Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0D01452g8.841ON32732717540.0
KLLA0D01551g8.841ON33132513820.0
Kwal_27.102558.841ON32932713620.0
NCAS0D049408.841ON32732513560.0
YPL273W (SAM4)8.841ON32532413490.0
TPHA0G03760singletonON33132313480.0
Ecym_46128.841ON32632513400.0
Suva_13.515na 1ON32532413320.0
KAFR0B00210singletonON32632313190.0
KLTH0C03850g8.841ON32932713020.0
Smik_6.4848.841ON32532412990.0
NDAI0F00250singletonON32932712871e-179
KNAG0B06970singletonON33231412751e-177
TDEL0E05690singletonON32832412441e-172
Suva_64.1singletonON27327311601e-161
Suva_16.17singletonON32432411501e-158
TDEL0E00240singletonON32832411331e-156
YLL062C (MHT1)na 2ON32432411301e-155
Smik_12.1na 2ON32432411261e-155
Skud_12.4na 2ON32532411031e-151
KAFR0F04420singletonON32632410901e-149
ABL125W8.841ON33632510691e-146
KAFR0L00150singletonON32632310451e-142
Suva_16.328.841ON25924810241e-140
TBLA0B032608.841ON3263219341e-125
Kpol_1068.78.841ON3233249261e-124
TPHA0I002608.841ON3233219111e-122
Skud_100.1singletonON2002008651e-117
Skud_101.1singletonON2002008631e-117
ZYRO0G14212g8.841ON3253278751e-117
SAKL0D09306gna 3ON3263367309e-95
Kwal_0.322na 3ON3323266213e-78
AFR410WsingletonON3703326062e-75
KLTH0H12716gna 3ON3483386014e-75
Skud_47.2singletonON96963985e-48
YMR321Cna 1ON1051013753e-44
TPHA0A002903.7ON170125740.56
TPHA0D044601.135ON81251731.3
TPHA0D043408.198ON43394684.4
CAGL0B02387g8.850ON47148676.1
Kpol_411.67.272ON97037677.4
Smik_8.2944.383ON79673677.7
TBLA0A090807.364ON59167677.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0D01452g
         (327 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {O...   680   0.0  
KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {O...   536   0.0  
Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {O...   529   0.0  
NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON}               526   0.0  
YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}  SAM4S-adenos...   524   0.0  
TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON}     523   0.0  
Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar ...   520   0.0  
Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {O...   517   0.0  
KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON}       512   0.0  
KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {O...   506   0.0  
Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W (...   504   0.0  
NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON}       500   e-179
KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON}             495   e-177
TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {...   483   e-172
Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)        451   e-161
Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON} ...   447   e-158
TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON}       441   e-156
YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}  MH...   439   e-155
Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL0...   438   e-155
Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON} YLL...   429   e-151
KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON}               424   e-149
ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-synteni...   416   e-146
KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON}      407   e-142
Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W (R...   399   e-140
TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.84...   364   e-125
Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}...   361   e-124
TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841 ...   355   e-122
Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   337   e-117
Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   337   e-117
ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} simil...   341   e-117
SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar...   285   9e-95
Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MH...   243   3e-78
AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-synte...   238   2e-75
KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} simi...   236   4e-75
Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)      157   5e-48
YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON} P...   149   3e-44
TPHA0A00290 Chr1 complement(39479..39991) [513 bp, 170 aa] {ON} ...    33   0.56 
TPHA0D04460 Chr4 complement(964925..967363) [2439 bp, 812 aa] {O...    33   1.3  
TPHA0D04340 Chr4 complement(932744..934045) [1302 bp, 433 aa] {O...    31   4.4  
CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {...    30   6.1  
Kpol_411.6 s411 complement(8774..11686) [2913 bp, 970 aa] {ON} c...    30   7.4  
Smik_8.294 Chr8 (481015..483405) [2391 bp, 796 aa] {ON} YHR204W ...    30   7.7  
TBLA0A09080 Chr1 complement(2243375..2245150) [1776 bp, 591 aa] ...    30   7.8  

>SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 327

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/327 (100%), Positives = 327/327 (100%)

Query: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60
           MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ
Sbjct: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60

Query: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120
           IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK
Sbjct: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120

Query: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180
           YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE
Sbjct: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180

Query: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240
           LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV
Sbjct: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240

Query: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGA 300
           SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGA
Sbjct: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGA 300

Query: 301 RIIGGCCRTSPQDIKDIVQAIEKYKSQ 327
           RIIGGCCRTSPQDIKDIVQAIEKYKSQ
Sbjct: 301 RIIGGCCRTSPQDIKDIVQAIEKYKSQ 327

>KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase,
          Length = 331

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/325 (75%), Positives = 289/325 (88%)

Query: 3   RQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQIV 62
           R PIK++F+E+PD +LVMDGGQGTELENRGI VANPVWST+PFI+ESFWS+++S+DR IV
Sbjct: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61

Query: 63  KEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDKYL 122
           K+MF+DFI+ G+ ILMT TYQTSFKSVSENTPI+TL+EYN LL+RIV+FSR CIGED+YL
Sbjct: 62  KQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYL 121

Query: 123 IGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHELK 182
           IGCIGAWGAHVC EFTGDYG +P++ID+ EYFRPQL NF  S+ ID+IGFETIPN+HEL+
Sbjct: 122 IGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELR 181

Query: 183 AILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCVSF 242
           AILSWDE+++SKPFYIGLSVHE GVLRDGT+M+++AD+I SLGDKLN NLM +GINC +F
Sbjct: 182 AILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAF 241

Query: 243 NHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGARI 302
           N SH+IL SLH   P+MP+IVYPNSGEIYDTVKKIWL NENQ  TWDDVVKSYIENGARI
Sbjct: 242 NQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGARI 301

Query: 303 IGGCCRTSPQDIKDIVQAIEKYKSQ 327
           IGGCCRT+  DIK++  A+ KY  Q
Sbjct: 302 IGGCCRTTVDDIKEVRLAVNKYAKQ 326

>Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {ON}
           YPL273W (SAM4) - S-adenosylmethionine:homocysteine
           S-methyltransferase [contig 37] FULL
          Length = 329

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/327 (74%), Positives = 289/327 (88%), Gaps = 2/327 (0%)

Query: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNE--SSRD 58
           M R  IK+F +++P E+LV+DGGQGTELENRGIKVANPVWSTIPFISESFWS E  SS+D
Sbjct: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60

Query: 59  RQIVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGE 118
           RQIVKEM+ DF+K G+R+LMT TYQ SFKSVSENT IKTL+EY+ LL RIV FSRECIG+
Sbjct: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120

Query: 119 DKYLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNV 178
           DK+L+GCIGAWGAH C EFTGDYGA PE+IDFL+YF+PQL NF ++E IDLIGFETIPN+
Sbjct: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180

Query: 179 HELKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGIN 238
           HEL+AILSWDESII+KPFYIGLSVHENG+LRDGTTM +VA++IKS GD+LNPN  LLGIN
Sbjct: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240

Query: 239 CVSFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIEN 298
           CVS+N SH IL SLH+ELP+MP+I YPNSGE+YDTVKKIW    +Q ++W+ +VKSYI++
Sbjct: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300

Query: 299 GARIIGGCCRTSPQDIKDIVQAIEKYK 325
           GARIIGGCCRTSP+DI+ I +A++KY+
Sbjct: 301 GARIIGGCCRTSPKDIEAIHEAVQKYR 327

>NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 241/325 (74%), Positives = 286/325 (88%), Gaps = 1/325 (0%)

Query: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60
           M RQ IK++ Q++PD++LV+DGGQGTELENRGI VANPVWSTIPF+SESFWS++SS DRQ
Sbjct: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60

Query: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120
           IVKEMF+DF+  G+ ILMTTTYQTSFKSVSENT IKTL+EYN+LL RIV+FSR+CIGE K
Sbjct: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120

Query: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180
           YLIGCIG WGAHVC EF GDYGA+PE ID+ +YF+PQL NF ++E +DLIGFET+PNV+E
Sbjct: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180

Query: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240
           LKAILSWDE I+SKPFYIGLSVHENGVLRDGTTM+E+ +I KSLG+K+NPNL+LLGINCV
Sbjct: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240

