Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0D01408gna 1ON50650624020.0
KLLA0D01507gna 1ON51543912151e-162
Ecym_4614na 1ON4814309771e-127
ABL123Cna 1ON4944277472e-92
NDAI0E021058.677ON4083932272e-19
NCAS0C013608.677ON4063482236e-19
KNAG0J017108.677ON4153972085e-17
CAGL0M02211g8.677ON4153532086e-17
Kwal_26.88028.677ON4123482042e-16
KLTH0D11264g8.677ON4173552032e-16
TBLA0B038308.677ON4133492023e-16
Kpol_1072.158.677ON3993451971e-15
Kpol_1013.68.677ON4023621962e-15
ACR144W8.677ON4083441925e-15
TDEL0A062308.677ON4083511917e-15
TPHA0D012608.677ON4193501927e-15
Smik_6.3518.677ON4053481891e-14
Skud_16.1288.677ON4053481882e-14
YPL154C (PEP4)8.677ON4053481863e-14
Suva_16.1568.677ON4063481863e-14
ZYRO0F07392g8.677ON4183451846e-14
KLLA0D05929g8.677ON4093501847e-14
SAKL0H06512g8.677ON4043481765e-13
Ecym_23968.677ON4153441731e-12
ACR143WsingletonON3933431722e-12
KAFR0H024208.677ON4163501605e-11
TPHA0C008408.318ON10003951332e-07
NDAI0B017207.182ON5473061278e-07
YLR121C (YPS3)8.319ON5083621232e-06
Skud_12.1938.319ON4973711142e-05
SAKL0F07172g7.182ON5421221143e-05
AGL192W8.318ON4993821143e-05
Suva_9.186singletonOFF5431211143e-05
Suva_9.1877.182ON3331211124e-05
CAGL0E01837gsingletonON5211281124e-05
KNAG0I009108.318ON5691331125e-05
YIL015W (BAR1)7.182ON5873991109e-05
Skud_9.1547.182ON5161211101e-04
KNAG0I01200singletonON6773681091e-04
Ecym_42518.318ON5023581054e-04
Smik_12.1878.319ON5073491044e-04
Smik_9.1757.182ON5933941036e-04
ZYRO0E02266gsingletonON5061331036e-04
ZYRO0F10318g8.319ON4863901029e-04
NCAS0A124607.182ON5401201000.001
CAGL0J02288g7.182ON541131990.002
KAFR0B057108.318ON575119990.002
AGR407CsingletonON268153960.002
KLLA0D15917g7.182ON511126980.002
ZYRO0F10252gsingletonON551120980.003
Suva_10.2128.319ON745395970.004
Suva_16.14singletonON540301950.005
YLR120C (YPS1)8.318ON569120950.005
ZYRO0F10274gsingletonON572224950.005
Smik_65.1singletonON342272940.006
Suva_9.13singletonON464304950.006
Kpol_543.618.318ON588382950.006
NCAS0C033008.318ON559392940.008
Smik_5.7singletonON304115920.009
CAGL0E01727gsingletonON539208920.011
KAFR0B06530singletonON538371920.012
CAGL0E01749gsingletonON482123910.016
KNAG0G024108.318ON530371900.020
CAGL0E01859gsingletonON505127900.021
Smik_4.3888.318ON597315880.034
Suva_79.1singletonON227115850.057
YIR039C (YPS6)singletonON537331860.063
KNAG0H027607.182ON563391860.074
ZYRO0G02904gsingletonON531118850.083
NCAS0B035608.318ON586123840.11
KLTH0F06754gsingletonON767135850.11
AGR240W7.182ON452393840.12
Kwal_33.14239singletonON651250840.13
Suva_34.1singletonON387120830.15
SAKL0C02970gsingletonON592126830.17
TBLA0D045807.182ON395123810.21
ZYRO0D15554g7.182ON521363820.22
YDR144C (MKC7)8.318ON596299810.28
KNAG0E03220singletonON540180810.30
TPHA0A015808.318ON600399790.53
CAGL0M04191g8.318ON601119770.80
KAFR0H023008.318ON521123770.86
Suva_2.3058.318ON597463760.99
CAGL0E01793gsingletonON51635761.0
CAGL0E01419g8.318ON591126751.4
TBLA0D00140singletonON607118751.5
Kpol_1059.335.401ON66290751.5
Skud_4.4038.318ON590313751.5
CAGL0E01771gsingletonON519131741.7
CAGL0E01815gsingletonON51936742.0
Suva_11.251.506ON1046121742.1
SAKL0H15664g8.318ON55628732.2
KAFR0D049905.419ON56255723.1
ZYRO0F10296gsingletonON528121723.4
ZYRO0F10230g8.318ON580126723.5
KAFR0E03940singletonON63829705.0
TBLA0E02630singletonON689119705.1
Smik_12.1868.318ON572300705.5
Skud_12.1928.318ON569128706.2
Kwal_56.239028.318ON62965697.5
Kwal_26.7254singletonON57027697.7
TBLA0A039108.318ON596117689.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0D01408g
         (506 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly...   929   0.0  
KLLA0D01507g Chr4 (133636..135183) [1548 bp, 515 aa] {ON} weakly...   472   e-162
Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {O...   380   e-127
ABL123C Chr2 complement(164739..166223) [1485 bp, 494 aa] {ON} N...   292   2e-92
NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}     92   2e-19
NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {O...    91   6e-19
KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8....    85   5e-17
CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa] ...    85   6e-17
Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C...    83   2e-16
KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly...    83   2e-16
TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {O...    82   3e-16
Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {O...    80   1e-15
Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON} (10059.....    80   2e-15
ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic ho...    79   5e-15
TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON} Anc_8...    78   7e-15
TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.6...    79   7e-15
Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C ...    77   1e-14
Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {...    77   2e-14
YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON} ...    76   3e-14
Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {...    76   3e-14
ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly...    75   6e-14
KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly...    75   7e-14
SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {...    72   5e-13
Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}...    71   1e-12
ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic ho...    71   2e-12
KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {O...    66   5e-11
TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8....    56   2e-07
NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {O...    54   8e-07
YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON} ...    52   2e-06
Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {...    49   2e-05
SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {...    49   3e-05
AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic ho...    49   3e-05
Suva_9.186 Chr9 (310161..310220,310267..310332,310362..310451,31...    49   3e-05
Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W ...    48   4e-05
CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {...    48   4e-05
KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON}               48   5e-05
YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspart...    47   9e-05
Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W ...    47   1e-04
KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON}               47   1e-04
Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}...    45   4e-04
Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {...    45   4e-04
Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W ...    44   6e-04
ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {...    44   6e-04
ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {...    44   9e-04
NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa] ...    43   0.001
CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa] ...    43   0.002
KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa] ...    43   0.002
AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON} ...    42   0.002
KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]...    42   0.002
ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {...    42   0.003
Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {...    42   0.004
Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C (...    41   0.005
YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON} ...    41   0.005
ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {...    41   0.005
Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)        41   0.006
Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)    41   0.006
Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {O...    41   0.006
NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON}               41   0.008
Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)        40   0.009
CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} simila...    40   0.011
KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON}             40   0.012
CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {...    40   0.016
KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {O...    39   0.020
CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {...    39   0.021
Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON...    39   0.034
Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C...    37   0.057
YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}  ...    38   0.063
KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.1...    38   0.074
ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} simila...    37   0.083
NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {O...    37   0.11 
KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly...    37   0.11 
AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic ...    37   0.12 
Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144...    37   0.13 
Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR0...    37   0.15 
SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some s...    37   0.17 
TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa] ...    36   0.21 
ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]...    36   0.22 
YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}  ...    36   0.28 
KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {O...    36   0.30 
TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.3...    35   0.53 
CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa] ...    34   0.80 
KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.3...    34   0.86 
Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON...    34   0.99 
CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {...    34   1.0  
CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} simila...    33   1.4  
TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON}                 33   1.5  
Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON} (70588....    33   1.5  
Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON...    33   1.5  
CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {...    33   1.7  
CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {...    33   2.0  
Suva_11.25 Chr11 complement(54969..58109) [3141 bp, 1046 aa] {ON...    33   2.1  
SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} simi...    33   2.2  
KAFR0D04990 Chr4 (981180..982868) [1689 bp, 562 aa] {ON} Anc_5.4...    32   3.1  
ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {...    32   3.4  
ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {...    32   3.5  
KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON}               32   5.0  
TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {O...    32   5.1  
Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {...    32   5.5  
Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {...    32   6.2  
Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {...    31   7.5  
Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C...    31   7.7  
TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {O...    31   9.3  

>SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A),
           required for the posttranslational precursor maturation
           of vacuolar proteinases; synthesized as a zymogen,
           self-activates
          Length = 506

 Score =  929 bits (2402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/506 (90%), Positives = 460/506 (90%)

Query: 1   MTGPLLVIFLGVLFPSLALGFFPTSRDRFLQDNSCYEVNALNKQHEEATSLGNFAGSSYT 60
           MTGPLLVIFLGVLFPSLALGFFPTSRDRFLQDNSCYEVNALNKQHEEATSLGNFAGSSYT
Sbjct: 1   MTGPLLVIFLGVLFPSLALGFFPTSRDRFLQDNSCYEVNALNKQHEEATSLGNFAGSSYT 60

Query: 61  PQHYKDTAVSNSSNETFAKIQVKPGISILQSDEHSQAYFVDVTIGDVAYPLIIDTGSAYL 120
           PQHYKDTAVSNSSNETFAKIQVKPGISILQSDEHSQAYFVDVTIGDVAYPLIIDTGSAYL
Sbjct: 61  PQHYKDTAVSNSSNETFAKIQVKPGISILQSDEHSQAYFVDVTIGDVAYPLIIDTGSAYL 120

Query: 121 WVYGDSCNSSSCKGRKLFPTTNVLQDVASFSLAYTSGVAVGDVYHDRIIVNELATTDNFT 180
           WVYGDSCNSSSCKGRKLFPTTNVLQDVASFSLAYTSGVAVGDVYHDRIIVNELATTDNFT
Sbjct: 121 WVYGDSCNSSSCKGRKLFPTTNVLQDVASFSLAYTSGVAVGDVYHDRIIVNELATTDNFT 180

Query: 181 FGVASEVPDIFENYPASGIFGLPSDNSQSIENIISKLRSSNAISMEKFSILIGHINAEVS 240
           FGVASEVPDIFENYPASGIFGLPSDNSQSIENIISKLRSSNAISMEKFSILIGHINAEVS
Sbjct: 181 FGVASEVPDIFENYPASGIFGLPSDNSQSIENIISKLRSSNAISMEKFSILIGHINAEVS 240

