Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0D01430g8.842ON44742022560.0
Suva_13.288.842ON53042217680.0
Smik_13.198.842ON53641417670.0
Skud_13.268.842ON53941417640.0
YML115C (VAN1)8.842ON53541417500.0
KAFR0A028308.842ON50741217230.0
NCAS0B003008.842ON52341717140.0
NDAI0E002908.842ON52241717110.0
ZYRO0G14234g8.842ON50941016950.0
KNAG0G034208.842ON51141616920.0
Kpol_541.158.842ON49840816890.0
KLLA0D01529g8.842ON50141516630.0
KLTH0C03828g8.842ON40439116380.0
TDEL0B005608.842ON50941416300.0
Ecym_46138.842ON52441716260.0
TBLA0B032708.842ON52041715970.0
ABL124W8.842ON48541115330.0
CAGL0B02321g8.842ON51241315250.0
TPHA0C047808.842ON52542314660.0
Kwal_27.102468.842ON33932514070.0
Ecym_35731.479ON44735010011e-132
NDAI0G003401.479ON5043509931e-130
SAKL0D11792g1.479ON4833509881e-130
NCAS0G041101.479ON4943509831e-129
YEL036C (ANP1)1.479ON5003519831e-129
Suva_5.331.479ON4953509821e-128
Smik_5.571.479ON4913509801e-128
Skud_5.541.479ON4913509801e-128
Kpol_370.51.479ON6453509921e-128
TBLA0B021701.479ON5723509861e-128
Kwal_27.101571.479ON4763509771e-128
CAGL0L01331g1.479ON4473509731e-128
KLTH0C03432g1.479ON4893519731e-127
KNAG0I003001.479ON4573529701e-127
KAFR0I027701.479ON4553509671e-127
TPHA0O004301.479ON5483519671e-125
NDAI0B012501.479ON4463529571e-125
TDEL0C026001.479ON4623519551e-125
KLLA0E22155g1.479ON4503509521e-125
AFR357W1.479ON4343519471e-124
ZYRO0F05170g1.479ON6083529381e-120
CAGL0L12804g8.500ON3933504525e-51
TPHA0L013708.500ON3923444518e-51
TBLA0H033408.500ON3933444482e-50
KLLA0E12849g8.500ON3923474464e-50
NCAS0C023308.500ON3933444465e-50
KNAG0A021508.500ON3963474465e-50
SAKL0H11110g8.500ON3933474456e-50
Smik_16.1868.500ON3953474404e-49
KLTH0E11616g8.500ON3943504352e-48
TDEL0B013708.500ON3963474316e-48
Skud_16.2328.500ON3953474301e-47
KAFR0H013908.500ON3983444282e-47
Kwal_27.118648.500ON4533444294e-47
YPL050C (MNN9)8.500ON3953474254e-47
Suva_16.2658.500ON3953444239e-47
Kpol_1031.788.500ON3923474231e-46
ZYRO0F08492g8.500ON3963444221e-46
AGL259C8.500ON3893424212e-46
NDAI0E030208.500ON3963544177e-46
NCAS0B024408.500ON4003414045e-44
Ecym_25508.500ON3903433871e-41
NDAI0C052508.500ON4023443661e-38
KNAG0A039908.500ON3571752313e-20
SAKL0H20438gsingletonON5652101695e-12
YCR019W (MAK32)1.440ON363133722.3
AGL343C5.8ON30779694.5
Ecym_21586.257ON189065688.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0D01430g
         (447 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {...   873   0.0  
Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}...   685   0.0  
Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}...   685   0.0  
Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}...   684   0.0  
YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}  V...   678   0.0  
KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.8...   668   0.0  
NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,...   664   0.0  
NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,...   663   0.0  
ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} simi...   657   0.0  
KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.8...   656   0.0  
Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON} (41403..4...   655   0.0  
KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {...   645   0.0  
KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {...   635   0.0  
TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {O...   632   0.0  
Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar...   630   0.0  
TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.8...   619   0.0  
ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic ho...   595   0.0  
CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} simila...   592   0.0  
TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON} Anc_1...   569   0.0  
Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {...   546   0.0  
Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {O...   390   e-132
NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}...   387   e-130
SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} simila...   385   e-130
NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479    383   e-129
YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}  AN...   383   e-129
Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON} Y...   382   e-128
Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON} Y...   382   e-128
Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON} Y...   382   e-128
Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)...   386   e-128
TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {O...   384   e-128
Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {...   380   e-128
CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa] ...   379   e-128
KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {...   379   e-127
KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}...   378   e-127
KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.4...   377   e-127
TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.47...   377   e-125
NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {O...   373   e-125
TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {O...   372   e-125
KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]...   371   e-125
AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic ...   369   e-124
ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} simila...   365   e-120
CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} hig...   178   5e-51
TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8....   178   8e-51
TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.5...   177   2e-50
KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]...   176   4e-50
NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {O...   176   5e-50
KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {O...   176   5e-50
SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {...   176   6e-50
Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {...   174   4e-49
KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} high...   172   2e-48
TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {O...   170   6e-48
Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {...   170   1e-47
KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {O...   169   2e-47
Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050...   169   4e-47
YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON} ...   168   4e-47
Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {...   167   9e-47
Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON} (1970...   167   1e-46
ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly...   167   1e-46
AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON} S...   166   2e-46
NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {O...   165   7e-46
NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {O...   160   5e-44
Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar...   153   1e-41
NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON} Anc_8...   145   1e-38
KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {O...    94   3e-20
SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, ...    70   5e-12
YCR019W Chr3 (152837..153928) [1092 bp, 363 aa] {ON}  MAK32Prote...    32   2.3  
AGL343C Chr7 complement(72374..73297) [924 bp, 307 aa] {ON} Synt...    31   4.5  
Ecym_2158 Chr2 (294821..300493) [5673 bp, 1890 aa] {ON} similar ...    31   8.3  

>SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 447

 Score =  873 bits (2256), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/420 (100%), Positives = 420/420 (100%)

Query: 15  GGDPYVNYKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYE 74
           GGDPYVNYKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYE
Sbjct: 15  GGDPYVNYKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYE 74

Query: 75  KEVEMLLGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHE 134
           KEVEMLLGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHE
Sbjct: 75  KEVEMLLGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHE 134

Query: 135 LIDLAFLVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYM 194
           LIDLAFLVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYM
Sbjct: 135 LIDLAFLVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYM 194

Query: 195 NQDYLNMVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGR 254
           NQDYLNMVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGR
Sbjct: 195 NQDYLNMVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGR 254

Query: 255 ARNWLTANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQA 314
           ARNWLTANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQA
Sbjct: 255 ARNWLTANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQA 314

Query: 315 YDLNSWVESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGG 374
           YDLNSWVESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGG
Sbjct: 315 YDLNSWVESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGG 374

Query: 375 VSILAKAKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           VSILAKAKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL
Sbjct: 375 VSILAKAKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434

>Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}
           YML115C (REAL)
          Length = 530

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/422 (76%), Positives = 365/422 (86%), Gaps = 4/422 (0%)

Query: 16  GDPYV---NYKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNER 72
           G+P +   NYKT  L+D EYYNYDF++ID +++ K+D G +H+LI+Q G+EVLTP DNE+
Sbjct: 96  GNPLLGSENYKTIDLEDEEYYNYDFEDIDPEVVSKFDDGVQHYLITQFGSEVLTPGDNEK 155

Query: 73  YEKEVEMLLGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYP 132
           Y++E+ MLL +TV+ YDL+ +EG+ NG E RDH+LLC+PLRNA +VLPLMFKHLMNLTYP
Sbjct: 156 YQEEMSMLLDSTVEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYP 215

Query: 133 HELIDLAFLVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLK 192
           HELIDLAFLVSDCSE D TLDALIAYS++LQNGTLSE+F E D +   +  KG+  LYLK
Sbjct: 216 HELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVI-DSQTKGTDKLYLK 274

Query: 193 YMNQDYLNMVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLM 252
           YM++DY+N V  AF PPFH +YDKPFRSVQVFQKDFGQVIGQGFSDRHAV VQGIRRKLM
Sbjct: 275 YMDEDYINRVHQAFSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLM 334

Query: 253 GRARNWLTANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGE 312
           GRARNWLTANALKPYHSWVYWRD D+ELCPGSVI+DLMS N DV VPNVWRPLP FL  E
Sbjct: 335 GRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSE 394

Query: 313 QAYDLNSWVESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGV 372
           Q YDLNSW+ESGEAL LA TLDEDDVIVEGYAEYPTWRVHL YIR+   +P E++DLDGV
Sbjct: 395 QPYDLNSWMESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGV 454

Query: 373 GGVSILAKAKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDD 432
           GGVSILAKAK+FR GV FPAFTFENHAETEAFGKMAKKM YRVGGLPHYT+WHIYEPSDD
Sbjct: 455 GGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDD 514

Query: 433 DL 434
           DL
Sbjct: 515 DL 516

>Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}
           YML115C (REAL)
          Length = 536

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/414 (76%), Positives = 364/414 (87%), Gaps = 1/414 (0%)

Query: 21  NYKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEML 80
           NYKT  L+D EYY+YDF++ID +++ K+D G EH+LISQ G++VLTP+D+E+Y+ E+ ML
Sbjct: 108 NYKTIDLEDEEYYDYDFEDIDPEVVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSML 167

Query: 81  LGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAF 140
           L +TV+ YDLS++EG+ NG E RDH+LLCVPLRNA +VLPLMFKHLMNLTYPHELIDLAF
Sbjct: 168 LDSTVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAF 227

Query: 141 LVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLN 200
           LVSDCSEDD TLDALIAYS++LQNGTLS++F E D +   +  KG+  LYL+YM+Q+Y+N
Sbjct: 228 LVSDCSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVI-DSQTKGTDKLYLQYMDQNYIN 286

Query: 201 MVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLT 260
            V  AF PPFH++YDKPFRSVQ+FQKDFGQVIGQGFSDRHAV VQGIRRKLMGRARNWLT
Sbjct: 287 RVRQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLT 346

Query: 261 ANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSW 320
           ANALKPYHSWVYWRD D+ELCPGS+I+DLMS N DV VPNVWRPLP FL  EQ YDLNSW
Sbjct: 347 ANALKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSW 406

Query: 321 VESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAK 380
           +ES E L+LA TLDEDDVIVEGYAEYPTWRVHL YIR+ + +P E++DLDGVGGVSILAK
Sbjct: 407 MESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAK 466

Query: 381 AKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           AKLFR GV FPAFTFENHAETEAFGKMAKKM YRVGGLPHYT+WHIYEPSDDDL
Sbjct: 467 AKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520

>Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}
           YML115C (REAL)
          Length = 539

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/414 (77%), Positives = 361/414 (87%), Gaps = 1/414 (0%)

Query: 21  NYKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEML 80
           NYKT  L+D EYYNYDF++ID ++I K+D G +H+LISQ G+EVL PE+ E Y+KE+ ML
Sbjct: 108 NYKTIDLEDEEYYNYDFEDIDPEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNML 167

Query: 81  LGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAF 140
           L +TV+ YDLS +EG+ NG E RDH+LLC+PLRNA +VLPLMFKHLMNLTYPHELIDLAF
Sbjct: 168 LDSTVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAF 227

Query: 141 LVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLN 200
           LVSDCSE D TLDALIAYS++LQNGTLS++F + D +   +  KG+  LYLKYM++DY+N
Sbjct: 228 LVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAII-DSQTKGTDKLYLKYMDEDYIN 286

Query: 201 MVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLT 260
            V  AF PPFH +YDKPFRSVQ+FQKDFGQVIGQGFSDRHAV VQGIRRKLMGRARNWLT
Sbjct: 287 RVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLT 346

Query: 261 ANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSW 320
           ANALKPYHSWVYWRD D+ELCPGSVIEDLMS N DV VPNVWRPLP FL  EQAYDLNSW
Sbjct: 347 ANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSW 406

Query: 321 VESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAK 380
           +ES EAL+LA TLDEDDVIVEGYAEYPTWRVHL YIR+ + NP E++DLDGVGGVSILAK
Sbjct: 407 MESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAK 466

Query: 381 AKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           AK+FR GV FPAFTFENHAETEAFGKMAKKM YRVGGLPHYT+WHIYEPSDDDL
Sbjct: 467 AKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520

>YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}
           VAN1Component of the mannan polymerase I, which contains
           Van1p and Mnn9p and is involved in the first steps of
           mannan synthesis; mutants are vanadate-resistant
          Length = 535

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/414 (76%), Positives = 360/414 (86%), Gaps = 1/414 (0%)

Query: 21  NYKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEML 80
           NYKT  L+D EYY+YDF++ID ++I K+D G +H+LISQ G+EVLTP+D+E+Y++E+ ML
Sbjct: 108 NYKTIDLEDEEYYDYDFEDIDPEVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNML 167

Query: 81  LGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAF 140
             +TV+ YDLS +EG+ NG E RDH+LLC+PLRNA +VLPLMFKHLMNLTYPHELIDLAF
Sbjct: 168 FDSTVEEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAF 227

Query: 141 LVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLN 200
           LVSDCSE D TLDALIAYS+ LQNGTLS++F E D +   +  KG+  LYLKYM++ Y+N
Sbjct: 228 LVSDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVI-DSQTKGTDKLYLKYMDEGYIN 286

Query: 201 MVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLT 260
            V  AF PPFH++YDKPFRSVQ+FQKDFGQVIGQGFSDRHAV VQGIRRKLMGRARNWLT
Sbjct: 287 RVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLT 346

Query: 261 ANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSW 320
           ANALKPYHSWVYWRD D+ELCPGSVI+DLMS N DV VPNVWRPLP FLG EQ YDLNSW
Sbjct: 347 ANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSW 406

Query: 321 VESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAK 380
           +ES EAL LA TLDEDDVIVEGYAEYPTWRVHL YIR+ + +P E +DLDGVGGVSILAK
Sbjct: 407 MESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAK 466

Query: 381 AKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           AK+FR GV FPAFTFENHAETEAFGKMAKKM YRVGGLPHYT+WHIYEPSDDDL
Sbjct: 467 AKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520

>KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.842
           YML115C
          Length = 507

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/412 (75%), Positives = 359/412 (87%), Gaps = 1/412 (0%)

Query: 23  KTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEMLLG 82
           KT +L D EYYN+DF++ID  +IQK+D+GA+H+LISQ G +VLTPED E YE+E+ ML  
Sbjct: 85  KTINLSDQEYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTDVLTPEDQEIYEREMNMLYD 144

Query: 83  ATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLV 142
           +T++ YDL  + G+ NGAENRDHVLLC+PLR+A +VLPLMF+HLMNLTYPHELIDLAFLV
Sbjct: 145 STIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLV 204

Query: 143 SDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMV 202
           SDCSE+D+TLDALI +SK LQNGTLS++  E D   ++ +   S +L+LKYM+ +YL  V
Sbjct: 205 SDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKS-NLHLKYMDPEYLKRV 263