Query: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWL-HNENQKVTWDDVVKSYIENG 299
           SFNHS  IL  +HK LPDMP+I YPNSGE+YDTVKKIWL  N    +TW+ VVK YIE G
Sbjct: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG 300

Query: 300 ARIIGGCCRTSPQDIKDIVQAIEKY 324
           ARIIGGCCRT+P+DI +I +A++K+
Sbjct: 301 ARIIGGCCRTTPKDILEISKAVKKF 325

>YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}
           SAM4S-adenosylmethionine-homocysteine methyltransferase,
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 325

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/324 (73%), Positives = 283/324 (87%)

Query: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60
           MAR P+KQF  ++P ++LV+DGGQGTELENRGIKVANPVWSTIPFISESFWS+ESS +R+
Sbjct: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60

Query: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120
           IVKEMF+DF+  G+ ILMTTTYQTS+KSVSENTPI+TL EYN LL RIV FSR CIGEDK
Sbjct: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120

Query: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180
           YLIGCIG WGAH+C EFTGDYGA PE IDF +YF+PQL+NFN ++++DLIGFETIPN+HE
Sbjct: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180

Query: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240
           LKAILSWDESI+S+PFYIGLSVHE+GVLRDGTTM+E+A +IK LGDK+NPN   LGINCV
Sbjct: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240

Query: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGA 300
           SFN S  IL SLH+ LP+M ++ YPNSGE+YDT KKIWL N ++  +WD VVK YI +GA
Sbjct: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300

Query: 301 RIIGGCCRTSPQDIKDIVQAIEKY 324
           RIIGGCCRTSP+DI++I  A++KY
Sbjct: 301 RIIGGCCRTSPKDIQEISAAVKKY 324

>TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON} 
          Length = 331

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 238/323 (73%), Positives = 284/323 (87%)

Query: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60
           MARQ IK + QE+P+++LVMDGGQGTELENRGIKVANPVWSTIPFISESFWS++SS DR+
Sbjct: 1   MARQCIKNYLQENPNKVLVMDGGQGTELENRGIKVANPVWSTIPFISESFWSDQSSEDRK 60

Query: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120
           IVKEMF+DFI  G+ ILMTTTYQTSFKSVSENTPIK  K YN+LL RI+ FSR+CIGE++
Sbjct: 61  IVKEMFNDFINAGAEILMTTTYQTSFKSVSENTPIKNTKHYNELLNRIIDFSRDCIGEER 120

Query: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180
           YLIGCIG+WGAH+C EF GDYG +PE IDF EYF+PQL NF ++ ++DLIGFET+PN+HE
Sbjct: 121 YLIGCIGSWGAHICAEFHGDYGEHPENIDFYEYFKPQLDNFFNNNKLDLIGFETVPNIHE 180

Query: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240
           LKAILSWDE I+SKPFYIGLSVHENG+LRDGT+M+EVA++IK  G+KLNPNL LLGINCV
Sbjct: 181 LKAILSWDEKILSKPFYIGLSVHENGLLRDGTSMQEVANLIKGFGEKLNPNLTLLGINCV 240

Query: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGA 300
           S+NHS+ I+ S+HKELP++P+I YPNSGEIYDT KKIWL N+N   TWDD+VK YIE G 
Sbjct: 241 SYNHSNDIIKSIHKELPNLPLIAYPNSGEIYDTTKKIWLPNKNPIFTWDDIVKGYIEAGV 300

Query: 301 RIIGGCCRTSPQDIKDIVQAIEK 323
           RIIGGCCRT+P DIK +  A+++
Sbjct: 301 RIIGGCCRTTPNDIKAVTIAVKE 323

>Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ABL125W
          Length = 326

 Score =  520 bits (1340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 235/325 (72%), Positives = 280/325 (86%)

Query: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60
           M R  +KQ  Q +PD+IL+MDGGQGTELENRGI VANPVWSTIPFI++SFWS+ SSRDRQ
Sbjct: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINDSFWSDRSSRDRQ 60

Query: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120
           IV  MF+++I  G+ +LMT TYQ+SFKSVSENT IKTL+EYNQLL+RIVAFSR CIG D 
Sbjct: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120

Query: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180
           YL+GCIG+WGAH+C EF+GDYG +PERI +L+YFRPQL NFN  E ID+IGFETIPN+HE
Sbjct: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180

Query: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240
           L AILSWDESII KPFYIG+SVHE+G LRDGTTM +VA + +SLG KLNPN + LGINC 
Sbjct: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240

Query: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGA 300
           SF +SH+IL SLH+ELP +P+I YPNSGE+YDTVKKIWL NEN  VTWD++VKSY+++GA
Sbjct: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300

Query: 301 RIIGGCCRTSPQDIKDIVQAIEKYK 325
           RIIGGCCRT+P DI+ IV A++KYK
Sbjct: 301 RIIGGCCRTTPNDIRQIVTAVKKYK 325

>Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {ON}
           YPL273W (REAL)
          Length = 325

 Score =  517 bits (1332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 235/324 (72%), Positives = 282/324 (87%)

Query: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60
           MAR P+KQ   + P ++LV+DGGQGTELENRGIKVANPVWSTIPFISESFWS+ESS +R+
Sbjct: 1   MARIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60

Query: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120
           IVKEMF+DF+  G+ ILMT TYQTSFKSVSENTPIKTL  Y+ LL RIV FSR+CIGE+K
Sbjct: 61  IVKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEK 120

Query: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180
           +LIGCIG WGAHVCCEFTG+YG NPE IDF +YF+PQL NFN ++++DL+GFETIPN+HE
Sbjct: 121 HLIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHE 180

Query: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240
           LKAILSWDESI+SKPFYIGLSVHE+GVLRDGTTM+ VA +IK LGDK+NPN +LLGINCV
Sbjct: 181 LKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCV 240

Query: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGA 300
           SFN S  IL SLH+ LP+MP++ YPNSGE+YDT KKIW+ N ++  +WD VVK YI +GA
Sbjct: 241 SFNQSPDILESLHRALPNMPLLAYPNSGEVYDTEKKIWMPNSDKLNSWDTVVKQYIGSGA 300

Query: 301 RIIGGCCRTSPQDIKDIVQAIEKY 324
           RIIGGCCRT+P+DI+++  A++KY
Sbjct: 301 RIIGGCCRTTPKDIQEVSAAVKKY 324

>KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  512 bits (1319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 236/323 (73%), Positives = 275/323 (85%)

Query: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60
           M RQPIK++ +E+P ++LV+DGGQGTELENRGI VANPVWSTIPFISESFWSN SS+DR+
Sbjct: 1   MPRQPIKEYLEENPKKVLVLDGGQGTELENRGIHVANPVWSTIPFISESFWSNASSKDRE 60

Query: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120
           IVK MF DF+  G+ ILMT TYQTSFKSV+ENTPIKTLKEYN+LLERIV+FSR CIG++K
Sbjct: 61  IVKGMFQDFLDAGADILMTITYQTSFKSVTENTPIKTLKEYNELLERIVSFSRSCIGDEK 120

Query: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180
           YLIGCIG WGAHVC EF GDYG +PE ID+  YF+PQL NF  ++ +DLIGFET+PN HE
Sbjct: 121 YLIGCIGPWGAHVCAEFNGDYGGHPENIDYYAYFKPQLDNFFQNKDLDLIGFETVPNFHE 180

Query: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240
           LKAILSWD++I+SKPFYIGLSVHENGVLRDGTTM E+   IKSLG K+NPN +LLGINCV
Sbjct: 181 LKAILSWDDTILSKPFYIGLSVHENGVLRDGTTMNEIGYYIKSLGSKINPNFLLLGINCV 240

Query: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGA 300
           SF+ S  IL S+HKELPDMP+I YPNSGEIYDTVKKIWL N    +TW+DVV  YI+ GA
Sbjct: 241 SFSDSPDILESIHKELPDMPLIAYPNSGEIYDTVKKIWLPNHYSDITWNDVVNRYIKAGA 300