Query: 241 EEEDGDVQDLTSNKGIFAIGDELEGLYKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNF 300
           EEEDGDVQDLTSNKGIFAIGDELEGLYKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNF
Sbjct: 241 EEEDGDVQDLTSNKGIFAIGDELEGLYKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNF 300

Query: 301 TNYENFTGSKSHNTRSSIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIMCNSTQTL 360
           TNYENFTGSKSHNTRSSIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIMCNSTQTL
Sbjct: 301 TNYENFTGSKSHNTRSSIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIMCNSTQTL 360

Query: 361 TLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDV 420
           TLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDV
Sbjct: 361 TLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDV 420

Query: 421 ENQRLGFAEGNENALLVPYSKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 480
           ENQRLGFAEGNENALLVPYSKE                                      
Sbjct: 421 ENQRLGFAEGNENALLVPYSKETNATTSSTNNTSEPSSQSTVEATLTSTTSASTTSSSSK 480

Query: 481 XXXXXXXXPRSRSLMLTIVMMIFNTA 506
                   PRSRSLMLTIVMMIFNTA
Sbjct: 481 SNVGLSFSPRSRSLMLTIVMMIFNTA 506

>KLLA0D01507g Chr4 (133636..135183) [1548 bp, 515 aa] {ON} weakly
           similar to uniprot|Q12303 Saccharomyces cerevisiae
           YLR121C YPS3 Aspartic protease
          Length = 515

 Score =  472 bits (1215), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 251/439 (57%), Positives = 323/439 (73%), Gaps = 9/439 (2%)

Query: 6   LVIFLGVLFP-SLALGFFPTSRDRFLQDNSCYEVNALNKQHEEATSLGNFAGSSYTPQHY 64
           L+I +  +F  +    F+P S +R+L   S ++V + N ++  A    N    + + Q  
Sbjct: 14  LIILITYIFNLTFVQAFYPCSGERYLSAGSAFKVESKNSKY--AAQFVNI-NDALSKQAL 70

Query: 65  KDTAVSNSSNETFAKIQVKPGISILQSDEHSQAYFVDVTIGDVAYPLIIDTGSAYLWVYG 124
           +  A + SS +   ++ VKPG+SIL +D ++QAYFV+VTIGD  YPL++D+GSAYLWVYG
Sbjct: 71  QGQATAKSSTKN-VEVPVKPGMSILSTDSNTQAYFVNVTIGDEIYPLVVDSGSAYLWVYG 129

Query: 125 DSCNSSSCKGRKLFPTTNVLQ--DVASFSLAYTSGVAVGDVYHDRIIVNELATTDNFTFG 182
            SC S SC   KLF T NV +  D ++FSL Y+SG A GDVY DRIIVN+LATT NFTFG
Sbjct: 130 SSCTSKSCTSNKLFSTDNVKRAADESTFSLIYSSGTASGDVYEDRIIVNKLATTQNFTFG 189

Query: 183 VASEVPDIFENYPASGIFGLPSDNSQSIENIISKLRSSNAISMEKFSILIGHINA-EVSE 241
           VA+EVPDIFENYP SGIFGLPS+NS +IE+IIS L  SNAISMEKFS++IG +N+ + + 
Sbjct: 190 VANEVPDIFENYPVSGIFGLPSNNSDNIESIISVLSESNAISMEKFSLIIGALNSKDNTT 249

Query: 242 EEDGDVQ-DLTSNKGIFAIGDELEGLYKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNF 300
            ED  +Q  LT NKG+F IGD +E LY G+I+Y SLI ++N YW LKI+++YVN   VNF
Sbjct: 250 SEDSALQAPLTENKGLFIIGDLVEDLYTGDIHYASLITNENHYWQLKIDSVYVNSQAVNF 309

Query: 301 TNYENFTGSKSHNTRSSIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIMCNSTQTL 360
           +  E  TGS+S   RS I+DSGTTLLILP QDALD+HT+F NS++DGTNFAI CNST+ L
Sbjct: 310 STSEAVTGSQSSYIRSGIVDSGTTLLILPTQDALDLHTFFVNSVSDGTNFAIPCNSTEIL 369

Query: 361 TLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDV 420
           +LE +   W I SE+YLG+ Y QDS YYGYCVSNIQGL++D++WILG VFL+  YAVFDV
Sbjct: 370 SLEINGVKWPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDKYAVFDV 429

Query: 421 ENQRLGFAEGNENALLVPY 439
           +NQ+ G A  NENA+LVPY
Sbjct: 430 QNQQFGLANKNENAILVPY 448

>Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {ON}
           similar to Ashbya gossypii ABL123C
          Length = 481

 Score =  380 bits (977), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 195/430 (45%), Positives = 272/430 (63%), Gaps = 13/430 (3%)

Query: 12  VLFPSLALGFFPTSRDRFLQDNSCYEVNALNKQHEEATSLGNFAGSSYTPQHYKDTAVSN 71
           +LF  L+L FFP+S  RFL +    +V   +             G  ++       AV  
Sbjct: 9   ILFLRLSLAFFPSSERRFLHNGKVGKVATADFWFPNEQVPSVRVGREFSFGDDSADAVKQ 68

Query: 72  SSNETF--AKIQVKPGISILQSDEHSQAYFVDVTIGDVAYPLIIDTGSAYLWVYGDSCNS 129
           ++++      + + P I+IL  D +S AY V+VTI D  Y LI+DTGSA+ WVYGDSC+ 
Sbjct: 69  AADDVLDPTYVHLSPAITILTRDSNSHAYIVNVTISDEEYSLILDTGSAFPWVYGDSCSL 128