Query: 203 EMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTAN 262
           + AF PPFH+DYDKPFRSVQ+F+K+FGQ+IGQGFSDRHAV VQGIRRKLMGRARNWLTAN
Sbjct: 264 QKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 323

Query: 263 ALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVE 322
           ALKPYHSWVYWRD DIELCPGSVIEDLM+ + DV VPNVWRPLP FL GEQ YDLNSW E
Sbjct: 324 ALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRE 383

Query: 323 SGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAK 382
           S EALKLA TLDEDDVIVEGYAEYPTWRVHL YIR+P  NP E++D+DGVGGVSILAKAK
Sbjct: 384 SAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPDEVVDIDGVGGVSILAKAK 443

Query: 383 LFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           LFR+GV FPAFTFENHAETEAFGKMAKKM Y+VGGLPHYT+WHIYEPSDDDL
Sbjct: 444 LFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDL 495

>NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,
           523 aa] {ON} Anc_8.842
          Length = 523

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/417 (74%), Positives = 359/417 (86%), Gaps = 2/417 (0%)

Query: 20  VNYKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEM 79
            +YKT  L ++EYY++DF++I+  +++K+D G +H+LISQ G +VLTP DNE Y KE++M
Sbjct: 94  ASYKTKQLTENEYYDHDFEDIEPAVVKKFDNGVQHYLISQYGTDVLTPSDNEVYAKELQM 153

Query: 80  LLGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLA 139
           +L A+V+ YDLS + GS NGA NRDH+LLCVPLR+A +VLPLMFKHLMNLTYPHELIDLA
Sbjct: 154 VLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLA 213

Query: 140 FLVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQD--EMRRKASIKGSPDLYLKYMNQD 197
           FLVSDCSE D TLDAL+AYSK LQNGTLS++F E D  EM      KG+ +L+LKYMN D
Sbjct: 214 FLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPD 273

Query: 198 YLNMVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARN 257
           YL +V+ +FK   H +YDKPFRS+QVFQKDFGQ+IGQGFSDRHAV VQGIRRKLMGRARN
Sbjct: 274 YLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARN 333

Query: 258 WLTANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDL 317
           WL ANALKPYH+WVYWRD DIELCPGSVIEDLMS + DV VPNVWRPLPEFL GEQ YDL
Sbjct: 334 WLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDL 393

Query: 318 NSWVESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSI 377
           NSW+ES EALKLA TLDEDDVIVEGYAEYPTWRVHL YIR+   +P E++DLDGVGGVSI
Sbjct: 394 NSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSI 453

Query: 378 LAKAKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           LAKAK+FR+GV FPAFTFENHAETEAFGKMA+KM +RVGGLPHYT+WHIYEPSDDDL
Sbjct: 454 LAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDL 510

>NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,
           522 aa] {ON} Anc_8.842
          Length = 522

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/417 (73%), Positives = 361/417 (86%), Gaps = 2/417 (0%)

Query: 20  VNYKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEM 79
            +YKT  L D EYYNYDF+NI+ D++ K++ G +H+LIS+ G +VLTP+D E+YEKE+ M
Sbjct: 92  TSYKTTELSDKEYYNYDFENIEADVLGKFENGVQHYLISEFGTDVLTPKDKEQYEKELAM 151

Query: 80  LLGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLA 139
           LL A+V+ YDL K++GS NGAENRDH+LLCVPLR+A +VLPLMFKHLMN+TYPHELIDLA
Sbjct: 152 LLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLA 211

Query: 140 FLVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKAS--IKGSPDLYLKYMNQD 197
           FLVSDCS+ D+TL+AL+ YS+ LQNGTLS++F + DE + + S   +G+ +L+LKYMNQ+
Sbjct: 212 FLVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQE 271

Query: 198 YLNMVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARN 257
           YL MVE AF  P H++YDKPFRSVQ+F+KDFGQVIGQGFSDRHAV VQGIRRKLMGRARN
Sbjct: 272 YLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARN 331

Query: 258 WLTANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDL 317
           WL ANALKPYHSWVYWRD DIELCPG+++ED+M+ + DV VPNVWRPLPEFL  EQ YDL
Sbjct: 332 WLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDL 391

Query: 318 NSWVESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSI 377
           NSW+ES EALKLA TL EDDVIVEGYAEYPTWRVHL YIR    +P  ++DLDGVGGVSI
Sbjct: 392 NSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSVVDLDGVGGVSI 451

Query: 378 LAKAKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           LAKAKLFR+GVHFPAFTFENHAETE FGKMAK+M YRVGGLPHYT+WHIYEPSDDDL
Sbjct: 452 LAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDL 508

>ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115C VAN1
           Mannosyltransferase with a role in protein N-
           glycosylation
          Length = 509

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/410 (76%), Positives = 358/410 (87%), Gaps = 2/410 (0%)

Query: 27  LKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEMLLGATVD 86
           L++  YY+YDF++ID  +I+K+D G +H+LI+Q G +VLTP+D E +E+E +MLL +TV+
Sbjct: 87  LEEDAYYDYDFEDIDPKVIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKMLLSSTVE 146

Query: 87  VYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCS 146
            YDLS + GS NGA N +HVLLCVPLR+A  VLPLMFKHLMNLTYPHELIDLAFLVSDC+
Sbjct: 147 SYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSDCT 206

Query: 147 EDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASI--KGSPDLYLKYMNQDYLNMVEM 204
           EDD TLDALIAYS++LQ+GTLS++FA+ D+   +A    KG+  LYLKYMN DYL  V+ 
Sbjct: 207 EDDKTLDALIAYSRQLQSGTLSQVFADMDQAAAEAEQASKGTEKLYLKYMNPDYLETVKE 266

Query: 205 AFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANAL 264
           +F PPFH++YDKPFRSVQVFQKDFGQ+IGQGFSDRHAV VQGIRRKLMGRARNWLTANAL
Sbjct: 267 SFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 326

Query: 265 KPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESG 324
           KPYHSWVYWRD D+ELCPGSVIEDLMS + DVAVPNVWRPLP+FL GEQ YDLNSW+ESG
Sbjct: 327 KPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWMESG 386

Query: 325 EALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLF 384
           EAL LA TLDEDDVIVEGYAEYPT+RVHL YIR+P  +P EILDLDGVGGVSILAKA+LF
Sbjct: 387 EALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAELF 446

Query: 385 RAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           R G+ FPAFTFENHAETE FGKMAKKM YRVGGLPHYT+WHIYEPSDDDL
Sbjct: 447 RRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDL 496

>KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.842
           YML115C
          Length = 511

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/416 (73%), Positives = 362/416 (87%), Gaps = 2/416 (0%)

Query: 21  NYKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEML 80
           NYKT +L+++EYYNYDF+ +D  +I K+D+G +H+LIS+ G +VLTP+D ERYE EV+ L
Sbjct: 83  NYKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEVKQL 142

Query: 81  LGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAF 140
             +TV  YDL+++ GS +G  NRDHVL+CVPLR+A  VLPLMFKHLMNLTYPHELID+AF
Sbjct: 143 FDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAF 202

Query: 141 LVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRR--KASIKGSPDLYLKYMNQDY 198
           LVSDCS+DD+TL+ALIAYS++LQNGTLS++F E D +     A  + +  LYLKYM Q+Y
Sbjct: 203 LVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEY 262

Query: 199 LNMVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNW 258
           LN VE AF PP+H++YDKPFRSVQ+F+K+FGQ+IGQGFSDRHAV VQGIRRKLMGR+RNW
Sbjct: 263 LNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNW 322

Query: 259 LTANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLN 318
           LTANALKPYHSWVYWRD DIELCPGSVI+D+M+ + DV VPNVWRPLPEFL GEQ YDLN
Sbjct: 323 LTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLN 382

Query: 319 SWVESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSIL 378
           SW+ES EAL+LA TLDEDDVIVEGYAEYPTWRVHL YIR+ + +P E++DLDGVGGVSIL
Sbjct: 383 SWMESPEALELAETLDEDDVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSIL 442

Query: 379 AKAKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           A+AKLFR GV FPAFTFENHAETEAFGKMA+K+ +RVGGLPHYT+WHIYEPSDDDL
Sbjct: 443 ARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDL 498

>Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON}
           (41403..42899) [1497 nt, 499 aa]
          Length = 498

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/408 (74%), Positives = 353/408 (86%), Gaps = 3/408 (0%)

Query: 27  LKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEMLLGATVD 86
           L+D+EYY+YDFKN D  +++K+D GA+H+LIS+ G+EVLTPED  RYE+E++ LL  TV 
Sbjct: 81  LEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSEVLTPEDKSRYEQELQELLSTTVQ 140

Query: 87  VYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCS 146
            YDLSKY G+ENG +NR+HVLLCVPLR+A +VLPLMFK++MNLTYPHELIDLAFLVSDC+
Sbjct: 141 NYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCT 200

Query: 147 EDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAF 206
           E D TL++LIAYS+ LQ+GTL+ LF E D   +  S K S  LYLKYMN+DYL MVE A+
Sbjct: 201 EGDHTLESLIAYSRHLQDGTLAGLFQEMD---KDDSKKDSEKLYLKYMNKDYLKMVEDAY 257

Query: 207 KPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKP 266
            PPFH DY+KPFRSVQ+FQKDFGQ +GQGF++RH+V VQGIRRKLMGRARNWL  NALKP
Sbjct: 258 SPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKP 317

Query: 267 YHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESGEA 326
           YH+WVYWRD D+ELCPG+VIEDLMS N DV VPNVWRPLPEFL  EQ YDLNSW+ES EA
Sbjct: 318 YHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEA 377

Query: 327 LKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLFRA 386
           LKLA  LDEDDVIVEGYAEYPTWRVHL YIR  + NP +++DLDGVGGVSIL KAKLFR+
Sbjct: 378 LKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRS 437

Query: 387 GVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           G+HFPAFTFENHAETEAFGKMAKKM +RVGGLPHYT+WHIYEPSDDDL
Sbjct: 438 GIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDL 485

>KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 501

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/415 (71%), Positives = 352/415 (84%), Gaps = 2/415 (0%)

Query: 20  VNYKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEM 79
           + Y   SL + EYY+YDFK +D+D I+KYD+G  H++IS+GG E L+ ED E +E+E +M
Sbjct: 74  MQYIPTSLDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGMEALSSEDKEAFEREADM 133

Query: 80  LLGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLA 139
           LL +T D+YDLS+Y G+ NGA NRDHVLLCVPLR+A ++LP++FK+LMNLTYPHELID+A
Sbjct: 134 LLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIA 193

Query: 140 FLVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYL 199
           FLVSDC+++  T+ +L+ +SKELQNGTLS+    QD    K     +  LYLKYM +DYL
Sbjct: 194 FLVSDCTDNGRTMSSLLDFSKELQNGTLSKTL--QDFEADKDKGNSAEQLYLKYMGKDYL 251

Query: 200 NMVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWL 259
            MV+ AF PPFH DYDKPFRS+Q+F+KDFGQ IGQGFSDRHAV VQG+RRKLMGRARNWL
Sbjct: 252 KMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWL 311

Query: 260 TANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNS 319
           TANALKPYHSWVYWRDVD+ELCPG+VIEDLM  + DV VPNVWRPLP FLGG QAYDLNS
Sbjct: 312 TANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNS 371

Query: 320 WVESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILA 379
           WVES EA+KLA TLDEDDVIVEGYAEYPTWRVHLGY+R  + NP ++LDLDGVGGVSILA
Sbjct: 372 WVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPDDLLDLDGVGGVSILA 431

Query: 380 KAKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           +A+LFR G+HFPAFTFENHAETEAFGKMAKKM ++VGGL HYT+WHIYEPSDDDL
Sbjct: 432 RAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDL 486

>KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 404

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/391 (76%), Positives = 337/391 (86%)

Query: 44  IIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEMLLGATVDVYDLSKYEGSENGAENR 103
           +++K+D GAEH+LIS+GG E+L   D ERYE+EV+ LL +TV+ YDL  +EGS  G  NR
Sbjct: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60

Query: 104 DHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDDTLDALIAYSKELQ 163
           +HVLL VPLRNA  VLPLMFK+LMNLTYPHELIDLAFLVSDCSEDD TL+AL+ Y KELQ
Sbjct: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120

Query: 164 NGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAFKPPFHKDYDKPFRSVQV 223
           +GTLS++FA           KG+ DL+LKYM   YL MV+ A+ PPFHK YDKPFRSVQ+
Sbjct: 121 SGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSVQI 180

Query: 224 FQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPYHSWVYWRDVDIELCPG 283
           FQKDFGQ+IGQGFSDRHAV VQGIRRKLMGRARNWLTANALKPYHSWVYWRD D+ELCPG
Sbjct: 181 FQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 240

Query: 284 SVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESGEALKLANTLDEDDVIVEGY 343
           SVI+DLMS + DVAVPNVWRPLPEFL GEQ YDLNSW+ES  AL+LA TLDEDDVIVEGY
Sbjct: 241 SVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVEGY 300

Query: 344 AEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLFRAGVHFPAFTFENHAETEA 403
           AEYPTWRVHL Y+R+PD+NP +I++LDGVGGVSILAKAKLFR GVHFPAFTFENHAETEA
Sbjct: 301 AEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAETEA 360

Query: 404 FGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           FGKMAKKM YRV GLPHYT+WHIYEPSDDDL
Sbjct: 361 FGKMAKKMGYRVAGLPHYTLWHIYEPSDDDL 391

>TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {ON}
           Anc_8.842 YML115C
          Length = 509

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/414 (71%), Positives = 353/414 (85%), Gaps = 1/414 (0%)

Query: 21  NYKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEML 80
           +Y T +L D  YY+YDF+NID D+I+K+D G  ++ I+Q G E +T E+  ++E+EV ML
Sbjct: 84  SYDTITLSDEAYYDYDFENIDPDVIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVSML 143

Query: 81  LGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAF 140
           L +TV+ YD+ ++ G+ N AEN++HVLLCVPLR+A NVLPLMFKHLMN+TYPHELIDLAF
Sbjct: 144 LDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAF 203

Query: 141 LVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLN 200
           LVSDCSE D TLDALIAYS++LQNGTLS++FAE  EM  K   KG  +LYL+YM+QDYL 
Sbjct: 204 LVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEV-EMSEKERKKGGENLYLQYMDQDYLQ 262

Query: 201 MVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLT 260
            V+ +F PPFH++YDK FRSVQ+FQKDFGQ IGQGFSDRHAV VQG+RRKLM RARNWLT
Sbjct: 263 RVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLT 322

Query: 261 ANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSW 320
           ANALKPYHSWVYWRD D+ELCPGSVI+DLM+ + DV VPNVWRPLP FL G+Q YDLNSW
Sbjct: 323 ANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSW 382

Query: 321 VESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAK 380
           +ES EAL LA TLDEDDVIVEGYAEYPTWR HL Y R+ + +P E+++LDGVGGVSILA+
Sbjct: 383 IESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILAR 442