Query: 301 RIIGGCCRTSPQDIKDIVQAIEK 323
           RIIGGCCRT P DI+ +  A++K
Sbjct: 301 RIIGGCCRTMPDDIEQVSAAVKK 323

>KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 329

 Score =  506 bits (1302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 229/327 (70%), Positives = 282/327 (86%), Gaps = 2/327 (0%)

Query: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWS--NESSRD 58
           M R  +K++   +P+E+LV+DGGQGTELENRGIKVANPVWSTIPFIS+SFW+  + SS+D
Sbjct: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60

Query: 59  RQIVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGE 118
           RQIVKEM++DF+K G+R+LMT TYQ SFKSVSENT I TL+EY+ LL RIV+FSR CIG+
Sbjct: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120

Query: 119 DKYLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNV 178
           DK+L+GCIG WGAH C EFTGDYG+ PE+ID+L+YF+PQL NF  ++ +DLIGFETIPN+
Sbjct: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180

Query: 179 HELKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGIN 238
           HEL+AILSWD +I+ KPFYIGLSVHE+GVLRDGTTM EVA++IKSLGDK+NPN +LLGIN
Sbjct: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240

Query: 239 CVSFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIEN 298
           CVS+NHS  IL SLH+E+P++P+I YPNSGE+YDTVKKIW    +  +TWD VVKSYI++
Sbjct: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300

Query: 299 GARIIGGCCRTSPQDIKDIVQAIEKYK 325
           GARIIGGCCRTSP+DI  I  A+ KY+
Sbjct: 301 GARIIGGCCRTSPKDIAAINAAVNKYR 327

>Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W
           (REAL)
          Length = 325

 Score =  504 bits (1299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/324 (75%), Positives = 281/324 (86%)

Query: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60
           MAR P+KQ   ++P ++LV+DGGQGTELENRGIKVANPVWSTIPFISESFWS+ESS  R+
Sbjct: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSSSRK 60

Query: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120
           IVKEMF+DF+  G+ ILMTTTYQTS+KSVSENTPIKTL EYN LL RIV FSR CIGEDK
Sbjct: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120

Query: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180
           YLIGCIG WGAH+C EFTGDYGANPE IDF +YF+PQL NFN ++ +DLIGFETIPN+HE
Sbjct: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQLDNFNKNDNLDLIGFETIPNIHE 180

Query: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240
           LKAILSWDES++SKPFYIGLSVHE+GVLRDGTTM+EVA +IK LGDK+NPN  LLGINCV
Sbjct: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240

Query: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGA 300
           SFN S  IL SLH+ LPDM ++ YPNSGE+YDT KKIWL N ++  +WD VVK YI +GA
Sbjct: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGA 300

Query: 301 RIIGGCCRTSPQDIKDIVQAIEKY 324
           RIIGGCCRTSP+DI++I  A++KY
Sbjct: 301 RIIGGCCRTSPKDIQEIFTAVKKY 324

>NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  500 bits (1287), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 231/327 (70%), Positives = 278/327 (85%), Gaps = 1/327 (0%)

Query: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60
           M RQPIK +  E+P +IL++DGGQGTELENRGI VANPVWSTIPF+++SFWS +SS+DR+
Sbjct: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60

Query: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120
           IVK+MF+DF++ G+ ILMTTTYQTSFKSVSENT IKTLKEY++LL RIV FSR+CIGE+K
Sbjct: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120

Query: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180
           YLIGCIG WGAH+C EFTG+YG +PE ID+ EYF+PQL NF  ++ +D+IGFETIPNV+E
Sbjct: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180

Query: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240
           LK ILSW   I+ KPFYIGLSVHENGVLRDGTTM +VADII SL DKLNPNL+LLGINCV
Sbjct: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240

Query: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWL-HNENQKVTWDDVVKSYIENG 299
           S  HS  IL S+H  LPD+P+IVYPNSGE+YDTVKKIWL  N+   ++WD+VV+ Y++ G
Sbjct: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300

Query: 300 ARIIGGCCRTSPQDIKDIVQAIEKYKS 326
           ARIIGGCCRT+P DIK I  A+ KY +
Sbjct: 301 ARIIGGCCRTTPNDIKQISDAVHKYSN 327

>KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON} 
          Length = 332

 Score =  495 bits (1275), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 227/314 (72%), Positives = 269/314 (85%)

Query: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60
           M RQPI+++ + +P ++LV+DGGQGTELENRGI VANPVWST+PFI  SFWSN+SS+DR 
Sbjct: 1   MPRQPIQEYLKVNPRKVLVLDGGQGTELENRGINVANPVWSTVPFIDSSFWSNKSSKDRV 60

Query: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120
           IVK MFD F+  G+ ILMTTTYQTSFKSVSENTPI+ L+EY+ LL+RIV FSR+CIG DK
Sbjct: 61  IVKGMFDAFLDAGAEILMTTTYQTSFKSVSENTPIQNLEEYSSLLDRIVQFSRDCIGPDK 120

Query: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180
           YLIGCIG WGAHVC EF GDYG NP  ID+L YF+PQL NF  ++ +DLIGFETIPN+HE
Sbjct: 121 YLIGCIGPWGAHVCAEFNGDYGPNPAEIDYLSYFKPQLDNFFHNDNLDLIGFETIPNIHE 180

Query: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240
           L+AILSWDE+I+SKPFYIGLSVH NG+LRDG+TMK+VAD+IKS G KLN NL LLGINCV
Sbjct: 181 LRAILSWDETILSKPFYIGLSVHNNGLLRDGSTMKDVADLIKSFGGKLNKNLTLLGINCV 240

Query: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGA 300
           SF+ S  IL S+HKELPDMP+I YPNSGE+YDTVKKIWL N +  +TW++VV  YI+ GA
Sbjct: 241 SFSDSPDILESIHKELPDMPLIAYPNSGEVYDTVKKIWLPNRDMVMTWEEVVDRYIKAGA 300

Query: 301 RIIGGCCRTSPQDI 314
           RI+GGCCRTSP+DI
Sbjct: 301 RIVGGCCRTSPKDI 314

>TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {ON}
           
          Length = 328

 Score =  483 bits (1244), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 220/324 (67%), Positives = 271/324 (83%), Gaps = 1/324 (0%)

Query: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60
           M R PIK+   E   EILV+DGGQGTELENRGI+VANPVWSTIPF+SESFW++ SS++R+
Sbjct: 1   MVRIPIKKLVIESK-EILVLDGGQGTELENRGIEVANPVWSTIPFLSESFWTDSSSKERK 59

Query: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120
           IV+ +FDDF K GS ILMT TYQTSF S+ ENT  KTL EYN LL+RIV FSR CIG+++
Sbjct: 60  IVESVFDDFKKSGSNILMTITYQTSFTSIVENTQFKTLAEYNTLLDRIVKFSRSCIGDER 119

Query: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180
           YLIG +G WGAHVCCEFTG+YG +PE ID+ EYF+PQL NFN  ++IDLIGFET+PN HE
Sbjct: 120 YLIGSVGPWGAHVCCEFTGNYGLHPESIDYYEYFKPQLDNFNGQDEIDLIGFETVPNFHE 179

Query: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240
           LKAILSWDE+ I+KPFYIGLSVH NGVLRDGTTM+E+ + IK LG+K++ N +LLG+NCV
Sbjct: 180 LKAILSWDETKIAKPFYIGLSVHNNGVLRDGTTMEEIGEYIKGLGEKISSNFLLLGVNCV 239

Query: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGA 300
           SFN S  ++ S+HK LPDMP++ YPNSGE+YDT KKIW  N+++  +WD VV+SYI+NGA
Sbjct: 240 SFNDSSDMVKSIHKALPDMPLLAYPNSGEVYDTEKKIWFDNKDKLDSWDSVVRSYIDNGA 299

Query: 301 RIIGGCCRTSPQDIKDIVQAIEKY 324
           RIIGGCCRTSP+DI ++  A++KY
Sbjct: 300 RIIGGCCRTSPRDIAEVSAAVKKY 323

>Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)
          Length = 273

 Score =  451 bits (1160), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 206/273 (75%), Positives = 241/273 (88%)

Query: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60
           MAR P+KQ   + P ++LV+DGGQGTELENRGIKVANPVWSTIPFISESFWS+ESS +R+
Sbjct: 1   MARIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60