Query: 130 SSCKGRKLFPTTNVLQDV--ASFSLAYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEV 187
            +C+GRKL+PT    Q V  ++F L Y  G+  G ++ D  I+N L T++ F FGVA+ V
Sbjct: 129 RACEGRKLYPTGGK-QTVNGSTFRLDYPYGITSGAIFQDSFIINNLNTSETFAFGVATSV 187

Query: 188 PDIFENYPASGIFGLPSDNSQSIENIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDV 247
           P +FENYP SGI GLP+++  ++E  +S L  S +I  +KF++ + HI +E +       
Sbjct: 188 PQMFENYPVSGILGLPANSPGTVEPALSVLYRSKSIRSQKFTLYLDHIESENTT------ 241

Query: 248 QDLTSNKGIFAIGDELEGLYKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFT 307
             L +N G+FAIG+ +  LYKG+IYY+ L+ + N+YW + I+ ++ N   V F N ENFT
Sbjct: 242 --LNANSGLFAIGEPITELYKGDIYYSELVVNPNNYWLIAIDRIFCNSTLVTFQNPENFT 299

Query: 308 GSKSHNTRSSIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIMCNSTQTLTLEFDNK 367
           G++S + RS IIDSG+T L+LPK DALDIH+Y   SITDG  FA+ CNST  LT E  NK
Sbjct: 300 GAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDGNYFAVFCNSTVDLTFELGNK 359

Query: 368 NWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGF 427
           NWTIP+  YLG+ Y + S YYGYCVSNI+G  I  +WILGDVF++  Y VFD++NQ++GF
Sbjct: 360 NWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGF 419

Query: 428 AEGNENALLV 437
           A  N N  LV
Sbjct: 420 ALKNSNVNLV 429

>ABL123C Chr2 complement(164739..166223) [1485 bp, 494 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
          Length = 494

 Score =  292 bits (747), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 164/427 (38%), Positives = 249/427 (58%), Gaps = 18/427 (4%)

Query: 18  ALGFFPTSRDRFLQ---DNSCYEVNALNKQHEE-ATSLGNFAGSSYTPQHYKDTAVSNSS 73
           AL     +++RFL+    +  Y++ A  +   E  TS  +  GS  T   Y  +      
Sbjct: 15  ALCLHLATQNRFLEATETSRIYKLLAPTRIVSEIKTSADDSTGS--TLLKYNRSGAETKK 72

Query: 74  NETFAKIQVKPGISILQSDEHSQAYFVDVTIGDVAYPLIIDTGSAYLWVYG-DSCNSSSC 132
           +     +  +P IS+L+ D  S+ + +  T G V+YPL++DTGSA  WVYG +S +S++ 
Sbjct: 73  SAQCNSLTFRPNISLLKRDPLSRVHIIQATFGGVSYPLVLDTGSAISWVYGVNSSSSANH 132

Query: 133 KGRKLFPTTNVLQDVAS--FSLAYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDI 190
           K R+ F   +    V    F++ Y SG A G +Y   + +N L   D F FGVA  VP +
Sbjct: 133 KARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLYTGTLSINGLKIQD-FRFGVAIGVPSL 191

Query: 191 FENYPASGIFGLPSDNSQSIENIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDVQDL 250
            + Y  SGIFGLPSD + S  +++  L+ S  I+ + FS+L+ HI +E         ++L
Sbjct: 192 LDAYALSGIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSES--------RNL 243

Query: 251 TSNKGIFAIGDELEGLYKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSK 310
             N G+   G+ L  LY+GE+ Y  L+P+  ++W + I   Y+   +V     +N +  K
Sbjct: 244 DDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPSIDK 303

Query: 311 SHNTRSSIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIMCNSTQTLTLEFDNKNWT 370
           +   RS IID+G+TL++LP++DAL +H+YF +SI+DG NFAI CNS++ + LE    NWT
Sbjct: 304 NIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIYCNSSEPIHLELSKHNWT 363

Query: 371 IPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEG 430
           I    ++G+ Y +DS Y GYCVSNIQG DI  +WILG+VFL+ +Y VFD+E +++GFA  
Sbjct: 364 ILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFANR 423

Query: 431 NENALLV 437
           N  A LV
Sbjct: 424 NTKATLV 430

>NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}
          Length = 408

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 106/393 (26%), Positives = 168/393 (42%), Gaps = 56/393 (14%)

Query: 56  GSSYTPQHYK-DTAVSNSSNETFAKIQVKPGISILQSDEHSQAYFVDVTIG--DVAYPLI 112
           G  Y  Q  K +  VS S +  F       G +I  S+  +  YF D+T+G    ++ +I
Sbjct: 51  GQKYLHQFEKFNPEVSFSRDHPFFTQGKNSGHNIPLSNYLNAQYFADITLGTPPQSFKVI 110

Query: 113 IDTGSAYLWVYGDSCNSSSCKGRKLF---PTTNVLQDVASFSLAYTSGVAVGDVYHDRII 169
           +DTGS+ LWV    C S +C     +    +++   +   F++ Y +G   G +  D + 
Sbjct: 111 LDTGSSNLWVPSVECGSLACYLHSKYDHDKSSSYKPNGTDFAIRYGTGSLEGYISQDTLN 170