Query: 381 AKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           A+LFR G+HFPAFTFENHAETEAFGKMAKKM +RVGGLPHYT+WHIYEPSDDDL
Sbjct: 443 ARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDL 496

>Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii ABL124W
          Length = 524

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/417 (71%), Positives = 345/417 (82%), Gaps = 5/417 (1%)

Query: 21  NYKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEML 80
           +Y T  L++ EYYN++++ +D+D +++YD G +H LI Q G   L     E +E+ ++ML
Sbjct: 97  SYDTAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDG--TLNSNQEEGFEEHLDML 154

Query: 81  LGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAF 140
           L  TV+ YDLSKY G+ NGAENR+HVL+CVPLRNA NVLPLMF+HLMNLTYPHELIDLAF
Sbjct: 155 LSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAF 214

Query: 141 LVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQD--EMRRKASIKGSP-DLYLKYMNQD 197
           LVSDCS+DD T+D+LI+Y++ELQ GTLS+    QD  +M +K+  K    DL+LKYMN+D
Sbjct: 215 LVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYKMHKKSKSKNKEGDLHLKYMNKD 274

Query: 198 YLNMVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARN 257
           YLNMVE A K PFHK+YDKPFRSVQ+FQKDFGQ+IGQGFSDRH V VQG RRKLMG+ARN
Sbjct: 275 YLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARN 334

Query: 258 WLTANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDL 317
           WLTANALKPYHSWVYWRD D+ELCPGSVIEDLMS+  DV VPNVWRPLPEFLG EQ YDL
Sbjct: 335 WLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDL 394

Query: 318 NSWVESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSI 377
           NSW+ES  AL LA TLDEDDVIVEGYAEY TWR HL   R+P  N  ++LDLDGVGGVSI
Sbjct: 395 NSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSI 454

Query: 378 LAKAKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           LAKAKLFR GVHF AF FENHAETEAFGKMAKKM YRVGGL HYT+WHIYEPS+DDL
Sbjct: 455 LAKAKLFRNGVHFAAFAFENHAETEAFGKMAKKMGYRVGGLSHYTLWHIYEPSNDDL 511

>TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.842
           YML115C
          Length = 520

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/417 (70%), Positives = 350/417 (83%), Gaps = 3/417 (0%)

Query: 21  NYKTFS-LKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEM 79
           NYK    L+D EYY+YDF++ID      +D+G +H+LI+Q G +V+T +D ERY +E+E 
Sbjct: 90  NYKNAKELEDVEYYDYDFRSIDEMSFHNFDQGEQHYLITQYGGDVVTSKDKERYIQEMEN 149

Query: 80  LLGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLA 139
           LL ++VD YDLS++EG+ NGAENR+H+L   PLR+A +VLP+MFKHLMNLTYPHELID+A
Sbjct: 150 LLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIA 209

Query: 140 FLVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKG-SPDL-YLKYMNQD 197
           FLVSDCSE D TLD LI +++ LQ+GTL ++F + D    K+  K  +P+  YLK+M+Q+
Sbjct: 210 FLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQN 269

Query: 198 YLNMVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARN 257
           Y+ M + +F  P H +Y+KPFRSVQ+FQKDFGQ+IGQGFSDRHAV VQGIRRKLMGRARN
Sbjct: 270 YIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARN 329

Query: 258 WLTANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDL 317
           WLTANALKPYHSWVYWRD D+ELCPGSVI+DLMS N DV VPNVWRPLPEFL  EQ YDL
Sbjct: 330 WLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDL 389

Query: 318 NSWVESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSI 377
           NSW+ESGEAL+LA TLDEDDVIVEGYAEYPTWRVHL Y+R+P+ +P + LD+DGVGGVSI
Sbjct: 390 NSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSI 449

Query: 378 LAKAKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           LAKAKLFR GVHFPAFTFENHAETEAFGKMAKKM Y VGGLP+Y +WHIYEPSDDDL
Sbjct: 450 LAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDL 506

>ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML115C (VAN1)
          Length = 485

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/411 (68%), Positives = 332/411 (80%), Gaps = 6/411 (1%)

Query: 27  LKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEMLLGATVD 86
           L D EYY+Y+F     + + KYD+G EH+ +++ G       D+  +E+++E L+ ATV+
Sbjct: 65  LDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ---ISRDDPEFEEQMEELVSATVE 121

Query: 87  VYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCS 146
            YDL  YEG+ NGAENR+HVL+C+PLRNA  VLP+MFKHLMNLTYPHELID+AFLVSDCS
Sbjct: 122 QYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDCS 181

Query: 147 EDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIK---GSPDLYLKYMNQDYLNMVE 203
           E+D TL +L+ Y+  LQ GTL+ + A ++   ++   K   G  DLYLKYM+Q+YL MV 
Sbjct: 182 ENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMVR 241

Query: 204 MAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANA 263
            AF PP+H++Y+KPFRSVQVF+KDFGQ IGQGFSDRH V VQGIRR+LMGRARNWLTANA
Sbjct: 242 DAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTANA 301

Query: 264 LKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVES 323
           LKPYHSWVYWRDVD+ELCPGSVIEDLMS+  DV VPNVWRPLPEFLGG+Q YDLNSW+ES
Sbjct: 302 LKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIES 361

Query: 324 GEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKL 383
            +AL LA  L+EDDVIVEGYAEY TWR HL   R    NP E++DLDGVGGVSILAKAKL
Sbjct: 362 TDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAKL 421

Query: 384 FRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           FR G HF AF FENHAETEAFGKMAKKM Y+VGGLPHYT+WHIYEPSDDD+
Sbjct: 422 FRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDI 472

>CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115c VAN1
           Vanadate resistance protein
          Length = 512

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/413 (67%), Positives = 335/413 (81%), Gaps = 3/413 (0%)

Query: 22  YKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEMLL 81
           Y  F  KD  Y+++DF++ID+DI+ K+D+G  ++LIS+ G E  +  D   Y   ++MLL
Sbjct: 93  YLPFEFKDAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQMLL 152

Query: 82  GATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFL 141
            +TV+ YDL  ++GS +G E ++H+L+CVPLR+A  VLPLMFK+LMNLTYPHELIDLAFL
Sbjct: 153 DSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFL 212

Query: 142 VSDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNM 201
           VSDCSE D TL+AL  YS+ LQ G L ++ A+ D   +    K +  ++LKYM  DYL  
Sbjct: 213 VSDCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKG---KSNESIHLKYMEPDYLKR 269

Query: 202 VEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTA 261
           V+ A+KPPFH +Y KPFRSVQ+FQKDFGQVIGQGFSDRHAV VQGIRRKLMGRARNWL +
Sbjct: 270 VKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMS 329

Query: 262 NALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWV 321
           NALKPYHSWVYWRD D+ELCPGSVIEDLM  + DV VPNVWRPLP+FL   Q YDLNSW+
Sbjct: 330 NALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWM 389

Query: 322 ESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKA 381
           ES EAL+LA TLDEDDVIVEGYAEYPT+RVHL YIR  D +P +++DLDGVGGVSILA+A
Sbjct: 390 ESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARA 449

Query: 382 KLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           ++FR GVHF AFTFENHAETEAFGKMAKK+ +RVGGLPHYT+WHIYEPSDDDL
Sbjct: 450 RVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDL 502

>TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON}
           Anc_1.479 YEL036C
          Length = 525

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/423 (65%), Positives = 338/423 (79%), Gaps = 9/423 (2%)

Query: 20  VNYKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLI---SQGGAEVLTPEDNERYEKE 76
           V + T  L   EYYNYDF + ++D I KYDKG   +L+          L+ +  E Y+ E
Sbjct: 92  VTFDTQVLTAPEYYNYDFHDYNLDTISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAE 151

Query: 77  VEMLLGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELI 136
           +  LL ++VD+YD+  + G+ +G  +R+HVLLC+PLR+A +VLPLMFK+LMNLTYPHELI
Sbjct: 152 LPKLLSSSVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELI 211

Query: 137 DLAFLVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQD---EMRRKASIKGSPD--LYL 191
           D+AFLVSDCSE+D TL++L+ Y++ LQNGTL ++F E D   EM  K  ++ + D  LYL
Sbjct: 212 DVAFLVSDCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKV-VENADDSKLYL 270

Query: 192 KYMNQDYLNMVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKL 251
           KYM ++YL  V+ AFK PFH++YDKPFRS+Q+++KDFGQ +GQ FSDRH V VQGIRRKL
Sbjct: 271 KYMKKEYLQRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKL 330

Query: 252 MGRARNWLTANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGG 311
           MGRARNWL  NALKPYHSWVYWRD D+ELCPG+VIEDLMS + DV VPNVWRPLPEF+  
Sbjct: 331 MGRARNWLMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNS 390

Query: 312 EQAYDLNSWVESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDG 371
           EQ YDLNSW+ES EA+ LA  L ED+VIVEGYAEYPTWRVHL Y+R  D +P +++D+DG
Sbjct: 391 EQPYDLNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKDGDPNQVVDVDG 450

Query: 372 VGGVSILAKAKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSD 431
           VGGVSILA+A+LFRAGVHFPAFTFENHAETEAFGKMAKKM +RVGGLPHYT+WHIYEPSD
Sbjct: 451 VGGVSILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSD 510

Query: 432 DDL 434
           DDL
Sbjct: 511 DDL 513

>Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {ON}
           YML115C (VAN1) - mannosyltransferase [contig 38] FULL
          Length = 339

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/325 (79%), Positives = 279/325 (85%)

Query: 110 VPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDDTLDALIAYSKELQNGTLSE 169
           VPLRNA  VLPLMFK+LMNLTYPHELIDLAFLVSDCSEDD T +AL+ Y+KELQ+GTLS+
Sbjct: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61

Query: 170 LFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAFKPPFHKDYDKPFRSVQVFQKDFG 229
           +FA  +        +GS DL+LKYM   YL MV+ AF PPFHK+YDKPFRSVQ+FQK+FG
Sbjct: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121

Query: 230 QVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPYHSWVYWRDVDIELCPGSVIEDL 289
           QVIGQ FSDRHAV VQG RRKLMGRARNWLTANALKPYHSWVYWRD D+ELCPGSVIEDL
Sbjct: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181

Query: 290 MSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESGEALKLANTLDEDDVIVEGYAEYPTW 349
           M+   DV VPNVWRPLPEFL GEQAYDLNSWVES  AL LA  LDEDDVIVEGYAEYPTW
Sbjct: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241

Query: 350 RVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLFRAGVHFPAFTFENHAETEAFGKMAK 409
           RVHLGYIR  D +P   +DLDGVGGVSILAKA+LFR GVHFPAFTFENHAETEAFGKMAK
Sbjct: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301

Query: 410 KMHYRVGGLPHYTVWHIYEPSDDDL 434
           KM Y V GLPHYT+WHIYEPSDDDL
Sbjct: 302 KMGYSVAGLPHYTLWHIYEPSDDDL 326

>Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {ON}
           similar to Ashbya gossypii AFR357W
          Length = 447

 Score =  390 bits (1001), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 189/350 (54%), Positives = 239/350 (68%), Gaps = 48/350 (13%)

Query: 85  VDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSD 144
           VD YDLS Y+G+++G +  D VL CVPLR+A N LP+ FKHL ++TYPH LIDL+FLVSD
Sbjct: 50  VDYYDLSNYQGNKDGWQRADRVLFCVPLRDAANHLPMFFKHLKSMTYPHNLIDLSFLVSD 109

Query: 145 CSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEM 204
            +  DDT+  L+         +L +L ++ D  +R                         
Sbjct: 110 ST--DDTMGVLL--------NSLHDLQSQADGTKR------------------------- 134

Query: 205 AFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANAL 264
                        F  +++FQKDFGQ+IGQ FSDRH    QG RRKLM RARNWL + A+
Sbjct: 135 -------------FGDIEIFQKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSAAI 181

Query: 265 KPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESG 324
           KPYHSWVYWRDVD+E  P +++EDLM  + D+ VPNVWRPLP++L   Q YDLNSWVES 
Sbjct: 182 KPYHSWVYWRDVDVEYVPETILEDLMHHDKDIIVPNVWRPLPKWLNYIQPYDLNSWVESE 241

Query: 325 EALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLF 384
             L+LA +L EDDVIVEGY EY TWRVHL Y+R+P+ +P   ++LDG+GGVSIL+KAK+F
Sbjct: 242 GGLQLAASLKEDDVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSKAKVF 301

Query: 385 RAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           R G HFPAF+FE HAETEAFGK++++M Y V GLPHY +WH+YEPS DDL
Sbjct: 302 RTGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDL 351

>NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}
           Anc_1.479 YEL036C
          Length = 504

 Score =  387 bits (993), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 189/350 (54%), Positives = 240/350 (68%), Gaps = 48/350 (13%)

Query: 85  VDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSD 144
           V+ YDL+ Y+G+++G +  D +L CVPLR+A   LP+ F HL  ++YPH  IDL+FLVSD
Sbjct: 87  VEFYDLANYQGNKDGWQKNDRILFCVPLRDAAEHLPMFFDHLNKMSYPHNSIDLSFLVSD 146

Query: 145 CSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEM 204
            S  DDT+  L++    LQN       ++QD+ +R                         
Sbjct: 147 SS--DDTMGVLLS---NLQNAQ-----SQQDKSKR------------------------- 171

Query: 205 AFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANAL 264
                        F ++++F+KDFGQVIGQ FSDRH    QG RRKLM RARNWL + A+
Sbjct: 172 -------------FGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAI 218

Query: 265 KPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESG 324
           KPYHSWVYWRDVD+E  P +++EDLM  + DV VPNVWRPLP++LG  Q YDLNSW ES 
Sbjct: 219 KPYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 278

Query: 325 EALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLF 384
             L+LA+TL EDDVIVEGY EY TWR HL Y+R+P+ NP + ++LDG+GGVSILAKAK+F
Sbjct: 279 GGLQLADTLGEDDVIVEGYPEYATWRSHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVF 338

Query: 385 RAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           R G HFPAF+FE HAETEAFGK+++KM+Y V GLPHY +WHIYEPS +DL
Sbjct: 339 RTGSHFPAFSFEKHAETEAFGKLSRKMNYNVIGLPHYVIWHIYEPSKEDL 388

>SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 483

 Score =  385 bits (988), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 187/350 (53%), Positives = 237/350 (67%), Gaps = 48/350 (13%)

Query: 85  VDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSD 144
           V+ YDL+ Y+G+ +G +  D VL CVPLR+A   LP+ FKH+  ++YPH LIDL+FLVSD
Sbjct: 82  VEYYDLNNYQGNADGWQRGDRVLFCVPLRDAAEHLPMFFKHMDEISYPHNLIDLSFLVSD 141

Query: 145 CSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEM 204
            S  DDT+  L++  K+ Q        + QD+ +R                         
Sbjct: 142 SS--DDTMGVLLSSLKKAQ--------SNQDKSQR------------------------- 166

Query: 205 AFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANAL 264
                        F ++++F+KDFGQVIGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 167 -------------FGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAL 213