Query: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120
           IVKEMF+DF+  G+ ILMT TYQTSFKSVSENTPIKTL  Y+ LL RIV FSR+CIGE+K
Sbjct: 61  IVKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEK 120

Query: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180
           +LIGCIG WGAHVCCEFTG+YG NPE IDF +YF+PQL NFN ++++DL+GFETIPN+HE
Sbjct: 121 HLIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHE 180

Query: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240
           LKAILSWDESI+SKPFYIGLSVHE+GVLRDGTTM+ VA +IK LGDK+NPN +LLGINCV
Sbjct: 181 LKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCV 240

Query: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDT 273
           SFN S  IL SLH+ LP+MP++ YPNSGE+YDT
Sbjct: 241 SFNQSPDILESLHRALPNMPLLAYPNSGEVYDT 273

>Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON}
           YLL062C (REAL)
          Length = 324

 Score =  447 bits (1150), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 198/324 (61%), Positives = 260/324 (80%), Gaps = 1/324 (0%)

Query: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60
           M R  I++   EHP ++LV+DGGQGTELENRGI + +PVWS  PFIS+SFW + SS DR 
Sbjct: 1   MGRIAIEKLILEHPQKVLVLDGGQGTELENRGIDINSPVWSAAPFISDSFWESTSS-DRT 59

Query: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120
           +V+EM+ DF+  G+ +LMT TYQ +F S+SENT IKTL +YN+ L+R+V+F+R  IGED+
Sbjct: 60  LVEEMYRDFMDAGANVLMTVTYQANFSSISENTSIKTLSDYNRFLDRVVSFTRRVIGEDR 119

Query: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180
           YLIG IG W AHV  E+TGDYG++PE ID+L++F+ QL NFN   +IDLIGFET+PN HE
Sbjct: 120 YLIGSIGPWAAHVSSEYTGDYGSHPEDIDYLQHFKAQLDNFNKHTEIDLIGFETVPNFHE 179

Query: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240
           LKAILSWDE+IISKPFY+GLSVH+NG+LRDGTTM+E+A  +KSLG K+N + +LLG+NC+
Sbjct: 180 LKAILSWDENIISKPFYVGLSVHDNGLLRDGTTMEEIAAYVKSLGRKINRHFLLLGVNCI 239

Query: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGA 300
           SFN S  IL SLH+ LPDMP++ YPNSGE+YDT  K W   + ++ +W+ VV+ +I+NGA
Sbjct: 240 SFNQSTSILKSLHQALPDMPLLAYPNSGEVYDTKTKTWHQAKGKQNSWEVVVEEFIDNGA 299

Query: 301 RIIGGCCRTSPQDIKDIVQAIEKY 324
           RIIGGCCRTS +DI +I  A++K+
Sbjct: 300 RIIGGCCRTSAKDISEIASAVDKH 323

>TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  441 bits (1133), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 196/324 (60%), Positives = 259/324 (79%), Gaps = 1/324 (0%)

Query: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60
           M R P+++   +   +ILV+DGGQGTE+ENRGI+VANPVWS+IPF+SESFW++E S++R+
Sbjct: 1   MGRVPLRKVLTDS-RKILVLDGGQGTEMENRGIEVANPVWSSIPFVSESFWTDEWSKERK 59

Query: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120
           IV+E++ DF+  GS +LMT TYQ SFK+++ENT ++TL EYN LL+RIVAFSR CIG+++
Sbjct: 60  IVEEIYKDFMSSGSDMLMTVTYQASFKAIAENTELQTLSEYNSLLDRIVAFSRRCIGDER 119

Query: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180
           YL+G +G W A+   E+TGDYG + + ID+  Y++PQL NFN  E+ID+IG ET+PN HE
Sbjct: 120 YLVGSVGPWAAYNASEYTGDYGLHADSIDYYGYYKPQLDNFNKQEEIDMIGIETVPNFHE 179

Query: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240
           LKAILSWDE  I+KPFY+ L+ H++GVLRDGT M+++A  IK LG+ LNPN MLLGINCV
Sbjct: 180 LKAILSWDEKKIAKPFYVSLTTHDSGVLRDGTAMEDIAQYIKCLGNNLNPNFMLLGINCV 239

Query: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGA 300
           SFN S  IL  LH  LP+M ++ YPNSGE+Y+  KKIWL N+ +  +WD VVKS+I +GA
Sbjct: 240 SFNDSRDILELLHNALPEMLLLAYPNSGEVYEPKKKIWLANKCKTTSWDSVVKSFINSGA 299

Query: 301 RIIGGCCRTSPQDIKDIVQAIEKY 324
           RIIGGCCRTSPQDI D+  A++KY
Sbjct: 300 RIIGGCCRTSPQDIADVSIAVKKY 323

>YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}
           MHT1S-methylmethionine-homocysteine methyltransferase,
           functions along with Sam4p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 324

 Score =  439 bits (1130), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 200/324 (61%), Positives = 257/324 (79%), Gaps = 1/324 (0%)

Query: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60
           M R PIK+   EHP ++L++DGGQGTELENRGI + +PVWS  PF SESFW   SS++R+
Sbjct: 1   MKRIPIKELIVEHPGKVLILDGGQGTELENRGININSPVWSAAPFTSESFWE-PSSQERK 59

Query: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120
           +V+EM+ DF+  G+ ILMT TYQ +F+S+SENT IKTL  Y + L++IV+F+RE IGE++
Sbjct: 60  VVEEMYRDFMIAGANILMTITYQANFQSISENTSIKTLAAYKRFLDKIVSFTREFIGEER 119

Query: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180
           YLIG IG W AHV CE+TGDYG +PE ID+  +F+PQL+NFN +  IDLIGFETIPN HE
Sbjct: 120 YLIGSIGPWAAHVSCEYTGDYGPHPENIDYYGFFKPQLENFNQNRDIDLIGFETIPNFHE 179

Query: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240
           LKAILSWDE IISKPFYIGLSV +N +LRDGTT++E++  IK LG+K+N NL+L+G+NCV
Sbjct: 180 LKAILSWDEDIISKPFYIGLSVDDNSLLRDGTTLEEISVHIKGLGNKINKNLLLMGVNCV 239

Query: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGA 300
           SFN S LIL  LH+ LP MP++VYPNSGEIY+  +K W    N+   W+  VK +++NGA
Sbjct: 240 SFNQSALILKMLHEHLPGMPLLVYPNSGEIYNPKEKTWHRPTNKLDDWETTVKKFVDNGA 299

Query: 301 RIIGGCCRTSPQDIKDIVQAIEKY 324
           RIIGGCCRTSP+DI +I  A++KY
Sbjct: 300 RIIGGCCRTSPKDIAEIASAVDKY 323

>Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL062C
           (REAL)
          Length = 324

 Score =  438 bits (1126), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 196/324 (60%), Positives = 257/324 (79%), Gaps = 1/324 (0%)

Query: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60
           M R PI++   EHP ++LV+DGGQGTELENRGI + +PVWS  PF+S+SFW  +SSR+R+
Sbjct: 1   MKRIPIEKLLIEHPQKVLVLDGGQGTELENRGININSPVWSAAPFVSDSFWE-KSSRERK 59

Query: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120
           +V+EM+ DF+  G+ +LMT TYQ +FKS+S+NT IKTL  Y + L++IV FSR  IGE++
Sbjct: 60  VVEEMYRDFMNAGANVLMTITYQANFKSISKNTTIKTLPAYRRFLDQIVCFSRRLIGEER 119

Query: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180
           YLIG IG W AHV  E+TG+YG +PE ID+ E+FRPQL  FN +E IDLIGFETIPN HE
Sbjct: 120 YLIGSIGPWAAHVSSEYTGNYGPHPEDIDYYEFFRPQLDTFNENEDIDLIGFETIPNFHE 179

Query: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240
           LKAILSW E IIS+PFY+GLSVH+NG+LRDGTT++E++  IK LG K+N N +LLG+NC+
Sbjct: 180 LKAILSWGEDIISRPFYVGLSVHDNGLLRDGTTLEEISAHIKGLGSKINKNFLLLGVNCI 239