Query: 170 VNELATTDNFTFGVASEVPDI-FENYPASGIFGLPSDNSQSIENIISKLRSSNAISME-- 226
           + +L       F  A+  P + F      GI GL  D S S+  ++      NAI  E  
Sbjct: 171 IGDLNIPKQ-DFAEATSEPGLTFAFGKFDGILGLAYD-SISVNKVVPPFY--NAIEQELL 226

Query: 227 ---KFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYKGEIYYNSLIPDKNSY 283
              KF+  +G  N    + EDG         G   IG   +  +KG+I +  L   + +Y
Sbjct: 227 DEKKFAFYLGDAN---KKSEDG---------GEITIGGIDKTKFKGDIDW--LPVRRKAY 272

Query: 284 WSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLILPKQDALDIHTYFGNS 343
           W +K   + + D    F   EN           + ID+GT+L+ LP   A  I+T  G  
Sbjct: 273 WEVKFEGIGLGD---QFAELEN---------HGAAIDTGTSLIALPSGLAEIINTEIGAK 320

Query: 344 ITDGTNFAIMCNSTQTL---TLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDI 400
                 + + C++   L   T  F+ KN+TI         Y       G C+S I  +D 
Sbjct: 321 KGWTGQYTVECDARPNLPDLTFNFNGKNFTI-------GPYDYTLEVSGSCISAIMPMDF 373

Query: 401 DDA----WILGDVFLEGIYAVFDVENQRLGFAE 429
            +      I+GD FL   Y+++D+EN  +G AE
Sbjct: 374 PEPVGPMAIIGDAFLRKYYSIYDLENNAVGLAE 406

>NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {ON}
           Anc_8.677
          Length = 406

 Score = 90.5 bits (223), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 88/348 (25%), Positives = 152/348 (43%), Gaps = 51/348 (14%)

Query: 98  YFVDVTIGDVA--YPLIIDTGSAYLWVYGDSCNSSSCKGRKLF---PTTNVLQDVASFSL 152
           YF D+++G     + +I+DTGS+ LWV    CNS +C     +    +++   +   F++
Sbjct: 92  YFADISVGTPPQNFKVILDTGSSNLWVPSSECNSLACFLHSKYDHDASSSYKANGTKFAI 151

Query: 153 AYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDI-FENYPASGIFGLPSDNSQSIE 211
            Y SG   G +  D + + +L T     F  A+  P + F      GI GL  D + S++
Sbjct: 152 QYGSGSLEGYISQDTLNIGDL-TIPKQDFAEATSEPGLTFAFGKFDGILGLAYD-TISVD 209

Query: 212 NIISKLRSS---NAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYK 268
            ++    ++     +  +KF+  +            GD +    N G   IG   E  +K
Sbjct: 210 KVVPPFYNAIEQGLLDEKKFAFYL------------GDTKKDEKNGGEITIGGIDESKFK 257

Query: 269 GEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLIL 328
           G+I +  L   + +YW +K   + + D      N+             + ID+GT+L+ L
Sbjct: 258 GDIEW--LPVRRKAYWEVKFEGIALGDQYAALENH------------GAAIDTGTSLITL 303

Query: 329 PKQDALDIHTYFGNSITDGTNFAIMCNSTQ---TLTLEFDNKNWTIPSEKYLGDKYSQDS 385
           P   A  I+T  G        + + C++      LT  F+ KN+TI    Y  +      
Sbjct: 304 PSGLAEIINTEIGAKKGWTGQYTLDCDTRDGLPDLTFNFNGKNFTISPFDYTLE------ 357

Query: 386 AYYGYCVSNIQGLDIDDAW----ILGDVFLEGIYAVFDVENQRLGFAE 429
              G C+S I  +D  +      I+GD FL   Y+++D++N  +G AE
Sbjct: 358 -VSGSCISAIMPMDFPEPMGPMAIVGDAFLRKYYSIYDLDNHAVGLAE 404

>KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8.677
           YPL154C
          Length = 415

 Score = 84.7 bits (208), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 100/397 (25%), Positives = 174/397 (43%), Gaps = 58/397 (14%)

Query: 56  GSSYTPQHYKD-TAVSNSSNETFAK------IQVKPGISILQSDEHSQAYFVDVTIGDVA 108
           G  Y  Q+ K    VS S +  F K       +V  G  +  S+  +  Y+ D+T+G   
Sbjct: 52  GQKYLNQYEKAFPEVSFSKHHPFFKGSAQDSFEVAKGHEVPLSNYLNAQYYTDITLGTPP 111

Query: 109 --YPLIIDTGSAYLWVYGDSCNSSSCKGRKLF---PTTNVLQDVASFSLAYTSGVAVGDV 163
             + +I+DTGS+ LWV    C S +C   + +    +++   +   FS+ Y SG   G +
Sbjct: 112 QQFKVILDTGSSNLWVPSSECGSLACFLHEKYDHSASSSYKANGTDFSIQYGSGSLEGYI 171

Query: 164 YHDRIIVNELATTDNFTFGVASEVPDI-FENYPASGIFGLPSDNSQSIENIISKLRSS-- 220
             D + + +L T     F  A+  P + F      GI GL  D + S++ ++    ++  
Sbjct: 172 SQDTLSIGDL-TIPKQDFAEATSEPGLAFAFGKFDGILGLAYD-TISVDKVVPPFYNALE 229