Query: 265 KPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESG 324
           KPYHSWVYWRDVD+E  P +++EDLM  N DV VPNVWRPLP++LG  Q YDLNSW ES 
Sbjct: 214 KPYHSWVYWRDVDVETIPRTILEDLMHHNKDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 273

Query: 325 EALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLF 384
             L+LA++L+ED VIVEGY EY TWR HL Y+R+P  +P   ++LDG+GGVSIL+KAK+F
Sbjct: 274 GGLQLADSLEEDAVIVEGYPEYATWRTHLAYMRDPSGDPEAEMELDGIGGVSILSKAKVF 333

Query: 385 RAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           R G HFPAF+FE HAETEAFGK++++M Y V GLPHY +WH+YEPS DDL
Sbjct: 334 RTGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDL 383

>NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479
          Length = 494

 Score =  383 bits (983), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 185/350 (52%), Positives = 240/350 (68%), Gaps = 48/350 (13%)

Query: 85  VDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSD 144
           V+ YDL  Y+G+++G +  D +L CVPLR+A   LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 82  VEFYDLGNYQGNKDGWQRNDRILFCVPLRDAAEHLPMFFDHLNKMTYPHNLIDLSFLVSD 141

Query: 145 CSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEM 204
            S  D+T+  L++    LQN       ++QD  +R                         
Sbjct: 142 SS--DNTMGVLLS---NLQNAQ-----SQQDRSKR------------------------- 166

Query: 205 AFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANAL 264
                        F ++++F+KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + A+
Sbjct: 167 -------------FGNIEIFEKDFGQIIGQSFSDRHGFKAQGPRRKLMARARNWLGSVAI 213

Query: 265 KPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESG 324
           KPYHSWVYWRDVD+E  P +++EDLM  + DV VPNVWRPLP++LG  Q YDLNSW ES 
Sbjct: 214 KPYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQESE 273

Query: 325 EALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLF 384
             L+LAN+LDED VIVEGY EY TWR HL Y+R+P+ NP + ++L+G+GGVSIL+KAK+F
Sbjct: 274 GGLQLANSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELNGIGGVSILSKAKVF 333

Query: 385 RAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           R+G HFPAF+FE HAETEAFGK++++M++ V GLPHY +WHIYEPS +DL
Sbjct: 334 RSGSHFPAFSFEKHAETEAFGKLSRRMNFNVIGLPHYVIWHIYEPSKEDL 383

>YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}
           ANP1Subunit of the alpha-1,6 mannosyltransferase
           complex; type II membrane protein; has a role in
           retention of glycosyltransferases in the Golgi; involved
           in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol
          Length = 500

 Score =  383 bits (983), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 185/351 (52%), Positives = 240/351 (68%), Gaps = 48/351 (13%)

Query: 84  TVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVS 143
           +V+ YDL  Y+G+++G +  D +L CVPLR+A   LP+ F HL  +TYPH LIDL+FLVS
Sbjct: 61  SVEFYDLRNYQGNKDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVS 120

Query: 144 DCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVE 203
           D S  D+T+  L++  +  Q        ++QD+ +R                        
Sbjct: 121 DSS--DNTMGVLLSNLQMAQ--------SQQDKSKR------------------------ 146

Query: 204 MAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANA 263
                         F ++++++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + A
Sbjct: 147 --------------FGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVA 192

Query: 264 LKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVES 323
           LKPYHSWVYWRDVD+E  P +++EDLM  + DV VPNVWRPLP++LG  Q YDLNSW ES
Sbjct: 193 LKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKES 252

Query: 324 GEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKL 383
              L+LA++LDED VIVEGY EY TWR HL Y+R+P+ NP + ++LDG+GGVSILAKAK+
Sbjct: 253 EGGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKV 312

Query: 384 FRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           FR G HFPAF+FE HAETEAFG+++++M+Y V GLPHY +WHIYEPS DDL
Sbjct: 313 FRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDL 363

>Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON}
           YEL036C (REAL)
          Length = 495

 Score =  382 bits (982), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 185/350 (52%), Positives = 238/350 (68%), Gaps = 48/350 (13%)

Query: 85  VDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSD 144
           V+ YDL  Y+G+++G +  D +L CVPLR+A   LP+ F HL  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFDHLNAMSYPHNLIDLSFLVSD 121

Query: 145 CSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEM 204
            S  D+T+  L++  +  Q        ++QD+ +R                         
Sbjct: 122 SS--DNTMGVLLSKLQMAQ--------SQQDKTKR------------------------- 146

Query: 205 AFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANAL 264
                        F ++++++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 147 -------------FGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVAL 193

Query: 265 KPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESG 324
           KPYHSWVYWRDVD+E  P +++EDLM  + DV VPNVWRPLP++LG  Q YDLNSW ES 
Sbjct: 194 KPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 253

Query: 325 EALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLF 384
             L+LAN LDED VIVEGY EY TWR HL Y+R+P+ NP + ++LDG+GGVSILAKAK+F
Sbjct: 254 GGLQLANALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVF 313

Query: 385 RAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           R G HFPAF+FE HAETEAFG+++++M+Y V GLPHY +WHIYEPS DDL
Sbjct: 314 RTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDL 363

>Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  382 bits (980), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 184/350 (52%), Positives = 238/350 (68%), Gaps = 48/350 (13%)

Query: 85  VDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSD 144
           V+ YDL  Y+G+++G +  D +L CVPLR+A   LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVSD 121

Query: 145 CSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEM 204
            S  D+T+  L++         L +  ++QD+ +R                         
Sbjct: 122 SS--DNTMGVLLS--------NLHKAQSQQDKSKR------------------------- 146

Query: 205 AFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANAL 264
                        F ++++++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 147 -------------FGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVAL 193

Query: 265 KPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESG 324
           KPYHSWVYWRDVD+E  P +++EDLM  + DV VPNVWRPLP++LG  Q YDLNSW ES 
Sbjct: 194 KPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 253

Query: 325 EALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLF 384
             L+LA+ L+ED VIVEGY EY TWR HL Y+R+P+ NP + ++LDG+GGVSILAKAK+F
Sbjct: 254 GGLQLADALEEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVF 313

Query: 385 RAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           R G HFPAF+FE HAETEAFG+++++M+Y V GLPHY +WHIYEPS DDL
Sbjct: 314 RTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDL 363

>Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  382 bits (980), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 183/350 (52%), Positives = 238/350 (68%), Gaps = 48/350 (13%)

Query: 85  VDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSD 144
           V+ YDL  Y+G+++G +  D +L CVPLR+A   LP+ F HL  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMSYPHNLIDLSFLVSD 121

Query: 145 CSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEM 204
            S  D+T+  L++  +  Q        ++QD+ +R                         
Sbjct: 122 SS--DNTMGVLLSSLQTAQ--------SQQDKSKR------------------------- 146

Query: 205 AFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANAL 264
                        F ++++++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 147 -------------FGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVAL 193

Query: 265 KPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESG 324
           KPYHSWVYWRDVD++  P +++EDLM  + DV VPNVWRPLP++LG  Q YDLNSW ES 
Sbjct: 194 KPYHSWVYWRDVDVQTIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 253

Query: 325 EALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLF 384
             L+LA+ LDED VIVEGY EY TWR HL Y+R+P+ NP + ++LDG+GGVSILAKAK+F
Sbjct: 254 GGLQLADALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVF 313

Query: 385 RAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           R G HFPAF+FE HAETEAFG+++++M+Y V GLPHY +WHIYEPS DDL
Sbjct: 314 RTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDL 363

>Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)
           [1938 nt, 646 aa]
          Length = 645

 Score =  386 bits (992), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 182/350 (52%), Positives = 242/350 (69%), Gaps = 48/350 (13%)

Query: 85  VDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSD 144
           V+ YDLS Y+G+++G +  D +L C+PLR+A   LP+ F H+  +TYPH L+DL+FLVSD
Sbjct: 66  VEFYDLSNYQGNKDGWQQNDRILFCIPLRDAAQHLPMFFDHMNKMTYPHNLVDLSFLVSD 125

Query: 145 CSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEM 204
            S  DDT+  L+++ + +Q        ++QD+ +R                         
Sbjct: 126 SS--DDTMGVLLSHLQTVQ--------SQQDKSKR------------------------- 150

Query: 205 AFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANAL 264
                        F ++++++KDFGQ+IGQ FSDRH    QG RRKLM +ARNWL + AL
Sbjct: 151 -------------FGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMAKARNWLGSVAL 197

Query: 265 KPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESG 324
           KPYHSWVYWRDVDIE  P +++EDLM  + D+ VPNVWRPLP++LG  Q YDLNSW ES 
Sbjct: 198 KPYHSWVYWRDVDIETAPVTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQESE 257

Query: 325 EALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLF 384
             L+LAN LDE+ VIVEGY EY TWR HL Y+R+P+ +P + ++LDG+GGVSIL+KAK+F
Sbjct: 258 GGLQLANQLDENAVIVEGYPEYATWRPHLAYMRDPNGDPEDEMELDGIGGVSILSKAKVF 317

Query: 385 RAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           R+G HFPAF+FE HAETEAFGK++++M+Y V GLPHY VWHIYEPS +DL
Sbjct: 318 RSGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDL 367

>TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {ON}
           Anc_1.479 YEL036C
          Length = 572

 Score =  384 bits (986), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 185/350 (52%), Positives = 238/350 (68%), Gaps = 48/350 (13%)

Query: 85  VDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSD 144
           V  YDL+ Y G+ +G +  D +L CVPLR+A   LP  F HL  +TYPH LIDL+FLVSD
Sbjct: 72  VHFYDLNNYRGNSDGWQRNDRILFCVPLRDAAQHLPRFFNHLNTMTYPHNLIDLSFLVSD 131

Query: 145 CSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEM 204
               DDT+  L+++ +  Q        ++Q++++R                         
Sbjct: 132 SK--DDTMGVLLSHLQTAQ--------SQQNKLKR------------------------- 156

Query: 205 AFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANAL 264
                        F ++++++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 157 -------------FGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAL 203

Query: 265 KPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESG 324
           KPYHSWVYWRDVD+E CP +++EDLM    DV VPNVWRPLP++LG  Q YDLNSW ES 
Sbjct: 204 KPYHSWVYWRDVDVETCPVTIMEDLMHHGKDVIVPNVWRPLPDWLGNIQPYDLNSWQESE 263

Query: 325 EALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLF 384
             L+LA++LDED VIVEGY EY TWR HL Y+R+P+ +P E ++LDG+GGVSIL+KAK+F
Sbjct: 264 GGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAKVF 323

Query: 385 RAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           R+G HFPAF+FE HAETEAFGK++++M+Y V GLPHY VWHIYEPS +DL
Sbjct: 324 RSGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDL 373

>Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {ON}
           YEL036C (ANP1) - subunit of mannosyltransferase complex
           [contig 41] FULL
          Length = 476

 Score =  380 bits (977), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 186/350 (53%), Positives = 233/350 (66%), Gaps = 48/350 (13%)

Query: 85  VDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSD 144
           V+ YDL  Y+G+ +G +  D VL  VPLR+A   LP+ F H+  ++YPH LIDL+FLVSD
Sbjct: 53  VEYYDLRNYQGNRDGWQRGDRVLFTVPLRDAAEHLPMFFDHMDKISYPHNLIDLSFLVSD 112

Query: 145 CSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEM 204
            S  DDT+  L+ + K+ Q+ T                                      
Sbjct: 113 SS--DDTMGVLLDHLKKAQSKT-------------------------------------- 132

Query: 205 AFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANAL 264
                   D  K F ++++F+KDFGQ IGQ FSDRH    QG RRKLMGRARNWL + AL
Sbjct: 133 --------DRKKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSVAL 184

Query: 265 KPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESG 324
           KPYHSWVYWRDVD+E  P +++EDLM  + DV VPNVWRPLP++LG  Q YDLNSW ES 
Sbjct: 185 KPYHSWVYWRDVDVETIPRTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQESE 244

Query: 325 EALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLF 384
             ++LA +LDED VIVEGY EY TWR HL Y+R+P  NP + ++LDG+GGVSIL+KAK+F
Sbjct: 245 GGMQLAESLDEDAVIVEGYPEYATWRTHLAYMRDPSGNPEDEMELDGIGGVSILSKAKVF 304

Query: 385 RAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           RAG HFPAF+FE HAETEAFGK+++++ Y V GLPHY +WHIYEPS DDL
Sbjct: 305 RAGSHFPAFSFEKHAETEAFGKLSRRLGYSVIGLPHYVIWHIYEPSSDDL 354

>CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa]
           {ON} highly similar to uniprot|P32629 Saccharomyces
           cerevisiae YEL036c ANP1 required for protein
           glycosylation in the golgi
          Length = 447

 Score =  379 bits (973), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 185/350 (52%), Positives = 235/350 (67%), Gaps = 50/350 (14%)

Query: 85  VDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSD 144
           V+ YDL+ Y G  +G +  D +L CVPLR+A   LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 54  VEFYDLNDYTGLPDGWQRNDRILFCVPLRDAAEHLPMFFDHLNAMTYPHHLIDLSFLVSD 113

Query: 145 CSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEM 204
            S  D+T+  L+ + ++ Q                                         
Sbjct: 114 SS--DNTMGVLMHHLQQAQ----------------------------------------- 130

Query: 205 AFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANAL 264
                  KD +K F ++++F+KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + A+
Sbjct: 131 -------KDKNKRFGNIEIFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAI 183

Query: 265 KPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESG 324
           KPYHSWVYWRDVD+E+ P S++EDLM  + DV VPNVWRPLP++LG  Q YDLNSWVES 
Sbjct: 184 KPYHSWVYWRDVDVEVIPRSIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVESE 243

Query: 325 EALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLF 384
             L+LA+TL ED VIVEGY EY TWR HL Y+R+P+ NP + + LDG+GGVSIL+KA++F
Sbjct: 244 GGLQLADTLSEDSVIVEGYPEYATWRTHLAYMRDPNGNPEDEMMLDGIGGVSILSKARVF 303

Query: 385 RAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           RAG HFPAF+F+ HAETEAFGK++++M + V GLPHY +WHIYEPS DDL
Sbjct: 304 RAGSHFPAFSFQKHAETEAFGKLSRRMGFDVVGLPHYVIWHIYEPSTDDL 353

>KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {ON}
           similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 489

 Score =  379 bits (973), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 186/351 (52%), Positives = 233/351 (66%), Gaps = 48/351 (13%)

Query: 84  TVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVS 143
            V  YDL  Y+G  +G +  DHVL  VPLR+A   LP+ F H+  ++YPH LIDL+FLVS
Sbjct: 52  NVQYYDLRNYQGHADGWQRGDHVLFTVPLRDAAEHLPMFFDHMDRISYPHNLIDLSFLVS 111

Query: 144 DCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVE 203
           D S  DDT+  L+ Y ++ Q+                                       
Sbjct: 112 DSS--DDTMGVLLEYLQKAQS--------------------------------------- 130