Query: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGA 300
           SFN S LIL +LH+ LPD P++VYPNSGEIYD  +K W H  ++  +WD  V+ +I++GA
Sbjct: 240 SFNQSTLILKALHEVLPDFPLLVYPNSGEIYDPKEKTWYHPTDKLDSWDVTVRKFIDSGA 299

Query: 301 RIIGGCCRTSPQDIKDIVQAIEKY 324
           RIIGGCCRTSP+DI +I  +++ Y
Sbjct: 300 RIIGGCCRTSPKDIAEIAASVDTY 323

>Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON}
           YLL062C (REAL)
          Length = 325

 Score =  429 bits (1103), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 191/324 (58%), Positives = 254/324 (78%), Gaps = 1/324 (0%)

Query: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60
           M R  I++   E+P  +LV+DGGQGTELENRGI +  PVWS  PF S+SFW  +SS DR+
Sbjct: 1   MKRISIEKLILEYPTRVLVLDGGQGTELENRGINIGGPVWSATPFTSDSFWE-QSSHDRE 59

Query: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120
           +V+EM+ DF+  G+ +LMT TYQ +FKS+SENT I+TL  YN  L+RIV+F+R  IGE++
Sbjct: 60  VVEEMYRDFMNAGANVLMTITYQANFKSISENTSIQTLSAYNGFLDRIVSFTRRFIGEER 119

Query: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180
           YL+G IG W AHV  E+TG+YG +PE ID+  +F+PQL +FN ++ IDLIGFET+PN HE
Sbjct: 120 YLVGSIGPWAAHVSSEYTGNYGPHPEDIDYYNFFKPQLDSFNENKDIDLIGFETVPNFHE 179

Query: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240
           LKAILSW E IISKPFY+GLSVH+NG+LRDGTTM+EV+  IK LG ++N +L+L+G+NC+
Sbjct: 180 LKAILSWGEDIISKPFYVGLSVHDNGLLRDGTTMEEVSAHIKGLGSRINKHLLLMGVNCI 239

Query: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGA 300
           SFN S LIL +LH+ LPD P++VYPNSGE+YD  +K W    ++  +WD  VK++I++GA
Sbjct: 240 SFNRSTLILRTLHESLPDTPLLVYPNSGEVYDVKEKTWHWPTDKPESWDITVKTFIDSGA 299

Query: 301 RIIGGCCRTSPQDIKDIVQAIEKY 324
           RIIGGCCRTSP+DI +I  A+ +Y
Sbjct: 300 RIIGGCCRTSPKDIAEIATAVRRY 323

>KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  424 bits (1090), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 190/324 (58%), Positives = 250/324 (77%)

Query: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60
           M R PIK++   + D+ILV+DGGQGTELE RGI +++PVWST+PFI+ESFWSN SS DR+
Sbjct: 1   MGRVPIKEYLLRNSDKILVLDGGQGTELEKRGINISSPVWSTLPFINESFWSNSSSNDRK 60

Query: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120
           I+K+M+ DFI  G+ +L TTTYQTSF S+SENT I+TLK+Y++LL RI  F+RECIG+ K
Sbjct: 61  IIKDMYSDFISAGADVLSTTTYQTSFASISENTNIQTLKDYHELLNRITKFTRECIGDSK 120

Query: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180
           YL+G IG + A++  E+TGD+G   + ID+  YF+PQL NFN S +ID+IGFETIPN+HE
Sbjct: 121 YLVGSIGTYAAYLSAEYTGDFGDAADTIDYHGYFKPQLDNFNRSTEIDIIGFETIPNIHE 180

Query: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240
           L+AILS ++  +SKPFYI LS +    LRDGT++K V D+IKS    LNPNL+LLGINC+
Sbjct: 181 LRAILSLNKKDLSKPFYISLSTNSKAQLRDGTSLKGVVDVIKSFESTLNPNLILLGINCI 240

Query: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGA 300
             N SHL +  L+  LP  P+IVYPNSGE YD V+KIWL +E+   TW+ +V  Y++ GA
Sbjct: 241 GLNSSHLTMEYLNNHLPQFPLIVYPNSGEKYDPVRKIWLADEDPAFTWEYIVHRYLDAGA 300

Query: 301 RIIGGCCRTSPQDIKDIVQAIEKY 324
           RI+GGCCRT+P DI+ I +AI+ Y
Sbjct: 301 RIVGGCCRTTPSDIRSISEAIKCY 324

>ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 336

 Score =  416 bits (1069), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 192/325 (59%), Positives = 237/325 (72%), Gaps = 2/325 (0%)

Query: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60
           M R PI+Q+ +E P  +LVMDGGQGTELENRGI VA+PVWS  PF+  + W    SR+R 
Sbjct: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60

Query: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120
           IV  +  DF+  G+ ++MT TYQ SF SV+ NT I TL++YN LL+RIV F RE +G+DK
Sbjct: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120

Query: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180
           YL+G IGAWGAHVC EFTGDYG  P+ ID+L YF+PQL NFN+   +DLIGFETIPN HE
Sbjct: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180

Query: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240
           L+AILSWDES+I+KPFY+ LSVH+ G LRDGT M +VA I+ +    LNPN + LGINC 
Sbjct: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMADVAAIVAAA-APLNPNFLGLGINCS 239

Query: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGA 300
           S + +  IL+ LH  LP +PM +YPNSGEIYD VKK+W +     V W  VV SYI +GA
Sbjct: 240 SLSRTPAILAELHALLPALPMTIYPNSGEIYDPVKKVW-NASPHVVDWGAVVASYIRSGA 298

Query: 301 RIIGGCCRTSPQDIKDIVQAIEKYK 325
           RIIGGCCRT P DI+ I  A+  + 
Sbjct: 299 RIIGGCCRTIPNDIRQIADAVRTHA 323

>KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  407 bits (1045), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 180/323 (55%), Positives = 250/323 (77%)

Query: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60
           M R P+K++ +E+P+++LV DGGQG ELE RG+ + + +WST PF+S+SFWS+ SS D +
Sbjct: 1   MVRVPLKKYLKENPEKVLVSDGGQGLELERRGLDIKHRLWSTRPFLSKSFWSDPSSNDIR 60

Query: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120
           IVK MF+DF+  G+ ILMTTTYQTSFK+VSE+T +K+L+EYN+LL++IV F+R CIG+++
Sbjct: 61  IVKGMFEDFVNAGAEILMTTTYQTSFKAVSESTELKSLREYNELLDKIVGFTRACIGDNR 120

Query: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180
           YLIG IG++GA V  E++GDYG +PE +DF  YF+PQL NF ++++ID++GFETI N  E
Sbjct: 121 YLIGSIGSYGALVGGEYSGDYGDSPETVDFYSYFKPQLDNFLNNDEIDIVGFETIANFTE 180

Query: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240
           LK++LSWDE  +SKPFYI LSVH+NG LRDGT M  + D IKSL   +NPNL  LG+NCV
Sbjct: 181 LKSLLSWDEKKVSKPFYISLSVHDNGNLRDGTPMHLITDYIKSLATAINPNLTFLGVNCV 240

Query: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGA 300
           ++N +  I+ S+H  LP MP+ V+PNSGE+++  K IW  N     +W+ VVK +I +G 
Sbjct: 241 NYNKATEIIDSIHNGLPTMPLSVFPNSGEVFNVEKGIWTANPEAAASWEAVVKRFISSGV 300

Query: 301 RIIGGCCRTSPQDIKDIVQAIEK 323
           RI+GGCCRT P DI+ I +A++K
Sbjct: 301 RIVGGCCRTRPHDIEQISKAVKK 323

>Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W
           (REAL)
          Length = 259

 Score =  399 bits (1024), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 181/248 (72%), Positives = 216/248 (87%)

Query: 77  LMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDKYLIGCIGAWGAHVCCE 136
           LMT TYQTSFKSVSENTPIKTL  Y+ LL RIV FSR+CIGE+K+LIGCIG WGAHVCCE
Sbjct: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70

Query: 137 FTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHELKAILSWDESIISKPF 196
           FTG+YG NPE IDF +YF+PQL NFN ++++DL+GFETIPN+HELKAILSWDESI+SKPF
Sbjct: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130