Query: 221 -NAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYKGEIYYNSLIPD 279
            + +   KF+  +G  N +    EDG        + IF   D+ +  Y G++ +  L   
Sbjct: 230 QDLLDEAKFAFYLGDTNKDA---EDG-------GEAIFGGVDKSK--YTGDVTW--LPVR 275

Query: 280 KNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLILPKQDALDIHTY 339
           + +YW +K+  L + D          +   +SH    + ID+GT+L+ LP   A  I++ 
Sbjct: 276 RKAYWEVKLEGLGLGD---------EYAELESHG---AAIDTGTSLITLPSGLAEIINSE 323

Query: 340 FGNSITDGTNFAIMCNSTQT---LTLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQ 396
            G        + + CN+      LT  F+  N+TI         Y       G C+S I 
Sbjct: 324 IGAKKGWTGQYTLECNTRDQLPDLTFNFNGYNFTI-------GPYDYTLEVSGSCISAIT 376

Query: 397 GLDIDDA----WILGDVFLEGIYAVFDVENQRLGFAE 429
            +D  +      I+GD FL   Y+++D+E+  +G A+
Sbjct: 377 PMDFPEPVGPLAIVGDAFLRKYYSIYDLEHNAVGLAK 413

>CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa]
           {ON} similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154c PEP4 aspartyl protease Saccharopepsin precursor
          Length = 415

 Score = 84.7 bits (208), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 89/353 (25%), Positives = 154/353 (43%), Gaps = 44/353 (12%)

Query: 98  YFVDVTIGDVA--YPLIIDTGSAYLWVYGDSCNSSSCKGRKLF---PTTNVLQDVASFSL 152
           YF D+++G     + +I+DTGS+ LWV    C S +C     +    ++  ++D    S+
Sbjct: 91  YFADISLGTPPQKFKVILDTGSSNLWVPSVDCGSLACFLHNKYDHSQSSTYIKDGRPLSI 150

Query: 153 AYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDI-FENYPASGIFGLPSDNSQSIE 211
           +Y SG   G +  D + + +L T  N  FG  +  P + F      GI GL  D + + +
Sbjct: 151 SYGSGSIEGYISEDNLQIGDL-TIQNQKFGETTSEPGLAFAFGKFDGILGLAYD-TIAQD 208

Query: 212 NIISKLRSS---NAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYK 268
           +I     S+   + +   KFS  +  +N   +E          S+ G+F +G      +K
Sbjct: 209 DITPPFYSAIQQHLLDESKFSFYLKSVNDPAAEGGS------ASDGGVFTLGGVDSSKFK 262

Query: 269 GEIYYNSLIP---DKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTL 325
           G+     LIP    + +YW + +N + + D              K  NT ++ ID+GT+L
Sbjct: 263 GD-----LIPLHVRRQAYWEVPLNAIKLGDQSTG----------KLENTGAA-IDTGTSL 306

Query: 326 LILPKQDALDIHTYFGNSITDGTNFAIMCNSTQTLTLEFDNKNWTIPSEKYLGDKYSQDS 385
           + LP   A  I+   G        + + C++   L     +  +T+    ++   +    
Sbjct: 307 ITLPSDMAEIINAQIGAKKGWTGQYTLECSTRAKLP----DLTFTLDGHDFVLSPFEYTL 362

Query: 386 AYYGYCVSNIQGLD----IDDAWILGDVFLEGIYAVFDVENQRLGFAEGNENA 434
              G C+S I  +D    I    ILGD FL   Y+VFD++   +  AE   +A
Sbjct: 363 EVSGSCISVITPMDFPEPIGRMAILGDAFLRRYYSVFDLDANVVSLAEAVHSA 415

>Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C
           (PEP4) - vacuolar proteinase A [contig 68] FULL
          Length = 412

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 88/348 (25%), Positives = 155/348 (44%), Gaps = 51/348 (14%)

Query: 98  YFVDVTIG--DVAYPLIIDTGSAYLWVYGDSCNSSSCKGRKLF---PTTNVLQDVASFSL 152
           YF ++++G    ++ +I+DTGS+ LWV  D C S +C     +    +++   +  SF++
Sbjct: 98  YFTEISLGTPPQSFKVILDTGSSNLWVPSDECGSLACFLHSKYSHDASSSYKANGTSFAI 157

Query: 153 AYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDI-FENYPASGIFGLPSDNSQSIE 211
            Y SG   G +  D + + +L T     F  A+  P + F      GI GL  D + S++
Sbjct: 158 QYGSGSLEGYISQDTLSIGDL-TIPKQDFAEATSEPGLAFAFGKFDGILGLGYD-TISVD 215

Query: 212 NIIS---KLRSSNAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYK 268
            ++    K  +   +   +F+  +   NA+ SEE  G+V            G      YK
Sbjct: 216 KVVPPVYKAINDGLLDEPRFAFYLN--NADDSEESTGEV----------TFGGIDSSKYK 263

Query: 269 GEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLIL 328
           G+I +  L   + +YW +K + + + D       Y    G+       + ID+GT+L+ L
Sbjct: 264 GDITW--LPVRRKAYWEVKFDGIGLGD------EYAELQGT------GAAIDTGTSLIAL 309

Query: 329 PKQDALDIHTYFGNSITDGTNFAIMCNSTQT---LTLEFDNKNWTIPSEKYLGDKYSQDS 385
           P   A  +++  G        + + C S      LT  F+ KN+TI +  Y  +      
Sbjct: 310 PSGLAEVLNSEIGAKKGWTGQYTVDCESRDQLPDLTFTFNGKNFTITAYDYTLE------ 363