Query: 204 MAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANA 263
              KP    D  + F ++++++KDFGQ IGQ FSDRH    QG RRKLMGRARNWL + A
Sbjct: 131 ---KP----DRTQRFGNIEIYEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSVA 183

Query: 264 LKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVES 323
           LKPYHSWVYWRDVD+E  P +++EDLM  + DV VPNVWRPLP++LG  Q YDLNSW ES
Sbjct: 184 LKPYHSWVYWRDVDVETIPPTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQES 243

Query: 324 GEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKL 383
              L+LA +LDED VIVEGY EY TWR HL Y+R+P  +P + ++LDG+GGVSIL+KAK+
Sbjct: 244 EGGLQLAESLDEDSVIVEGYPEYATWRTHLAYMRDPSGDPEDEMELDGIGGVSILSKAKV 303

Query: 384 FRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           FRAG HFPAF+FE HAETEAFGK+++++ Y V GLPHY +WHIYEPS DDL
Sbjct: 304 FRAGSHFPAFSFEKHAETEAFGKLSRRLGYSVVGLPHYVIWHIYEPSSDDL 354

>KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}
           Anc_1.479 YEL036C
          Length = 457

 Score =  378 bits (970), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 183/352 (51%), Positives = 231/352 (65%), Gaps = 48/352 (13%)

Query: 83  ATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLV 142
           A  + YDL  Y G+ NG +  D +L CVPLR+A   LP+ FKHL  +TYPH L+DL+FLV
Sbjct: 65  ANTEFYDLKNYRGNSNGWQTGDRILFCVPLRDAAEHLPMFFKHLNEMTYPHNLVDLSFLV 124

Query: 143 SDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMV 202
           SD    DDT+  L++  +  Q+                                      
Sbjct: 125 SDSK--DDTMGVLLSNLQTAQS-------------------------------------- 144

Query: 203 EMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTAN 262
                    KD  K F +++ F+KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + 
Sbjct: 145 --------QKDRSKRFGNIEFFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSV 196

Query: 263 ALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVE 322
           A+KPYHSWVYWRDVD+E  P +++EDLM    DV VPNVWRPLPE+LG  Q YDLNSW E
Sbjct: 197 AIKPYHSWVYWRDVDVETAPVTIMEDLMHHGKDVIVPNVWRPLPEWLGNIQPYDLNSWQE 256

Query: 323 SGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAK 382
           S   L+LA++LD+D VIVEGY EY TWR HL Y+R+P+ +P   ++LDG+GGVSIL+KA+
Sbjct: 257 SDAGLELADSLDDDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKAR 316

Query: 383 LFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           +FR+G HFPAF+FE HAETEAFGK++++M Y V GLPHY +WHIYEPS +DL
Sbjct: 317 VFRSGSHFPAFSFEKHAETEAFGKLSRRMGYSVVGLPHYVIWHIYEPSTEDL 368

>KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.479
           YEL036C
          Length = 455

 Score =  377 bits (967), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 185/350 (52%), Positives = 234/350 (66%), Gaps = 48/350 (13%)

Query: 85  VDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSD 144
           V+ YDL  Y+G+ +G +  D +L CVPLR+A   LP+ F+HL  +TYPH  IDL+FLVSD
Sbjct: 62  VEYYDLRNYQGNSDGWQRNDRILFCVPLRDAAEHLPMFFEHLNLMTYPHNFIDLSFLVSD 121

Query: 145 CSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEM 204
            S  DDT+  L           LS L + Q +M                           
Sbjct: 122 SS--DDTMGVL-----------LSHLQSAQSQM--------------------------- 141

Query: 205 AFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANAL 264
                   D  K F ++++++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 142 --------DKSKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAL 193

Query: 265 KPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESG 324
           KPYHSWVYWRDVD+E  P +++EDLM  + DV VPNVWRPLP++LG  Q YDLNSW ES 
Sbjct: 194 KPYHSWVYWRDVDVETVPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQESE 253

Query: 325 EALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLF 384
             L+LA  L+ED VIVEGY EY TWR HL Y+R+P+ +P E ++LDG+GGVSIL+KAK+F
Sbjct: 254 GGLQLAEALEEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAKVF 313

Query: 385 RAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           R G HFPAF+FE HAETEAFG+++++M+Y V GLPHY +WHIYEPS +DL
Sbjct: 314 RTGSHFPAFSFEKHAETEAFGRLSRRMNYNVVGLPHYVIWHIYEPSTEDL 363

>TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.479
           YEL036C
          Length = 548

 Score =  377 bits (967), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 185/351 (52%), Positives = 232/351 (66%), Gaps = 48/351 (13%)

Query: 84  TVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVS 143
            V+ YDL  Y+G+++G +  D ++ CVPLR+A   LP  F HL  ++YPH LIDL+FLVS
Sbjct: 64  NVEFYDLRNYKGNKDGWQRNDRIVFCVPLRDAAQHLPRFFDHLDKMSYPHNLIDLSFLVS 123

Query: 144 DCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVE 203
           D S  DDT+  L           LS L   Q +                           
Sbjct: 124 DSS--DDTMGVL-----------LSNLQTAQSQ--------------------------- 143

Query: 204 MAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANA 263
                   +D  K F ++++++KDFGQVIGQ FSDRH    QG RRKLM RARNWL + A
Sbjct: 144 --------RDKSKRFGNIEIYEKDFGQVIGQSFSDRHGFAGQGPRRKLMARARNWLGSVA 195

Query: 264 LKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVES 323
           LKPYHSWVYWRDVDIE  P +++EDLM  + D+ VPNVWRPLP++LG  Q YDLNSW ES
Sbjct: 196 LKPYHSWVYWRDVDIETAPRTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQES 255

Query: 324 GEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKL 383
              L+LAN L+ED VIVEGY EY TWR HL Y+R+P+ +P   ++LDG+GGVSIL+KA +
Sbjct: 256 EGGLQLANQLNEDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKANV 315

Query: 384 FRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           FR+G HFPAF+FE HAETEAFGK++++M Y V GLPHY VWHIYEPS +DL
Sbjct: 316 FRSGSHFPAFSFEKHAETEAFGKLSRRMGYNVIGLPHYVVWHIYEPSTEDL 366

>NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {ON}
           Anc_1.479
          Length = 446

 Score =  373 bits (957), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 184/352 (52%), Positives = 236/352 (67%), Gaps = 50/352 (14%)

Query: 84  TVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVS 143
           +V+ YD+S Y+G ++G    + +L+CVPL++A N LPL FK L  +TYPHELIDL+FLVS
Sbjct: 54  SVEFYDMSNYQGHKDGWNQNNRILICVPLKDASNALPLFFKTLEKMTYPHELIDLSFLVS 113

Query: 144 DCSEDDDTLDALIAYSKELQ-NGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMV 202
           D S  D+T+  L+   K LQ +G  S  F                               
Sbjct: 114 DSS--DNTMYNLLNMLKRLQIDGGTSGKFG------------------------------ 141

Query: 203 EMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTAN 262
                            ++++++KDFGQVIGQGFSDRH    QG RRKLMG+ARNWL   
Sbjct: 142 -----------------NIEIYEKDFGQVIGQGFSDRHGFAAQGPRRKLMGKARNWLNTV 184

Query: 263 ALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVE 322
           A+KPYHSWVYWRDVD+E+ P +++EDLM  + DV VPNVWRPLP++LG  Q YDLNSW E
Sbjct: 185 AIKPYHSWVYWRDVDVEIIPETILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKE 244

Query: 323 SGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAK 382
           S   L L+N+L ED VIVEGY EY TWR HL Y+R+P+ +P   ++LDGVGGVSIL+KA 
Sbjct: 245 SEAGLALSNSLGEDAVIVEGYPEYATWRSHLAYMRDPNGDPEREMELDGVGGVSILSKAN 304

Query: 383 LFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           +FR+G HFPAF+F+ HAETEAFGK++K M++ V GLP+Y VWHIYEPS +DL
Sbjct: 305 VFRSGSHFPAFSFKKHAETEAFGKLSKHMNFTVIGLPNYVVWHIYEPSKEDL 356

>TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {ON}
           Anc_1.479 YEL036C
          Length = 462

 Score =  372 bits (955), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 183/351 (52%), Positives = 232/351 (66%), Gaps = 49/351 (13%)

Query: 85  VDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSD 144
           V+ YDL  Y+G  +G +  + +L  VPLR+A   LP  F H+  L+YPH LID++FLVSD
Sbjct: 57  VEYYDLRNYQGDRDGWQRGNRILFLVPLRDAAQHLPRFFGHMSELSYPHNLIDMSFLVSD 116

Query: 145 CSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEM 204
            S  DDT+  L+ + +  Q+                                        
Sbjct: 117 SS--DDTMGELLHHLQIAQS---------------------------------------- 134

Query: 205 AFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANAL 264
                  KD +K F ++++F+KDFGQ IGQ FSDRH    QG RRKLM RARNWL +  L
Sbjct: 135 ------QKDRNKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSVTL 188

Query: 265 KPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESG 324
           KPYHSWVYWRDVD+E+ P S++EDLM  + DV VPNVWRPLP++LG  Q YDLNSW ES 
Sbjct: 189 KPYHSWVYWRDVDVEIAPISIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 248

Query: 325 EALKLANTL-DEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKL 383
             ++LANTL DED VIVEGY E+ TWR HL Y+R+P+ NP + ++LDG+GGVSILAKAK+
Sbjct: 249 AGIQLANTLTDEDSVIVEGYPEFATWRTHLAYMRDPNGNPEDEMELDGIGGVSILAKAKV 308

Query: 384 FRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           FR G HFPAF+FE HAETEAFGK++++M+Y V GLPHY +WHIYEPS +DL
Sbjct: 309 FRTGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVIWHIYEPSTEDL 359

>KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]
           {ON} similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 450

 Score =  371 bits (952), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 183/350 (52%), Positives = 231/350 (66%), Gaps = 48/350 (13%)

Query: 85  VDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSD 144
           V+ YDL  Y+G+ NG +  D V+ CVPLR+A   L + F  L  LTYPH LIDL+FLVSD
Sbjct: 57  VEYYDLINYQGNANGWQTGDRVVFCVPLRDAAAHLDMFFDTLDKLTYPHNLIDLSFLVSD 116

Query: 145 CSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEM 204
            S  DDT+  L+++ +  Q        + QD+ RR                         
Sbjct: 117 SS--DDTMKTLLSHLRRAQ--------SNQDKSRR------------------------- 141

Query: 205 AFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANAL 264
                        F ++++F+KDFGQ +GQ FSDRH    QG RRK M RARNWL + AL
Sbjct: 142 -------------FANIEIFEKDFGQSVGQSFSDRHGFAAQGPRRKSMARARNWLGSAAL 188

Query: 265 KPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESG 324
           KPYHS+VYWRDVD++  P +++EDLM  + DV VPNVWRPLP++LG  Q YDLNSWVES 
Sbjct: 189 KPYHSYVYWRDVDVQTIPNTILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVESE 248

Query: 325 EALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLF 384
             L+LA++LDED  IVEGY EY TWR HL Y+R+P  +P   ++LDG+GGVSIL+KAK+F
Sbjct: 249 GGLQLADSLDEDACIVEGYPEYATWRTHLAYMRDPSGDPEVEMELDGIGGVSILSKAKVF 308

Query: 385 RAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           R G HFPAF+FE HAETEAFGK++++M Y V GLPHY +WHIYEPS DDL
Sbjct: 309 RTGSHFPAFSFEKHAETEAFGKLSRRMQYSVVGLPHYVIWHIYEPSSDDL 358

>AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL036C (ANP1)
          Length = 434

 Score =  369 bits (947), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 184/351 (52%), Positives = 229/351 (65%), Gaps = 49/351 (13%)

Query: 85  VDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSD 144
           V+ +DLS   G  +G    D VL CVPLR+A   LP+ FKHL  +TYPH L+DL+FLVSD
Sbjct: 42  VEYWDLSWSRGKADGWAQGDRVLFCVPLRDAAEHLPMFFKHLSEMTYPHNLVDLSFLVSD 101

Query: 145 CSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEM 204
               D+T+  L  + +ELQ+                                        
Sbjct: 102 SK--DETMSVLRQHVRELQS---------------------------------------- 119

Query: 205 AFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANAL 264
                   D  + F ++++FQKDFGQ IGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 120 ------QPDNARQFGNIEIFQKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAL 173

Query: 265 KPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESG 324
           KPYHSWVYWRDVD+E  P ++IEDLM  + DV VPNVWRPLP++LG  Q YDLNSWVES 
Sbjct: 174 KPYHSWVYWRDVDVETVPQTIIEDLMHHDKDVIVPNVWRPLPDWLGDIQPYDLNSWVESE 233

Query: 325 EALKL-ANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKL 383
             L+L A+T DED VIVEGY EY TWRVHL Y+R+P+ +P   ++LDG+GGVSIL++A++
Sbjct: 234 GGLQLAADTPDEDAVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSRARV 293

Query: 384 FRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           FR+G HFPAF+F+ HAETE FGK+++ M Y V GLPHY +WHIYEPS DDL
Sbjct: 294 FRSGSHFPAFSFQKHAETEGFGKLSRAMGYSVVGLPHYVIWHIYEPSSDDL 344

>ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 608

 Score =  365 bits (938), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 181/352 (51%), Positives = 233/352 (66%), Gaps = 49/352 (13%)

Query: 84  TVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVS 143
            V+ YDL  Y+G  +G +  + +L  VPLR+A   LP  F H+  +TYPH LID +FLVS
Sbjct: 62  NVEYYDLRNYQGDPDGWQRDNRILFLVPLRDAAEHLPRFFNHMDKMTYPHNLIDFSFLVS 121

Query: 144 DCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVE 203
           D S  DDT+ AL+++ ++ Q        + +D+ RR                        
Sbjct: 122 DSS--DDTMGALLSHLEKAQ--------SNKDKTRR------------------------ 147

Query: 204 MAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANA 263
                         F ++++++KDFGQ IGQ FSDRH    QG RRKLM RARNWL   A
Sbjct: 148 --------------FGNIEIYEKDFGQAIGQSFSDRHGFDAQGPRRKLMARARNWLGTVA 193

Query: 264 LKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVES 323
           LK YHSWVYWRDVD+ELCP S++EDLM  + DV VPNVWRPLP++LG  Q YDLNSW ES
Sbjct: 194 LKAYHSWVYWRDVDVELCPQSIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKES 253

Query: 324 GEALKLANTLDEDD-VIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAK 382
              ++LA++L +DD VIVEGY +Y TWR HL Y+R+P+ NP + L+LDG+GGVSIL+K K
Sbjct: 254 EVGVQLADSLPDDDAVIVEGYPDYSTWRTHLAYMRDPNGNPEDELELDGIGGVSILSKGK 313