Query: 197 YIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCVSFNHSHLILSSLHKEL 256
           YIGLSVHE+GVLRDGTTM+ VA +IK LGDK+NPN +LLGINCVSFN S  IL SLH+ L
Sbjct: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190

Query: 257 PDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGARIIGGCCRTSPQDIKD 316
           P+MP++ YPNSGE+YDT KKIWL N ++  +WD VVK YI +GARIIGGCCRT+P+DI++
Sbjct: 191 PNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE 250

Query: 317 IVQAIEKY 324
           +  A++KY
Sbjct: 251 VSAAVKKY 258

>TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.841
           YPL273W
          Length = 326

 Score =  364 bits (934), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 168/321 (52%), Positives = 236/321 (73%), Gaps = 3/321 (0%)

Query: 3   RQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWS-NESSRDRQI 61
           RQ  K++F  HP+ ++VMDGGQGTELE RG+ V++ VWST+PFI   FW  +E S++  I
Sbjct: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 61

Query: 62  VKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDKY 121
           VK+MF  F+  GS+ LM+ TYQ SF ++S NT I+ L+EYN+LL +IV F RECIG  KY
Sbjct: 62  VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 121

Query: 122 LIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHEL 181
           LIG IG + +HV  E+TGDYG +PE +D+L YF+PQL NFN ++ IDLI  ET+PN +EL
Sbjct: 122 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQLDNFNDNDDIDLIAMETVPNKYEL 181

Query: 182 KAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCVS 241
           KA+LSWD + I KPFYI LSV ++G LRDGT+M  ++ + ++   K NPNLM++G+NCVS
Sbjct: 182 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 240

Query: 242 FNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKV-TWDDVVKSYIENGA 300
           ++ + +I+  L   +PD+P++ YPNSGE+YD + + W  N + K+ +W+ +VK  + NG 
Sbjct: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 300

Query: 301 RIIGGCCRTSPQDIKDIVQAI 321
           R++GGCCRT+P DI  I QA+
Sbjct: 301 RMVGGCCRTTPDDIHKIAQAV 321

>Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}
           complement(11996..12967) [972 nt, 324 aa]
          Length = 323

 Score =  361 bits (926), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 165/324 (50%), Positives = 236/324 (72%), Gaps = 3/324 (0%)

Query: 3   RQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNES-SRDRQI 61
           R PI++  +  PDE+LV DGG GT LE+RGI V++P+WST+PF+ + FW +E+ + DR I
Sbjct: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61

Query: 62  VKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDKY 121
           ++ ++ D+I  GSRIL T TYQTSF  +S +T +KT++ Y QL+  I +F R  IGED Y
Sbjct: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNY 121

Query: 122 LIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHEL 181
           LIG IG +GA +  E+TG+YG +P  I++LEYF+PQL+ FN+++ ID+IGFET+PN +EL
Sbjct: 122 LIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYEL 181

Query: 182 KAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCVS 241
           +AILSWD+S+ISKP+Y+ LS+ +NG LRDGT+ +E+A I K   +  N NL+L G NC+S
Sbjct: 182 EAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCIS 239

Query: 242 FNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGAR 301
           F ++   +S LH+ +P +P+IVYPNSGEIYD + K W  ++   +TW+D++K    +  R
Sbjct: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVR 299

Query: 302 IIGGCCRTSPQDIKDIVQAIEKYK 325
           I+GGCCRT+P DI  I   I K K
Sbjct: 300 IVGGCCRTTPDDINKIKDMITKVK 323

>TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841
           YPL273W
          Length = 323

 Score =  355 bits (911), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 162/321 (50%), Positives = 228/321 (71%), Gaps = 2/321 (0%)

Query: 3   RQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWS-NESSRDRQI 61
           R P ++F  EHP+EILV+DGGQGTELENRG+ + +P+WSTI F+++ FW  N  + +R+ 
Sbjct: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERKC 61

Query: 62  VKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDKY 121
           ++EMF+DF   G+ +  T TYQTSF SVSENT IK+L+EY++LL +I  F R CI +D Y
Sbjct: 62  IREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDY 121

Query: 122 LIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHEL 181
           L+GCIGA+ A +  E+ G+YG    +ID+L+YF+PQL  FN+   ID+IGFETIPN HEL
Sbjct: 122 LLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHEL 181

Query: 182 KAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCVS 241
           +AILSWDE II++PF+I LS+ +   LRDGT+ +E+  +      + N NL+ +G NC+S
Sbjct: 182 EAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCIS 240

Query: 242 FNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGAR 301
           + +S   +  LH  +P + +I YPNSGEIYD   K W      K++W++VV  Y + G +
Sbjct: 241 YAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGVK 300

Query: 302 IIGGCCRTSPQDIKDIVQAIE 322
           IIGGCCRT+P DIK I +A++
Sbjct: 301 IIGGCCRTTPDDIKQIKKAVD 321

>Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  337 bits (865), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 157/200 (78%), Positives = 177/200 (88%)

Query: 78  MTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDKYLIGCIGAWGAHVCCEF 137
           MTTTYQTS+KSVSENTPIKTL EYN LL RIV FSR CIGEDKYLIGCIG WGAH+CCEF
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRVCIGEDKYLIGCIGPWGAHICCEF 60

Query: 138 TGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHELKAILSWDESIISKPFY 197
           TGDYG +P+ IDF +YF+PQL NFN S+++DLIGFETIPNVHEL+AILSWDESI+SKPFY
Sbjct: 61  TGDYGPDPQSIDFYKYFKPQLDNFNKSDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 198 IGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCVSFNHSHLILSSLHKELP 257
           IGLSVHE+GVLRDGTTM+EVA +IK LGDK+NPN  LLGINCVSFN S  IL SLH+ LP
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQVLP 180

Query: 258 DMPMIVYPNSGEIYDTVKKI 277
           +M ++ YPNSGE+YDT KKI
Sbjct: 181 NMALLAYPNSGEVYDTEKKI 200

>Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  337 bits (863), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 157/200 (78%), Positives = 177/200 (88%)

Query: 78  MTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDKYLIGCIGAWGAHVCCEF 137
           MTTTYQTS+KSVSENTPIKTL EYN LL RIV FSR+CIGE+KYLIGCIG WGAH+C EF
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRDCIGENKYLIGCIGPWGAHICREF 60

Query: 138 TGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHELKAILSWDESIISKPFY 197
           TGDYG +PE IDF EYF+PQL NFN ++++DLIGFETIPNVHEL+AILSWDESI+SKPFY
Sbjct: 61  TGDYGPDPESIDFYEYFKPQLDNFNKNDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 198 IGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCVSFNHSHLILSSLHKELP 257
           IGLSVHE+GVLRDGTTM+EVA +IK LGDK+NPN  LLGINCVSFN S  IL SLH+ LP
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQALP 180

Query: 258 DMPMIVYPNSGEIYDTVKKI 277
           DM ++ YPNSGE+YDT KKI
Sbjct: 181 DMALLAYPNSGEVYDTEKKI 200

>ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 325

 Score =  341 bits (875), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 160/327 (48%), Positives = 230/327 (70%), Gaps = 10/327 (3%)

Query: 3   RQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWS-NESSRDRQI 61
           RQ + +  ++  D +LVMDGGQGTELENRG+ ++ P+WST+PF  E FW+ ++   DR +
Sbjct: 2   RQQLLEVLRD-TDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDV 60

Query: 62  VKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDKY 121
           V  MF  ++  G+++L T TYQTS+K++  +T I T  +Y+QLL+RIV F R CIG+D Y
Sbjct: 61  VNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHY 120

Query: 122 LIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHEL 181
           L+G IG + AHV  E+TGDYG  PE ID+ +YF PQ+ NFN +E ID+IG ET+PNVHEL
Sbjct: 121 LVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHEL 180

Query: 182 KAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCVS 241
           K+ILSWDE+ ISKPFY+ L V ++G LRDGT +++   ++    ++ N NL+L+GINC S
Sbjct: 181 KSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQ---LVPLFANRSNKNLLLVGINCCS 237

Query: 242 FNHSHLILSSLHKELPDMPM--IVYPNSGEIYDTVKKIWLHN---ENQKVTWDDVVKSYI 296
            + S   LS L++ L   PM  +VYPNSGEIYD   + W      ++ +++W  +V+ Y 
Sbjct: 238 LSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYR 297