Query: 386 AYYGYCVSNIQGLDIDDA----WILGDVFLEGIYAVFDVENQRLGFAE 429
              G C+S    +D  +      I+GD FL   Y+++D+ N  +G A+
Sbjct: 364 -VSGSCISAFTPMDFPEPVGPLAIIGDAFLRKFYSIYDLGNNAVGLAQ 410

>KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 417

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 92/355 (25%), Positives = 155/355 (43%), Gaps = 65/355 (18%)

Query: 98  YFVDVTIGDV--AYPLIIDTGSAYLWVYGDSCNSSSCKGRKLFPTTNVLQDVAS------ 149
           YF ++T+G    ++ +I+DTGS+ LWV  D C S +C     F  +    D +S      
Sbjct: 103 YFTEITLGTPPQSFKVILDTGSSNLWVPSDECGSLAC-----FLHSKYSHDASSSYKANG 157

Query: 150 --FSLAYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDI-FENYPASGIFGLPSDN 206
             F++ Y SG   G +  D + + +L T     F  A+  P + F      GI GL  D 
Sbjct: 158 TNFAIQYGSGSLEGYISQDTLSIGDL-TIPKQDFAEATSEPGLAFAFGKFDGILGLGYD- 215

Query: 207 SQSIENIIS---KLRSSNAISMEKFSILIGHINAEVSEEEDGDVQ--DLTSNKGIFAIGD 261
           + +++ ++    K  +   +   +F+  +   NA+ SEE  G+V    + S+K       
Sbjct: 216 TIAVDKVVPPVYKAINDGLLDEPRFAFYLN--NADDSEESTGEVTFGGIDSSK------- 266

Query: 262 ELEGLYKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDS 321
                YKG I +  L   + +YW +K + + + D       Y    G+       + ID+
Sbjct: 267 -----YKGNITW--LPVRRKAYWEVKFDGIGLGD------EYAELEGT------GAAIDT 307

Query: 322 GTTLLILPKQDALDIHTYFGNSITDGTNFAIMCNSTQT---LTLEFDNKNWTIPSEKYLG 378
           GT+L+ LP   A  ++   G        + + C S      LT  F+ KN+TI +  Y  
Sbjct: 308 GTSLIALPSGLAEVLNAEIGAKKGWSGQYTVDCESRDQLPDLTFTFNGKNFTISAYDYTL 367

Query: 379 DKYSQDSAYYGYCVSNIQGLDIDDA----WILGDVFLEGIYAVFDVENQRLGFAE 429
           +         G C+S    +D  +      I+GD FL   Y+V+D+ N  +G A+
Sbjct: 368 E-------VSGSCISAFTPMDFPEPVGPLAIIGDAFLRKFYSVYDLGNNAVGLAQ 415

>TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {ON}
           Anc_8.677 YPL154C
          Length = 413

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 91/349 (26%), Positives = 156/349 (44%), Gaps = 55/349 (15%)

Query: 98  YFVDVTIG--DVAYPLIIDTGSAYLWVYGDSCNSSSCKGRKLF---PTTNVLQDVASFSL 152
           YF D+ IG    ++ +++DTGS+ LWV    C S +C     +    ++    + ++F++
Sbjct: 99  YFADIKIGTPPQSFKVVLDTGSSNLWVPSKECGSLACYLHSKYNHDESSTYKANGSAFAI 158

Query: 153 AYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDI-FENYPASGIFGLPSDNSQSIE 211
            Y SG   G +  D + + +L  T    F  A+  P I F      GI GL  D + ++ 
Sbjct: 159 QYGSGSLEGYISQDVMEIGDLKITKQ-DFAEATSEPGISFAFGKFDGILGLAYD-TIAVN 216

Query: 212 NIISKLRSSNAISM-----EKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGL 266
            ++  +   NAI+       KF+  +G  +A  S++  G+         +F   DE +  
Sbjct: 217 RVVPPVY--NAINQGLLDEPKFAFYLG--DASKSKDNGGEA--------VFGGIDETK-- 262

Query: 267 YKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLL 326
           ++G+I +  L   + +YW +K+  L + +    +T  EN           + ID+GT+L+
Sbjct: 263 FEGDITW--LPVRRKAYWEVKLEGLGLGE---EYTELEN---------HGAAIDTGTSLI 308

Query: 327 ILPKQDALDIHTYFGNSITDGTNFAIMCNSTQTL---TLEFDNKNWTIPSEKYLGDKYSQ 383
            LP   A  I++  G        + I C+   +L   T  FD  N+TI         Y  
Sbjct: 309 TLPSGLAEIINSEIGAKKGWTGQYTIECDKRASLPDMTFTFDGYNFTI-------SPYDY 361

Query: 384 DSAYYGYCVSNIQGLDIDDA----WILGDVFLEGIYAVFDVENQRLGFA 428
                G C+S I  +D  +      I+GD FL   Y+V+D+ N  +G A
Sbjct: 362 TLEVSGSCISAITPMDFPEPVGPMAIIGDAFLRKYYSVYDLGNDAVGLA 410

>Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {ON}
           complement(35798..36997) [1200 nt, 400 aa]
          Length = 399

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 85/345 (24%), Positives = 148/345 (42%), Gaps = 46/345 (13%)