Query: 383 LFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434
           +FR G HFPAF+FE HAETEAFGK++++M Y V GLPHY +WHIYEPS +DL
Sbjct: 314 VFRTGSHFPAFSFEKHAETEAFGKLSRRMGYNVVGLPHYVIWHIYEPSTEDL 365

>CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050c required for complex N-glycosylation
          Length = 393

 Score =  178 bits (452), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 114/350 (32%), Positives = 172/350 (49%), Gaps = 53/350 (15%)

Query: 85  VDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSD 144
           V  YDL+K   + + A N++ VL+  P++         + +L+ LTYP +L++L F++  
Sbjct: 94  VAKYDLNKLHSTSDAAVNKEQVLILTPMQTFHQAY---WDNLLQLTYPRDLLELGFIIPK 150

Query: 145 CSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEM 204
            +  D  L  L A  K  Q    +  F +   +R+ +                       
Sbjct: 151 SASGDAALKQLEAAVKRAQTDKKNNRFGKVTILRQDS----------------------- 187

Query: 205 AFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANAL 264
                  K +DK        Q+           +RHA+ VQ  RR  M  ARN L  + +
Sbjct: 188 -------KGFDK-------LQE----------KERHALAVQKERRSAMALARNELLFSTI 223

Query: 265 KPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPL---PEFLGGEQAYDLNSWV 321
            P+ SWV W D DI     S+I+D+ +LN  V   NV++      E     + YD N+W 
Sbjct: 224 GPHTSWVLWLDADIIETKPSLIQDMTALNKPVLAANVYQRYFDEAENKPSIRPYDFNNWA 283

Query: 322 ESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKA 381
           +S  A +L + + +D++IVEGYAE  T+R  + +   PD  P E++ LDGVGG   L KA
Sbjct: 284 DSQIAQELGDKMGDDEIIVEGYAEIATYRPLMAHFYTPDGPPNELMSLDGVGGGCTLVKA 343

Query: 382 KLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSD 431
           ++ R G  FP F F +  ETE F KMAK+++Y V GLP+Y V+HI E +D
Sbjct: 344 EVHRDGAMFPTFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVFHIEERND 393

>TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8.500
           YPL050C
          Length = 392

 Score =  178 bits (451), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 107/344 (31%), Positives = 174/344 (50%), Gaps = 53/344 (15%)

Query: 88  YDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSE 147
           YDL+K   +++  + ++HVL+  P++   +     + +L+ ++YP  L++L F++     
Sbjct: 99  YDLNKLHSTKDAMKLKEHVLIATPMQTFHDAY---WSNLLKMSYPRSLLELGFIIPRTPT 155

Query: 148 DDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAFK 207
            D+TL  L A  K +Q G + + FA+   +R+ +                          
Sbjct: 156 GDETLKKLEAAVKNVQTGKVEDRFAKITILRQDS-------------------------- 189

Query: 208 PPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPY 267
               + +DK                  G  +RH++ VQ  RR  M  ARN L  +++ P 
Sbjct: 190 ----QSFDK-----------------LGEKERHSLAVQKERRSAMALARNELLFSSIGPS 228

Query: 268 HSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQA---YDLNSWVESG 324
            SWV W D DI   P +VI+D+ + N  V   NV++   +    E +   YD N+W ES 
Sbjct: 229 TSWVLWLDADIVETPATVIQDMTNHNKPVLAANVYQRFFDKEKNENSIRPYDFNNWAESE 288

Query: 325 EALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLF 384
           + L++A  ++ED++IVEGYAE  T+R  + +  +       ++ LDGVGG   L KA++ 
Sbjct: 289 KGLEIAKNMNEDEIIVEGYAEIATYRPLMAHFYDKAGKIDALMALDGVGGGCTLVKAEVH 348

Query: 385 RAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYE 428
           R G  FP F F +  ETE F KMAK+++Y + GLP+Y V+HI E
Sbjct: 349 RDGAMFPNFPFYHLIETEGFAKMAKRLNYEIFGLPNYLVYHIEE 392

>TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.500
           YPL050C
          Length = 393

 Score =  177 bits (448), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 111/344 (32%), Positives = 177/344 (51%), Gaps = 53/344 (15%)

Query: 88  YDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSE 147
           YDL+K   + + A N++ VL+  P++   +     +++L+ LTYP ELI+L F++     
Sbjct: 97  YDLNKLHSTSDAAVNKEQVLILTPMQTFHDEF---WQNLLQLTYPRELIELGFILPRSDS 153

Query: 148 DDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAFK 207
            D  L AL A  K++Q    ++ F++   +R+ +                          
Sbjct: 154 GDAALKALEAAVKKVQTDKKNQRFSKITILRQDS-------------------------- 187

Query: 208 PPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPY 267
                             + FGQ++ +   +RHA+ VQ  RR  M  ARN L  + + P+
Sbjct: 188 ------------------QGFGQLMEK---ERHALHVQKERRAAMALARNELLFSTIGPH 226

Query: 268 HSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQ---AYDLNSWVESG 324
            SWV W D DI   P +VI+D+ + +  V   NV++   +    E+   AYD N+W ES 
Sbjct: 227 TSWVLWLDADIVETPPTVIQDMTAHDKAVLAANVYQRYFDEEKKEKSIRAYDFNNWQESD 286

Query: 325 EALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLF 384
             L++A  +++D++IVEGY+E  T+R  + +  +P A+    + LDGVGG   L KA + 
Sbjct: 287 TGLQIAAGMNDDEIIVEGYSEIATYRPLMAHFYDPTASVNSEMMLDGVGGGCTLVKADVH 346

Query: 385 RAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYE 428
           R G  FP F F +  ETE F KMAK+++Y V GLP+Y V+H+ E
Sbjct: 347 RDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHMEE 390

>KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]
           {ON} highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 392

 Score =  176 bits (446), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 115/347 (33%), Positives = 173/347 (49%), Gaps = 59/347 (17%)

Query: 88  YDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSE 147
           YDL+K + + N   N++ VL+  P++         + +L++LTYP  LI+L F++   + 
Sbjct: 99  YDLNKLKSTSNALVNKERVLILTPMQTFHQQ---YWNNLLSLTYPRALIELGFIIPRTAS 155

Query: 148 DDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAFK 207
            D  L  L +  +E+Q G       +QD+   K +I       L+  +Q +  +      
Sbjct: 156 GDAALQKLESAVREVQTG-------KQDKRFAKITI-------LRQASQSFDRL------ 195

Query: 208 PPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPY 267
                                      G  DRHA+ VQ  RR  M  ARN L  + + P+
Sbjct: 196 ---------------------------GEKDRHALEVQKERRAAMALARNELLFSTIGPH 228

Query: 268 HSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQA------YDLNSWV 321
            SW+ W D DI   P +VI+DL S N  V   NV++   +F   +Q       YD N+W 
Sbjct: 229 TSWILWLDADIVETPVTVIQDLTSHNKPVLAANVYQ---KFYDKDQKKESIRPYDFNNWA 285

Query: 322 ESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKA 381
           ES   LKLA  L ++++IVEGY+E  T+R  + +  + +     +++LDGVGG   L KA
Sbjct: 286 ESEIGLKLAQQLGDNEIIVEGYSEIATYRPLMAHFYDANGATNSLMELDGVGGGCTLVKA 345

Query: 382 KLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYE 428
           ++ R G  F  F F +  ETEAF KMAK++ Y V GLP+Y V+HI E
Sbjct: 346 EVHRDGAMFTNFPFYHLIETEAFAKMAKRLGYSVFGLPNYLVYHIEE 392

>NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {ON}
           Anc_8.500
          Length = 393

 Score =  176 bits (446), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 113/344 (32%), Positives = 174/344 (50%), Gaps = 53/344 (15%)

Query: 88  YDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSE 147
           YDL+K   + + A N++ +L+  P++         +++L+ LTYP ELI+L F+      
Sbjct: 97  YDLNKLHSTSDAAINKEKILILTPIQKFHQE---YWENLLQLTYPRELIELGFIAPRTPT 153

Query: 148 DDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAFK 207
            D  L AL A   ++Q+   ++ F++   +R                 QD +   ++  K
Sbjct: 154 GDQALAALEAAVDKVQSDKKNQRFSKVTILR-----------------QDSVGFNKLTEK 196

Query: 208 PPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPY 267
                                         +RHA+ VQ  RR  M  ARN L  + + P+
Sbjct: 197 ------------------------------ERHALEVQKERRASMALARNELLFSTIGPH 226

Query: 268 HSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQA---YDLNSWVESG 324
            SWV W D DI   P S+I+D+ + +  V   NV++   +    ++A   YD N+W ES 
Sbjct: 227 TSWVLWLDADIIETPASLIQDMTAHDRAVLSANVFQRYYDEEKKQKAIRPYDFNNWQESD 286

Query: 325 EALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLF 384
             L+LA+ + +D++IVEGYAE  T+R  + Y  +PD +  E + LDGVGG   L KA++ 
Sbjct: 287 TGLELASKMKDDEIIVEGYAEIATYRPLMAYFHDPDNSVAEEMRLDGVGGGCTLVKAEVH 346

Query: 385 RAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYE 428
           R G  FP F F +  ETE F KMAK+++Y V GLP+Y V+HI E
Sbjct: 347 RDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 390

>KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  176 bits (446), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 117/347 (33%), Positives = 171/347 (49%), Gaps = 59/347 (17%)

Query: 88  YDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSE 147
           YDL+K   ++  A N++ VL+  P++         + +++++TYP ELI+L F+      
Sbjct: 100 YDLNKLHSTKQAAVNKERVLILTPMQTFHEQ---YWDNILHMTYPRELIELGFIAPRTPT 156

Query: 148 DDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAFK 207
            D  L  L A  K++Q+G  +E FA+   +R+++              Q +  + E    
Sbjct: 157 GDAALKKLEAAIKKIQSGKKNERFAKIIILRQES--------------QSFDMLAE---- 198

Query: 208 PPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPY 267
                                         DRHA+ VQ  RR  M  ARN L  + L P+
Sbjct: 199 -----------------------------KDRHALAVQKQRRSAMALARNELLFSTLGPH 229

Query: 268 HSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGE------QAYDLNSWV 321
            SWV W D DI   P +VI+DL + +  V   NV++    F   E      + YD N+W 
Sbjct: 230 TSWVLWLDADIVETPPTVIQDLAAHDKPVLAANVYQ---RFFNDELSKADIRPYDFNNWQ 286

Query: 322 ESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKA 381
           ES   L+LAN+L  D++IVEGYAE  T+R  + +  +      E + LDGVGG   L KA
Sbjct: 287 ESETGLELANSLPADEIIVEGYAEMATFRPLMAHFFDESKPVSEEMALDGVGGGCTLVKA 346

Query: 382 KLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYE 428
           ++ R G  FP F F +  ETE F KMAK++ Y V GLP+Y V+HI E
Sbjct: 347 EVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIEE 393

>SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {ON}
           highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 393

 Score =  176 bits (445), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 115/347 (33%), Positives = 168/347 (48%), Gaps = 59/347 (17%)

Query: 88  YDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSE 147
           YDL+K   ++N A N++ VL+  P++N        + +L+ LTYP ELI+L F+V     
Sbjct: 98  YDLNKLTSTQNAALNKEQVLILTPMQNFHQK---YWDNLLQLTYPRELIELGFIVPRTGS 154

Query: 148 DDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAFK 207
            +  L+ L A  K++Q G   + F +   +R+ +              Q +  ++E    
Sbjct: 155 GNVALEQLEAAVKKVQTGKKEDRFGKITILRQAS--------------QSFDKLLE---- 196

Query: 208 PPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPY 267
                                         +RHA+ VQ  RR  M  ARN L  + + PY
Sbjct: 197 -----------------------------KERHALEVQKERRAAMALARNELLFSTIGPY 227

Query: 268 HSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQA------YDLNSWV 321
            SW+ W D DI   P SVIED+ + N  V   NV++    +   EQ       YD N+W 
Sbjct: 228 TSWILWLDADIVETPPSVIEDMTAHNKPVLAANVYQ---RYYDQEQKKESIRPYDYNNWA 284

Query: 322 ESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKA 381
           ES   L+LA+ +  D+++VEGY E  T+R  + +     A     ++LDGVGG   L KA
Sbjct: 285 ESDIGLQLASQMSADEILVEGYPEIATYRPLMAHFYEDSAPATVEMELDGVGGGCTLVKA 344

Query: 382 KLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYE 428
            + R G  FP F F +  ETE F KMAK++ Y V GLP+Y V+HI E
Sbjct: 345 DVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIDE 391

>Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  174 bits (440), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 111/347 (31%), Positives = 172/347 (49%), Gaps = 59/347 (17%)

Query: 88  YDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSE 147
           YDL+K   + + A N++HVL+  P++         + +L+ LTYP ELI+L F+    + 
Sbjct: 99  YDLNKLHSTPDAAANKEHVLILTPMQTFHQQY---WDNLLQLTYPRELIELGFITPRTAT 155

Query: 148 DDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAFK 207
            D  L  L    K++Q    ++ F++   MR+ +              Q +  ++E    
Sbjct: 156 GDLALKKLENAVKKVQADKKAQRFSKITIMRQNS--------------QSFDKLME---- 197

Query: 208 PPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPY 267
                                         +RHA+ VQ  RR  M  ARN L  + + P+
Sbjct: 198 -----------------------------KERHALDVQKERRAAMALARNELLFSTIGPH 228

Query: 268 HSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQA------YDLNSWV 321
            SWV W D DI   P ++I+D+   N  V   N+++    F   E+       YD N+W 
Sbjct: 229 TSWVLWLDADIIETPTTLIQDMTQHNKAVLAANIYQ---RFYDQEKKQSSIRPYDFNNWQ 285

Query: 322 ESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKA 381
           ES   L++A+ +D+D++IVEGYAE  T+R  + +  + +  P + + LDGVGG   L KA
Sbjct: 286 ESDTGLEIASQMDDDEIIVEGYAEIATYRPLMAHFYSANELPSKEMVLDGVGGGCTLVKA 345

Query: 382 KLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYE 428
           ++ R G  FP F F +  ETE F KMAK+++Y V GLP+Y V+HI E
Sbjct: 346 EVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 392

>KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 394

 Score =  172 bits (435), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 107/350 (30%), Positives = 174/350 (49%), Gaps = 59/350 (16%)

Query: 85  VDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSD 144
           +  YDL+K   ++    N++ VL+  P++   +     + +L+ LTYP +LI+L F++  
Sbjct: 96  ISHYDLNKLTSTDKAFANKEQVLILTPMQTFHDQY---WDNLLQLTYPRDLIELGFIIPR 152

Query: 145 CSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEM 204
            +  D  L  L A  K  Q G   + F++                 +  + QD       
Sbjct: 153 TATGDTALRKLEAAVKRTQLGKKDQRFSK-----------------ITILRQD------- 188

Query: 205 AFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANAL 264
                      + F S+Q               +RHA+ VQ  RR  M  ARN L  + +
Sbjct: 189 ----------SQSFDSLQE-------------KERHALKVQKERRAAMALARNELLFSTI 225