Query: 297 ENGARIIGGCCRTSPQDIKDIVQAIEK 323
           + GAR IGGCCRT+P DI++I + +++
Sbjct: 298 KFGARAIGGCCRTTPLDIQEICKVVDR 324

>SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar to
           uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 326

 Score =  285 bits (730), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 150/336 (44%), Positives = 216/336 (64%), Gaps = 24/336 (7%)

Query: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60
           M RQPI ++ +     ILV+DGGQGTE+E RGI V +P+WST+PFI +    N +  +  
Sbjct: 1   MRRQPIAEYLES---SILVLDGGQGTEMERRGIDVIHPLWSTLPFIKK----NPTHLNH- 52

Query: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSE--NTPIKTLKEYNQLLERIVAFSR-ECIG 117
            +K M+ DF   G+R L T TYQ SF ++ +  +  + T ++Y Q L  I+ F+R +CI 
Sbjct: 53  -IKGMYHDFSTSGARALSTITYQASFATLKQYSDGQVVTEQQYQQFLNDIIGFTRDQCIS 111

Query: 118 EDKYLIGCIGAWGAHVC--CEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETI 175
           + +YLIGC+G + A++C   E++GDYG+  E+IDF +YF+PQL  F+  ++ID++GFETI
Sbjct: 112 DSQYLIGCVGPYAAYLCNGAEYSGDYGS--EKIDFKQYFKPQLDVFSRDDRIDMVGFETI 169

Query: 176 PNVHELKAILSWDESII--SKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLM 233
           PN+ ELK +LS D + +  +KPFYI +S   NG LRDGT + ++ + IK       PNL+
Sbjct: 170 PNIEELKTLLSKDFTSMLGTKPFYISISTDSNGNLRDGTPVAKICETIKDADKSTPPNLL 229

Query: 234 LLGINCVSFNHSHLILSSLHKELPD----MPMIVYPNSGEIYDTVKKIWLHNEN--QKVT 287
            LGINCV ++HS+ ILS L+  L D    +   VYPNSGEIYD     W  N     ++T
Sbjct: 230 FLGINCVDYHHSYNILSRLNGGLGDDCSLLFKAVYPNSGEIYDGNTHTWHTNSEIAPELT 289

Query: 288 WDDVVKSYIENGARIIGGCCRTSPQDIKDIVQAIEK 323
           W+ +V  + E   ++IGGCCRT+P DIK I  A+ K
Sbjct: 290 WNYLVSKFAEQKCQLIGGCCRTTPDDIKQIADAVNK 325

>Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MHT1)
           - S-methylmethionine:homocysteine S-methyltransferase
           [contig 86] FULL
          Length = 332

 Score =  243 bits (621), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 131/326 (40%), Positives = 193/326 (59%), Gaps = 24/326 (7%)

Query: 16  EILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQIVKEMFDDFIKVGSR 75
           EIL++DGGQGTELE RGI +A+P+WST+P++++        +  +I+KEM+  F   G  
Sbjct: 12  EILLLDGGQGTELEKRGINIAHPLWSTLPYVTKD------KKHLKIIKEMYSAFESAGCN 65

Query: 76  ILMTTTYQTSFKSVSENTP--IKTLKEYNQLLERIVAFSR-ECIGEDKYLIGCIGAWGAH 132
            LMT TYQ SF S+  ++   I   KEY + L+ ++ ++  +CI  + YL+G +G + A+
Sbjct: 66  ALMTITYQASFLSMKNHSDGLINNEKEYTRFLDYVIDYTENQCISPNSYLVGSVGPYAAY 125

Query: 133 VC--CEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHELKAILSWDES 190
           +    E++G Y    + IDF+E+FRPQ+Q+F  S +IDLIG ETIPN  E KA+L  + S
Sbjct: 126 LSNGAEYSGHYIE--DNIDFIEFFRPQVQHFAVSSRIDLIGIETIPNFEEFKALLRPEFS 183

Query: 191 IIS--KPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCVSFNHSHLI 248
            +   KP+YI ++    G LRDGT  +++ + IK     L PNL+  GINCVSF H   I
Sbjct: 184 RLCALKPYYISITTDNEGNLRDGTARQDICETIKRSAQDLPPNLVFFGINCVSFAHCADI 243

Query: 249 LSSLHKELPDMPM-------IVYPNSGEIYDTVKKIWLHNE--NQKVTWDDVVKSYIENG 299
           L  L+  L D+ +        VYPNSGE+Y      W  N       TW+++    ++ G
Sbjct: 244 LKLLNDSLDDIGVENRLRFRAVYPNSGEVYHGDTHSWGPNPEIGPADTWENLASKVVQQG 303

Query: 300 ARIIGGCCRTSPQDIKDIVQAIEKYK 325
             +IGGCCRTSP D++ I   +   K
Sbjct: 304 CLMIGGCCRTSPADLRQIASVVSDIK 329

>AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 370

 Score =  238 bits (606), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 127/332 (38%), Positives = 198/332 (59%), Gaps = 22/332 (6%)

Query: 2   ARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQI 61
           A+  I +F + +   +LVMDGG G ELE RG+ V +P+WST PF+      + ++ D   
Sbjct: 47  AKCAITEFLERN---VLVMDGGMGVELERRGMDVKSPLWSTAPFLR----GDRAALD--T 97

Query: 62  VKEMFDDFIKVGSRILMTTTYQTSFKS-VSENTPIKTLKEYNQLLERIVAFS-RECIGED 119
           ++ ++ +F   GSR + T TYQ SF S V  +  + +  +Y + LE++V F+ REC+   
Sbjct: 98  IRGLYREFRAAGSRGISTLTYQASFHSMVKYSGSVSSRADYEKFLEQVVDFTYRECVDPA 157

Query: 120 K-YLIGCIGAWGAHVC--CEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIP 176
           + Y+IG +G + A +C   E+TGDYG   E I+F  YF PQ+  F +  +ID I FET+P
Sbjct: 158 RDYIIGSVGPYAAFLCNGAEYTGDYGF--ETINFFNYFEPQVSKFATDPRIDAIAFETVP 215

Query: 177 NVHELKAILS--WDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLML 234
           NV EL A+L   +   + +KPFYI +S  +  VLRDGT +  V  +I+   D L PNL+ 
Sbjct: 216 NVVELMAMLQPEFHALLKNKPFYISISAKDEHVLRDGTPLAVVGQLIRERMDDLPPNLLC 275

Query: 235 LGINCVSFNHSHLILSSLHKELPDMPM---IVYPNSGEIYDTVKKIWLHNEN-QKVTWDD 290
            G+NCV    S  +L+ L+ +L D P+    +YPN   ++D     W  +++ + +TW +
Sbjct: 276 FGLNCVDLTRSAAMLAELNMQLQDCPIKFQAIYPNGTSVFDESLSAWRPSKDAESLTWAE 335

Query: 291 VVKSYIENGARIIGGCCRTSPQDIKDIVQAIE 322
            VK Y+    R+IGGCC T+PQD++ I +A++
Sbjct: 336 AVKLYLNQDCRMIGGCCGTTPQDMRQIAEALD 367

>KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 348

 Score =  236 bits (601), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 130/338 (38%), Positives = 201/338 (59%), Gaps = 29/338 (8%)

Query: 3   RQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQIV 62
           R+P+K+FF+   + IL++DGGQGTELE +G+ +++P+WST+PFI ++          + +
Sbjct: 2   RKPLKEFFK---NNILLLDGGQGTELEKKGVSISHPLWSTLPFIIKN------KTHLEAI 52

Query: 63  KEMFDDFIKVGSRILMTTTYQTSFKSVSENTP--IKTLKEYNQLLERIVAFS-RECIGED 119
           KEM+ DF + GS  LMT TYQ SF S+ + +   + + ++Y   L+ ++ F+ RECI  D
Sbjct: 53  KEMYRDFAEAGSNALMTITYQASFSSMKKYSEGLVNSEEDYAAFLDYVIGFTDRECITPD 112