Query: 265 KPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLG------GEQAYDLN 318
            P+ SW+ W D DI   P S+I+D+ + N  V   NV++   +++        E+ YD N
Sbjct: 226 GPHTSWILWLDADIIETPPSLIQDMTAHNKPVLAANVYQ---KYMNEETKKIAERPYDFN 282

Query: 319 SWVESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSIL 378
           +W +S +AL++A  + +D+V+ EGYAE PT+R  + ++ +   +    + LDGVGG   L
Sbjct: 283 NWADSEKALQMAAGMADDEVLFEGYAELPTYRTLMAHMYDASGSQAAEMSLDGVGGGCTL 342

Query: 379 AKAKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYE 428
            KA++ R G  FP+F F +  ETE F KMA+++ Y + GLP+Y V+HI E
Sbjct: 343 VKAEVHRDGAMFPSFPFYHLIETEGFAKMARRLEYEIFGLPNYLVYHIEE 392

>TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  170 bits (431), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 113/347 (32%), Positives = 172/347 (49%), Gaps = 53/347 (15%)

Query: 88  YDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSE 147
           YDL+K   +   A N++ VL+  P++         + +L+ LTYP ELI+L F+V     
Sbjct: 100 YDLNKLHSTAKAALNKEQVLILTPMQTFHEQ---YWDNLLQLTYPRELIELGFIVPRTQS 156

Query: 148 DDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAFK 207
            D  L  L    K++Q    ++ F +   +R+ +                          
Sbjct: 157 GDVALAKLEEAVKKVQTDKKNQRFVKVTILRQDS-------------------------- 190

Query: 208 PPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPY 267
               K +DK        Q+           +RHA+ VQ  RR  M  ARN L  + + P+
Sbjct: 191 ----KSFDK-------LQE----------KERHALAVQKERRAAMALARNELLFSTIGPH 229

Query: 268 HSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGE---QAYDLNSWVESG 324
            SWV W D DI   P ++I+D+ + N  V   NV++   +    E   +AYD N+W ES 
Sbjct: 230 TSWVLWLDADIVEAPPNLIQDMTAHNKPVLAANVYQRYYDEEKKESSIRAYDFNNWAESE 289

Query: 325 EALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLF 384
             L+LA+ + ED++IVEGY+E  T+R  + Y  + + +P   + LDGVGG   L +A + 
Sbjct: 290 TGLELASQMAEDEIIVEGYSELATYRPLMAYYYDANGSPGAEMALDGVGGGCTLVQADVH 349

Query: 385 RAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSD 431
           R G  FP F F +  ETE F KMAK++++ V GLP+Y V+HI E +D
Sbjct: 350 RDGAMFPNFPFYHLIETEGFAKMAKRLNHEVFGLPNYLVYHIEEWND 396

>Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  170 bits (430), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 110/347 (31%), Positives = 170/347 (48%), Gaps = 59/347 (17%)

Query: 88  YDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSE 147
           YDL+K   + + A N++HVL+  P++         + +L+ L+YP ELI+L F+    + 
Sbjct: 99  YDLNKLHSTSDAAVNKEHVLILTPMQTFHQQ---YWDNLLQLSYPRELIELGFITPRTAT 155

Query: 148 DDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAFK 207
            D  L  L    K++Q    ++ F++   +R+ +              Q +  ++E    
Sbjct: 156 GDLALKNLENAIKKVQTDKKTQRFSKITILRQNS--------------QSFDKLME---- 197

Query: 208 PPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPY 267
                                         +RHA+ VQ  RR  M  ARN L  + + P+
Sbjct: 198 -----------------------------KERHALDVQKERRAAMALARNELLFSTIGPH 228

Query: 268 HSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQA------YDLNSWV 321
            SW+ W D DI   P S+I+D+   +  V   N+++    F   E+       YD N+W 
Sbjct: 229 TSWILWLDADIIETPVSLIQDMTQHDKAVLAANIYQ---RFYDQEKKQPSIRPYDFNNWQ 285

Query: 322 ESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKA 381
           ES   L++A+ + +D++IVEGYAE  T+R  + +  N D  P E + LDGVGG   L KA
Sbjct: 286 ESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHHYNADGLPNEEMALDGVGGGCTLVKA 345

Query: 382 KLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYE 428
            + R G  FP F F +  ETE F KMAK+++Y V GLP+Y V+HI E
Sbjct: 346 DVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYNVFGLPNYLVYHIEE 392

>KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {ON}
           Anc_8.500 YPL050C
          Length = 398

 Score =  169 bits (428), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 108/344 (31%), Positives = 164/344 (47%), Gaps = 53/344 (15%)

Query: 88  YDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSE 147
           YDL+K   +   A N++ VL+  P++         +++L+ LTYP ELI+L F++     
Sbjct: 102 YDLNKLRSTAYAAVNKERVLILTPMQTFHKQ---YWENLLQLTYPRELIELGFIIPRTKT 158

Query: 148 DDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAFK 207
            ++ L  L                                               E+A K
Sbjct: 159 GENALKEL-----------------------------------------------EIAIK 171

Query: 208 PPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPY 267
                  ++ F  + + ++D          DRH++ VQ  RR  M  ARN L  + L P+
Sbjct: 172 KVQSDKKNQRFAKITILRQDSQSFDQLAEKDRHSILVQKERRAAMALARNELLFSTLGPH 231

Query: 268 HSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPL---PEFLGGEQAYDLNSWVESG 324
            +WV W D DI   P +VI+D+ S +  V   NV++      E     + YD N+W ES 
Sbjct: 232 TAWVLWLDADIIETPPTVIQDMTSHDKSVLAANVYQKYFDNDEKKMAIRPYDFNNWRESD 291

Query: 325 EALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLF 384
             L++A  +DE+++IVEGY+E  T+R  + +  N D    + ++LDGVGG   L KA + 
Sbjct: 292 IGLEIAANMDENEIIVEGYSEIATYRPLMAHFYNADGQVTDEMELDGVGGGCTLVKADVH 351

Query: 385 RAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYE 428
           R G  FP F F +  ETE F KMAK+++Y V GLP+Y V+HI E
Sbjct: 352 RDGAMFPNFPFYHLIETEGFAKMAKRLNYGVFGLPNYLVYHIEE 395

>Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050C
           (MNN9) - Protein required for complex glycosylation
           [contig 27] FULL
          Length = 453

 Score =  169 bits (429), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 106/344 (30%), Positives = 167/344 (48%), Gaps = 53/344 (15%)

Query: 88  YDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSE 147
           YDL+K   + N A N++ VL+  P++         + +L+ LTYP EL++L F++   + 
Sbjct: 158 YDLNKLTSTANAALNKEQVLILTPMQTFHEE---YWNNLLQLTYPRELLELGFIIPRTTS 214

Query: 148 DDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAFK 207
            D+ L  L A  K+ Q             + +K                           
Sbjct: 215 GDNALRKLEAAVKKTQ-------------LSKK--------------------------- 234

Query: 208 PPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPY 267
                  D+ F  + + ++D          DRHA+ VQ  RR  M  ARN L  + + PY
Sbjct: 235 -------DQRFLKITILRQDSQSFDLLKEKDRHALEVQKKRRSAMALARNELLFSTIGPY 287

Query: 268 HSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQA---YDLNSWVESG 324
            SWV W D DI   P ++I+D+ + +  V   NV++   +   G++    YD N+W +S 
Sbjct: 288 TSWVLWLDADIIETPPTLIQDMTAHDKAVLAANVYQHSIDKKTGQKTKGPYDFNNWADSD 347

Query: 325 EALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLF 384
            AL++A ++ +D V+ EGY E  T+R  + +      +P   + LDGVGG   L KA++ 
Sbjct: 348 TALQMAASMPDDGVLFEGYGEMATYRTLMAHFYKEGESPSAEMVLDGVGGGCTLVKAEVH 407

Query: 385 RAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYE 428
           R G  FP+F F +  ETE F KMA+++ Y + GLP+Y V+HI E
Sbjct: 408 RDGAMFPSFPFYHLIETEGFAKMAQRLDYEIYGLPNYLVYHIEE 451

>YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON}
           MNN9Subunit of Golgi mannosyltransferase complex also
           containing Anp1p, Mnn10p, Mnn11p, and Hoc1p that
           mediates elongation of the polysaccharide mannan
           backbone; forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 395

 Score =  168 bits (425), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 108/347 (31%), Positives = 169/347 (48%), Gaps = 59/347 (17%)

Query: 88  YDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSE 147
           YDL+K   +   A N++H+L+  P++         + +L+ L YP ELI+L F+    + 
Sbjct: 99  YDLNKLHSTSEAAVNKEHILILTPMQTFHQQ---YWDNLLQLNYPRELIELGFITPRTAT 155

Query: 148 DDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAFK 207
            D  L  L    K++Q    ++ F++   +R+ +              Q +  ++E    
Sbjct: 156 GDLALKKLENAIKKVQTDKKTQRFSKITILRQNS--------------QSFDKLME---- 197

Query: 208 PPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPY 267
                                         +RHA+ VQ  RR  M  ARN L  + + P+
Sbjct: 198 -----------------------------KERHALDVQKERRAAMALARNELLFSTIGPH 228

Query: 268 HSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQA------YDLNSWV 321
            SWV W D DI   P S+I+D+   N  +   N+++    F   E+       YD N+W 
Sbjct: 229 TSWVLWLDADIIETPPSLIQDMTKHNKAILAANIYQ---RFYDEEKKQPSIRPYDFNNWQ 285

Query: 322 ESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKA 381
           ES   L++A+ + +D++IVEGYAE  T+R  + +  + +  P E + LDGVGG   L KA
Sbjct: 286 ESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKA 345

Query: 382 KLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYE 428
           ++ R G  FP F F +  ETE F KMAK+++Y V GLP+Y V+HI E
Sbjct: 346 EVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  167 bits (423), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 106/344 (30%), Positives = 167/344 (48%), Gaps = 53/344 (15%)

Query: 88  YDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSE 147
           YDL+K   + + A N++H+L+  P++         + +L+ L YP ELI+L F+    + 
Sbjct: 99  YDLNKLHSTPDAAVNKEHILILTPMQTFHQQY---WDNLLQLNYPRELIELGFITPRTAT 155

Query: 148 DDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAFK 207
            D  L  L +  K++Q    ++ F++   +R+ +              Q +  ++E    
Sbjct: 156 GDSALKKLESAIKKVQTDKKTQRFSKITILRQNS--------------QSFDKLME---- 197

Query: 208 PPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPY 267
                                         +RHA+ VQ  RR  M  ARN L  + + P+
Sbjct: 198 -----------------------------KERHALEVQKERRAAMALARNELLFSTIGPH 228

Query: 268 HSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPL---PEFLGGEQAYDLNSWVESG 324
            SWV W D DI   P S+I+D+   N  V   N+++      +     + YD N+W ES 
Sbjct: 229 TSWVLWLDADIIETPTSLIQDMTQHNKAVLAANIYQRFYDQEKKQASIRPYDFNNWQESD 288

Query: 325 EALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLF 384
             L +A+ + +D++IVEGYAE  T+R  + +  +      E + LDGVGG   L KA++ 
Sbjct: 289 IGLDIASQMGDDEIIVEGYAEIATYRPLMAHFFDASKPQNEEMALDGVGGGCTLVKAEVH 348

Query: 385 RAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYE 428
           R G  FP F F +  ETE F KMAK+++Y V GLP+Y V+HI E
Sbjct: 349 RDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON}
           (197094..198272) [1179 nt, 393 aa]
          Length = 392

 Score =  167 bits (423), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 108/347 (31%), Positives = 169/347 (48%), Gaps = 59/347 (17%)

Query: 88  YDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSE 147
           YDL+K   + +   +++HVL+  P++         +++L+ L+YP ELI+L F++     
Sbjct: 99  YDLNKLHSTSDSISDKEHVLVLTPMQTFHEK---YWENLLKLSYPRELIELGFIIPRSDA 155

Query: 148 DDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAFK 207
            D  L  L    K +Q+   +  F++   +R+++              Q +  + E    
Sbjct: 156 GDAALKKLETAVKNVQSDKKNNRFSKITILRQES--------------QSFDKLEE---- 197

Query: 208 PPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPY 267
                                         +RH++ VQ  RR  M  ARN L  + L P+
Sbjct: 198 -----------------------------KERHSLAVQKERRAAMALARNELLFSTLGPH 228

Query: 268 HSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQA------YDLNSWV 321
            SWV W D DI   P +VIE +   +  V   NV++    F   ++       YD N+W 
Sbjct: 229 TSWVLWLDSDIVETPTTVIESMTKHDKPVLAANVYQ---RFFDNDKQQDSIRPYDFNNWA 285

Query: 322 ESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKA 381
           ES   L+LA+ + +D++IVEGYAE  T+R  + +  NP  +  E + LDGVGG   L KA
Sbjct: 286 ESDIGLQLASKMGDDEIIVEGYAEIATYRPLMAHFYNPSGDVGEEMALDGVGGGCTLVKA 345

Query: 382 KLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYE 428
           ++ R G  FP F F +  ETE F KMAK+++Y V GLP++ V+HI E
Sbjct: 346 EVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNFLVYHIEE 392

>ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 396

 Score =  167 bits (422), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 107/344 (31%), Positives = 166/344 (48%), Gaps = 53/344 (15%)

Query: 88  YDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSE 147
           YDL+K   +   A N++HVL+  P++         + +L+ LTYP E  +L F++   S 
Sbjct: 100 YDLNKLHSTAEAALNKEHVLILTPMQTFHQEY---WDNLLQLTYPREFTELGFILPRTSS 156

Query: 148 DDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAFK 207
            D  L  L A  K++Q    ++ F++   +R+ ++                         
Sbjct: 157 GDIALSKLEAAVKKVQTDKKNQRFSKITILRQNSA------------------------- 191

Query: 208 PPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPY 267
                 +DK                     +RHA+ VQ  RR  M  ARN L  ++L P 
Sbjct: 192 -----GFDKLMEK-----------------ERHALEVQKERRSAMASARNELLFSSLGPK 229

Query: 268 HSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGE---QAYDLNSWVESG 324
            SWV W D DI   P ++I+D+ S N  V   NV++   +    +   + YD N+W ES 
Sbjct: 230 TSWVLWLDADIVETPPNLIQDMTSHNKAVLSANVYQKYYDDQAKKVQIRPYDFNNWQESD 289

Query: 325 EALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLF 384
            AL+LA  + +D+++VEGY +  T+R  + Y  +        ++LDGVGG   L KA + 
Sbjct: 290 TALELAKQMGDDEILVEGYGDLATYRALMAYFYDATGATNAEMNLDGVGGGCTLVKADVH 349

Query: 385 RAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYE 428
           R G  FP F F +  ETE F KMA++++Y + GLP+Y V+HI E
Sbjct: 350 RDGAMFPTFPFYHLIETEGFAKMAQRLNYDIFGLPNYLVYHIEE 393

>AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL050C
           (MNN9)
          Length = 389

 Score =  166 bits (421), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 111/342 (32%), Positives = 162/342 (47%), Gaps = 56/342 (16%)

Query: 88  YDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSE 147
           YDL+  + +   A N + VL+  P++         + +L+ LTYP + I L FL+   S 
Sbjct: 97  YDLNTLQSTAMAAANGEQVLILTPMQIFHQQ---YWDNLLLLTYPRKYIHLGFLLPRTSS 153

Query: 148 DDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAFK 207
            +  L  L    +++Q G                                          
Sbjct: 154 GNTALRKLEKAVRKVQTGP----------------------------------------- 172

Query: 208 PPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPY 267
                  D+ F  + + ++DF        S RH   VQ  RR  M  ARN L  + + PY
Sbjct: 173 ------KDQRFGKITILRQDFASFNKLSQSARHRFHVQKERRSAMALARNELLFSTIGPY 226

Query: 268 HSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGE---QAYDLNSWVESG 324
            SWV W D DI   P ++IED+ S N  +   NV++   E   GE   +AYDLN+W ES 
Sbjct: 227 TSWVLWLDSDIVETPNTLIEDMTSHNKPILAANVYQRYVE--NGEPAIRAYDLNNWAESE 284

Query: 325 EALKLANTLDEDDVIVEGYA-EYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKL 383
             LK+A+ L ED +IVEGY  E+ T+R  + ++ +      E++ LDGVGG   L KA++
Sbjct: 285 LGLKIASELPEDQIIVEGYGDEFATYRPLMAHMYSDKRPKDELMALDGVGGGCTLVKAEV 344

Query: 384 FRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWH 425
            R G  FP F F +  ETE F KMAK+++Y + GLP+Y V+H
Sbjct: 345 HRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIYGLPNYLVYH 386

>NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {ON}
           Anc_8.500
          Length = 396

 Score =  165 bits (417), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 106/354 (29%), Positives = 175/354 (49%), Gaps = 53/354 (14%)

Query: 78  EMLLGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELID 137
           E++    +  +DL+K   +++ + N++ VL+  PL+         +++++ L+YP ELI+
Sbjct: 90  EIISEGHIAEFDLNKLHSTKDASINKEKVLILTPLQKFHQE---YWENILQLSYPRELIE 146

Query: 138 LAFLVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQD 197
           L F+V      D  L +L    ++ Q    ++ FA+   +R+ +                
Sbjct: 147 LGFIVPRTQTGDLALQSLEKAVEKTQTDKKNQRFAKVTILRQDSE--------------- 191

Query: 198 YLNMVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARN 257
                       F+K  +K                     +RHA+ VQ  RR  M  ARN
Sbjct: 192 -----------SFNKLAEK---------------------ERHALNVQKERRSSMALARN 219

Query: 258 WLTANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPL---PEFLGGEQA 314
            L  + + P+ SWV W D DI   P ++I+D+ + +  V   NV++      +     + 
Sbjct: 220 ELLFSTIGPHTSWVLWLDADIVETPSTLIQDMTAHDKSVLAANVFQRYYDDEKKASATRP 279

Query: 315 YDLNSWVESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGG 374
           YD N+W ES   L+LA+ +++D++IVEGY+E  T+R  + Y  +      E + LDGVGG
Sbjct: 280 YDFNNWQESEIGLELASKMNDDEIIVEGYSEIATYRPLMAYFHDTTKPVSEEMILDGVGG 339

Query: 375 VSILAKAKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYE 428
              L KA++ R G  FP+F F +  ETE F KMAK++ Y + GLP+Y V+HI E
Sbjct: 340 GCTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMAKRLGYEIFGLPNYLVYHIEE 393

>NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {ON}
           Anc_8.500
          Length = 400

 Score =  160 bits (404), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 103/341 (30%), Positives = 167/341 (48%), Gaps = 52/341 (15%)

Query: 88  YDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSE 147
           YDL+K + S N AEN++HVL+  PL++        + +L+ L+YP + I+L F++    +
Sbjct: 106 YDLNKLQSSANAAENKEHVLILTPLKSFEQG---YWDNLLKLSYPRDAIELGFIIPRTKK 162

Query: 148 DDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAFK 207
            D +L  L +  K++Q     + F++   +R+ +                          
Sbjct: 163 GDHSLKKLESAIKKVQTAKQGDKFSKITILRQNS-------------------------- 196

Query: 208 PPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPY 267
               K ++      +V + ++ + I                R  M  ARN L A+ L P 
Sbjct: 197 ----KGFETVPEKKEVSEIEYEKQI----------------RAEMALARNELLASTLGPQ 236

Query: 268 HSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGE---QAYDLNSWVESG 324
            +W+ W D DI   P S+I+D+   +  V   NV+    +   GE   + YD  +W+ES 
Sbjct: 237 TAWILWLDSDIVETPPSLIQDMTHHDKPVLAANVYERYKDRESGELSIRPYDFRNWIEST 296

Query: 325 EALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLF 384
           EAL+LA+ + ED++IVEG A   T R  + +    D +P   + LDGVG   +L K+++ 
Sbjct: 297 EALQLASGMQEDEIIVEGLAGISTNRQLMTHFYQQDGSPSSEISLDGVGASCLLVKSEVH 356

Query: 385 RAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWH 425
           R G  FP F F +  E+E F KMAK++ Y V GLP+Y V+H
Sbjct: 357 RDGAMFPNFPFYHLIESEGFAKMAKRLTYEVYGLPNYLVYH 397

>Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar to
           Ashbya gossypii AGL259C
          Length = 390

 Score =  153 bits (387), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 101/343 (29%), Positives = 166/343 (48%), Gaps = 52/343 (15%)

Query: 88  YDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSE 147
           YD++    + +   N++ VL+  P++   +     +++L++LTYP +L  L F++     
Sbjct: 98  YDMNTLTTTSSPLANKEIVLILTPMQKFHDKY---WENLLSLTYPRKLTQLGFIIPRTPT 154

Query: 148 DDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAFK 207
            D  +  L    K++Q+G  ++ F                 L +  + QD          
Sbjct: 155 GDVAMKRLEDAVKKVQSGKENQRF-----------------LKITILRQD---------S 188

Query: 208 PPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPY 267
             F+K  +K                     +RHA  VQ  RR  M  ARN L  + + P 
Sbjct: 189 QSFNKLDEK---------------------ERHAFNVQKERRAAMALARNELVFSTIGPS 227

Query: 268 HSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGE--QAYDLNSWVESGE 325
            SW+ W D DI   P +VI+D+ + +  +   NV++   +    E  + YD N+W ES  
Sbjct: 228 TSWILWLDADIVETPATVIQDMAAHDKAILAANVFQRYIDDQNQENIRPYDFNNWQESQT 287

Query: 326 ALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLFR 385
            L++A ++ +D++IVE Y E  T+R  +  + +P+ +P   + LDGVGG   L KA++ R
Sbjct: 288 GLEIAASMKDDEIIVESYHEIVTYRPLMAKLYDPNGSPSAEMSLDGVGGGCTLVKAQVHR 347

Query: 386 AGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYE 428
            G  FP F F +  ETE F  MAK+++Y V GLP+Y V+H  E
Sbjct: 348 DGAMFPNFPFYHLIETEGFAHMAKRLNYEVFGLPNYLVYHFNE 390

>NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON}
           Anc_8.500
          Length = 402

 Score =  145 bits (366), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 105/344 (30%), Positives = 168/344 (48%), Gaps = 55/344 (15%)

Query: 88  YDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSE 147
           YDL+K   S N  EN++HVL+  PL++        +++L+NL+YP +LI+L F+V +  +
Sbjct: 105 YDLNKLVSSANALENKEHVLILTPLQSFDEK---YWENLLNLSYPRDLIELGFMVPNTKK 161

Query: 148 DDDTLDALIAYSKELQ---NGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEM 204
            D  L  L    K +Q       S  FA+   +R+K S                      
Sbjct: 162 GDQILKQLENAVKNVQGIDKKLGSNKFAKITILRQKDS---------------------- 199

Query: 205 AFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANAL 264
                FHK  D+         KD  ++        + + ++  +R  M  ARN L ++ L
Sbjct: 200 ----GFHKFNDR---------KDKKEM--------NDIELEKEKRAEMALARNELLSSTL 238

Query: 265 KPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQA----YDLNSW 320
               +W+ W D ++   P ++I+D+   +  V   NV+  + +    ++A    YD  +W
Sbjct: 239 SHSTAWILWLDSNVIETPNTLIQDMTQHDKPVLATNVY--MKDSNDKDKANIRPYDFRNW 296

Query: 321 VESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAK 380
           +ES  AL+LA+ + ED++IVEG A   T R  +      D +P E L LDG+G    L K
Sbjct: 297 IESDTALQLASEMPEDEIIVEGMAGLATNRQLMTNFYESDGSPTEELALDGIGAACTLVK 356

Query: 381 AKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVW 424
           +++ R G  FP F F +  E+E F KMAK++ Y V GLP+Y V+
Sbjct: 357 SEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVVGLPNYLVF 400

>KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {ON} 
          Length = 357

 Score = 93.6 bits (231), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 86/175 (49%), Gaps = 3/175 (1%)

Query: 249 RKLMGRARNWLTANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEF 308
           RK +   +N L  + L PY SWV W D  I   P ++++DL +    +   +++      
Sbjct: 183 RKQLAALKNQLLFSTLPPYCSWVLWLDSQITGTPTTLVQDLANHGKAILTTHIFN---NS 239

Query: 309 LGGEQAYDLNSWVESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILD 368
            G   +  LN+WV S     LA  +    V++EG +   T R  +G   +  A+    ++
Sbjct: 240 DGSPDSETLNNWVASDTWRSLATGMPHSRVVIEGVSHVYTDRPLMGQFYDAAASVLTEME 299

Query: 369 LDGVGGVSILAKAKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTV 423
           LD V     L KA++ R G  FP F F +  ETE F +MA+ + ++  GLP+Y V
Sbjct: 300 LDSVSTACTLVKAEVHRDGAMFPNFAFHHLVETEGFARMARLLKHQAFGLPNYVV 354

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 3/71 (4%)

Query: 85  VDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSD 144
           +  Y+L++   S +   + +H+L+ +PL N  +     F++L  LTYP +LIDL  +V D
Sbjct: 79  ISYYNLNELAASPDAEGHSEHILVLIPLINFNS---RFFENLFALTYPKQLIDLGVIVPD 135

Query: 145 CSEDDDTLDAL 155
                  L AL
Sbjct: 136 SKNATGILQAL 146

>SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, 565
           aa] {ON} weakly similar to gnl|GLV|DEHA0C12881g
           Debaryomyces hansenii DEHA0C12881g
          Length = 565

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 92/210 (43%), Gaps = 35/210 (16%)

Query: 238 DRHAVTVQGIRRKLMGRARNWLTANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVA 297
           DRH  +VQ  RRK + + RN+L  N       +    D D+ + P  ++E  + +  ++ 
Sbjct: 368 DRHKDSVQRARRKTIAKVRNFL-YNRSHMDEKYTLTIDSDMMVIPSDMLEKFVKMGKELI 426

Query: 298 VPNVWRPLPEFLGGEQAYDLNSWVESGEALKLANTLDEDDVIVEGYAEYPT--------- 348
           VP + R     +G ++ YD N+W+  GE  K  +T  +++   E Y   P          
Sbjct: 427 VPRILR-----VGSDREYDKNTWI--GERTKPEDTSKQNNY--ESYVPRPVNGKTKFLQD 477

Query: 349 ---WRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLFRAGVHFPAFTF---------- 395
               ++ L    +P+A    +++LD VGG  +    K+F  G+ FP F            
Sbjct: 478 CVDEKITLN---SPEAYTDNVVELDSVGGAILFWDNKIFDQGIQFPVFYLIGSDWDHSEG 534

Query: 396 ENHAETEAFGKMAKKMHYRVGGLPHYTVWH 425
            +  ETE     AK + Y+  G+P+    H
Sbjct: 535 YDGVETEGLCYQAKTLGYKCYGVPNVICRH 564

>YCR019W Chr3 (152837..153928) [1092 bp, 363 aa] {ON}  MAK32Protein
           necessary for structural stability of L-A
           double-stranded RNA-containing particles
          Length = 363

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 55/133 (41%), Gaps = 12/133 (9%)

Query: 280 LCPGS----VIEDLMSLNLDVAVPNV--WRPLPEFLGGEQAYDLNSWVESGE-ALKLANT 332
           LC GS    +I DL+ +        +  W P P+    +   D+ S ++  +  + L+  
Sbjct: 145 LCSGSRCLDIINDLLRVKSSKGTKPIVIWEPFPDLCDFDHQNDIKSVMQRNDVTVILSPN 204

Query: 333 LDEDDVIVEGYAEYPTWRVHLGYIRNP-----DANPYEILDLDGVGGVSILAKAKLFRAG 387
            +E   +    ++ PT       + +      D N   IL    +G +S+  K K  R  
Sbjct: 205 AEESSRLFGLSSKEPTSLEECLALAHRFDDFMDENNMCILRCGALGSISVSEKFKNGRTY 264

Query: 388 VHFPAFTFENHAE 400
            HFPA+ F+  ++
Sbjct: 265 DHFPAYHFKTQSK 277

>AGL343C Chr7 complement(72374..73297) [924 bp, 307 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR282C
           (BGL2) Newly annotated start codon according to
           experimentaly determined 5' end of mRNA using 5' RACE.
          Length = 307

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 37/79 (46%)

Query: 212 KDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPYHSWV 271
           +D  K    V+ F KD   + G  FS +   TV      + GR+R  + A+ L   +++ 
Sbjct: 130 EDLAKRINEVRNFVKDIKDINGNSFSGKPVGTVDSWNVIVDGRSRPVIEASDLVMANAFS 189

Query: 272 YWRDVDIELCPGSVIEDLM 290
           YW+   ++    S  +D+M
Sbjct: 190 YWQGQTMQNASYSFFDDIM 208

>Ecym_2158 Chr2 (294821..300493) [5673 bp, 1890 aa] {ON} similar to
            Ashbya gossypii AFL138W
          Length = 1890

 Score = 30.8 bits (68), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 4/65 (6%)

Query: 41   DVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEMLLGATVDVYDLSKYEGSENGA 100
            D DI QKY    E  ++   G  ++ PE    Y  E +MLL   +   +L  +E S+  A
Sbjct: 1087 DKDIKQKY----ESHILEHSGIRLIEPELFNGYNPEKKMLLQEVIIEEELEPFEASKESA 1142

Query: 101  ENRDH 105
            E   H
Sbjct: 1143 EQFKH 1147

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.138    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,365,609
Number of extensions: 2302344
Number of successful extensions: 5458
Number of sequences better than 10.0: 73
Number of HSP's gapped: 5542
Number of HSP's successfully gapped: 117
Length of query: 447
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 334
Effective length of database: 40,524,141
Effective search space: 13535063094
Effective search space used: 13535063094
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)