Query: 120 KYLIGCIGAWGAHVC--CEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPN 177
           KYL+G +G +   +    E++G YG    +IDF++Y+ PQ+++F  S +IDLIG ETIPN
Sbjct: 113 KYLVGSVGPYAGLLSNGAEYSGYYGEG--KIDFIDYYSPQVKHFALSPRIDLIGIETIPN 170

Query: 178 VHELKAILSWDESIIS--KPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLL 235
           + E KA+LS + S +S  KP+YI ++   NG LRDGT++ E+   IK     L  N +  
Sbjct: 171 IDEFKALLSPEFSRLSFSKPYYISVTTDNNGCLRDGTSLNEICRAIKQSASLLPDNFVFF 230

Query: 236 GINCVSFNHSHLILSSLHKELPDMPMI--------VYPNSGEIYDTVKKIWLHN--ENQK 285
            INCV F H   IL SL+  L +M  +         YPNSGEIY      W  N     +
Sbjct: 231 AINCVEFLHCVEILQSLNDCL-EMQGVDRRFRFRGAYPNSGEIYHGGTHSWSSNPYAGPE 289

Query: 286 VTWDDVVKSYIENGARIIGGCCRTSPQDIKDIVQAIEK 323
            TW+++    +     ++GGCCRT  ++I+ +    +K
Sbjct: 290 DTWENLTLGLLSQECLMLGGCCRTGSEEIRQMALTTKK 327

>Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)
          Length = 96

 Score =  157 bits (398), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 71/96 (73%), Positives = 86/96 (89%)

Query: 1  MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60
          M R P+KQ  +++P ++LV+DGGQGTELENRGIKVANPVWSTIPFIS+SFWS+ESS +R+
Sbjct: 1  MVRLPLKQLLEDNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWSDESSANRK 60

Query: 61 IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIK 96
          IVK MF+DF+  G+ ILMTTTYQTS+KSVSENTPIK
Sbjct: 61 IVKGMFNDFLNAGAEILMTTTYQTSYKSVSENTPIK 96

>YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON}
           Putative protein of unknown function; proposed to be a
           palmitoylated membrane protein
          Length = 105

 Score =  149 bits (375), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 82/101 (81%)

Query: 224 LGDKLNPNLMLLGINCVSFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNEN 283
           LGDK+NPNL  LGINCVSFN S  IL SLH+ LP+M ++ YPNSGE+YDT KKIWL N +
Sbjct: 4   LGDKINPNLSFLGINCVSFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSD 63

Query: 284 QKVTWDDVVKSYIENGARIIGGCCRTSPQDIKDIVQAIEKY 324
           +  +WD VVK YI +GARIIGGCCRTSP+DI++I  A++KY
Sbjct: 64  KLNSWDTVVKQYISSGARIIGGCCRTSPKDIQEISAAVKKY 104

>TPHA0A00290 Chr1 complement(39479..39991) [513 bp, 170 aa] {ON}
           Anc_3.7 YOL143C
          Length = 170

 Score = 33.1 bits (74), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 53/125 (42%), Gaps = 16/125 (12%)

Query: 32  GIKVANPVWSTIPFISESFWSNESSRDRQ-IVKEMFDDFIKVGSRILMTTTYQTSFKSVS 90
           G+K  N +  T+P   E  W  +   DRQ  + E  D  I +G  I  +T +   F+ +S
Sbjct: 47  GVKEENIIVETVPGSYELPWGTKRFVDRQKKMGEPLDAVIPIGVLIKGSTMH---FEYIS 103

Query: 91  ENTPIKTLKEYNQLLERIV-----------AFSRECIGEDKYLIGCIGAWGAHVCCEFTG 139
           ++T    +K  NQ+   ++           AF+R  I E   +      WGA    E + 
Sbjct: 104 DSTTHALMKLQNQVQLPVIFGLLTCLTEEQAFARAGIDEGHTMHNHGEDWGA-AAVEMSV 162

Query: 140 DYGAN 144
            +G N
Sbjct: 163 KFGPN 167

>TPHA0D04460 Chr4 complement(964925..967363) [2439 bp, 812 aa] {ON}
           Anc_1.135 YJL200C
          Length = 812

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 12/51 (23%)

Query: 257 PDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGARIIGGCC 307
           P +P  V P S +I  T+ +            DD++K++ ENGA ++   C
Sbjct: 434 PKIPFFVTPGSEQIRATLDR------------DDIIKTFAENGATVLSNAC 472

>TPHA0D04340 Chr4 complement(932744..934045) [1302 bp, 433 aa] {ON}
           Anc_8.198 YER149C
          Length = 433

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 45/94 (47%), Gaps = 9/94 (9%)

Query: 31  RGIKVANP-VWSTIPFISES--FWSNESSRDRQIVKEMFDDFIKVGSRILMTTTYQTSFK 87
           +GI V  P V   + F+  +  F +NE S+ ++++KE   + IK       T   +T+FK
Sbjct: 240 KGIDVKPPMVDDPVDFLKGAIDFITNEISQHQKVIKEARQNTIKRSKSYKSTKELETAFK 299

Query: 88  SVSENTPIKTLK------EYNQLLERIVAFSREC 115
            +       T K      EY + +ER+ A +RE 
Sbjct: 300 DLQLAHSFLTRKFQNDREEYTKDIERLSATNREL 333

>CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {ON}
           weakly similar to uniprot|Q03264 Saccharomyces
           cerevisiae YMR285c or uniprot|Q03210 Saccharomyces
           cerevisiae YML118w
          Length = 471

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 24/48 (50%)

Query: 112 SRECIGEDKYLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQ 159
           +R+C+   K ++   G      C  FTGD+ + P  + +L   +P+ Q
Sbjct: 243 TRQCLVIKKKILEFAGTVKGDYCKMFTGDFNSQPNSVPYLVLTQPRAQ 290

>Kpol_411.6 s411 complement(8774..11686) [2913 bp, 970 aa] {ON}
           complement(8774..11686) [2913 nt, 971 aa]
          Length = 970

 Score = 30.4 bits (67), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 26/37 (70%), Gaps = 1/37 (2%)

Query: 75  RILMTTTYQTS-FKSVSENTPIKTLKEYNQLLERIVA 110
           +IL+T  Y T+  KS++E   I++LKE+N  LER++ 
Sbjct: 398 KILITRFYTTTQSKSMTEREVIESLKEFNSQLERLIT 434

>Smik_8.294 Chr8 (481015..483405) [2391 bp, 796 aa] {ON} YHR204W
           (REAL)
          Length = 796

 Score = 30.4 bits (67), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 33/73 (45%), Gaps = 6/73 (8%)

Query: 100 EYNQLLERIVAFSRECIGED---KYLIGCIGAWGAHVCCEFTGDYGANPERIDFLEY-FR 155
           E N L +RIV F++    +D   K + G I  +   +  E  G     P  +   EY + 
Sbjct: 538 EVNTLSQRIVGFAKSIFQQDQPDKEVAGVIPEY--QINAEIPGTCSMKPRHVIDNEYWYS 595

Query: 156 PQLQNFNSSEQID 168
           P L NFN   +ID
Sbjct: 596 PMLSNFNRLFEID 608

>TBLA0A09080 Chr1 complement(2243375..2245150) [1776 bp, 591 aa]
          {ON} Anc_7.364 YDL174C
          Length = 591

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 33/67 (49%)

Query: 33 IKVANPVWSTIPFISESFWSNESSRDRQIVKEMFDDFIKVGSRILMTTTYQTSFKSVSEN 92
          ++  NP+   IPF  + F S+  ++   I K  ++ +I V +  L    Y T  KS+S +
Sbjct: 16 LRTINPIKRAIPFTYKRFNSSSINKSFAIKKNNYNAYIGVVTISLGIIAYTTVTKSISND 75

Query: 93 TPIKTLK 99
            ++  K
Sbjct: 76 EEVEPEK 82

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,626,149
Number of extensions: 1699443
Number of successful extensions: 4967
Number of sequences better than 10.0: 48
Number of HSP's gapped: 5073
Number of HSP's successfully gapped: 48
Length of query: 327
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 217
Effective length of database: 40,868,139
Effective search space: 8868386163
Effective search space used: 8868386163
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)