Query: 98  YFVDVTIGDVA--YPLIIDTGSAYLWVYGDSCNSSSCKGRKLFP---TTNVLQDVASFSL 152
           Y+ DV+IG     + +I+DTGS+ LWV    C+S +C     +    ++    + + F +
Sbjct: 86  YYTDVSIGTPPQKFKVILDTGSSNLWVPSVGCSSLACYLHSKYDHSLSSTYRSNGSDFVI 145

Query: 153 AYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDI-FENYPASGIFGLPSDNSQSIE 211
            Y SG   G +  D + + +L       F  A+  P + F      GI GL  D S S+ 
Sbjct: 146 QYGSGSLKGYISQDTLTIGDLIIPQQ-DFAEATAEPGLAFAFGKFDGILGLAYD-SISVN 203

Query: 212 NIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYKGEI 271
             +  L ++    +    +   ++  E S +  G+             G      ++GEI
Sbjct: 204 KAVPPLYNAIHRGLLDKPMFAFYLGDEKSSKNGGEA----------TFGGYDPSRFEGEI 253

Query: 272 YYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLILPKQ 331
            +  L   + +YW ++ + + + D          F   + H    + ID+GT+L+ LP Q
Sbjct: 254 KW--LPVRRKAYWEVQFDGIKLGD---------KFMKLEGHG---AAIDTGTSLITLPSQ 299

Query: 332 DALDIHTYFGNSITDGTNFAIMCNSTQTL---TLEFDNKNWTIPSEKYLGDKYSQDSAYY 388
            A  ++   G   +    + I C   ++L   TL F N N+TI       D +       
Sbjct: 300 IADFLNNEIGAKKSWNGQYTIDCKKRESLPKLTLNFYNHNFTI-------DPFDYTLEIS 352

Query: 389 GYCVSNIQGLD----IDDAWILGDVFLEGIYAVFDVENQRLGFAE 429
           G C+S I  +D    +    I+GD FL   Y+++D+EN  +G A+
Sbjct: 353 GSCISAITPMDFPQPVGPLSIIGDAFLRRFYSIYDLENNAVGLAK 397

>Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON}
           (10059..11267) [1209 nt, 403 aa]
          Length = 402

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 92/362 (25%), Positives = 158/362 (43%), Gaps = 56/362 (15%)

Query: 85  GISILQSDEHSQAYFVDVTIGDVA--YPLIIDTGSAYLWVYGDSCNSSSCKGRKLF---P 139
           G +I  S+  +  Y+ D+T+G  A  + +I+DTGS+ LWV    CNS +C     +    
Sbjct: 76  GHNIPLSNYLNAQYYTDITLGTPAQSFKVILDTGSSNLWVPSVDCNSLACYLHAKYDHSD 135

Query: 140 TTNVLQDVASFSLAYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDI-FENYPASG 198
           ++   ++  +FS+ Y SG   G +  D + + +L       F  A+  P + F      G
Sbjct: 136 SSTYKKNGTTFSIQYGSGSMEGYISQDVLQIGDLVIPGQ-DFAEATSEPGLAFAFGKFDG 194

Query: 199 IFGLPSDNSQSIENIISKLRSSNAISMEK-----FSILIGHINAEVSEEEDGDVQDLTSN 253
           I GL  D + ++  ++      NAI+ +      FS  +G    + ++ EDG        
Sbjct: 195 ILGLAYD-TIAVNRVVPPFY--NAINKKLVDEPIFSFYLG----DDTKSEDG-------- 239

Query: 254 KGIFAIGDELEGLYKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHN 313
            G    G     L+ G+I +  L   + +YW +K + + + +   +  N+          
Sbjct: 240 -GQVTFGGYDSSLFTGDITW--LPVRRKAYWEVKFDAIALGNEVADLVNH---------- 286

Query: 314 TRSSIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIMCNSTQTL---TLEFDNKNWT 370
              + ID+GT+L+ LP   A  I++  G   +    + + C +  TL   T  FD  N+T
Sbjct: 287 --GAAIDTGTSLITLPSGLAEVINSQIGAKKSWSGQWIVDCKTRDTLPDMTFTFDGYNFT 344

Query: 371 IPSEKYLGDKYSQDSAYYGYCVSNIQGLD----IDDAWILGDVFLEGIYAVFDVENQRLG 426
           I         Y       G C+S I  +D    +    I+GD FL   Y+++DV N  +G
Sbjct: 345 I-------TPYDYTLEVSGSCISAITPMDFPAPVGPLAIVGDAFLRRYYSIYDVGNNAVG 397

Query: 427 FA 428
            A
Sbjct: 398 LA 399

>ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 408

 Score = 78.6 bits (192), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 84/344 (24%), Positives = 136/344 (39%), Gaps = 44/344 (12%)

Query: 98  YFVDVTIGDVA--YPLIIDTGSAYLWVYGDSCNSSSCKGRKLF---PTTNVLQDVASFSL 152
           Y  DVTIG     + +++DTGS+ LWV G  C + +C+  K +    ++   ++     +
Sbjct: 93  YAADVTIGTPPQDFRVVVDTGSSTLWVPGKECRAMACRLHKRYDHDRSSTYKENGTLTGV 152

Query: 153 AYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDIFENYPASGIFGLPSDN-SQSIE 211
            Y SG  +G V  D   +++L            E   +F      GI GL   +    + 
Sbjct: 153 TYGSGSIMGYVSEDTFRISDLEIPGQQFTETTDEPGSVFVFAAFDGILGLAYPSLGYGVT 212

Query: 212 NIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYKGEI 271
               +L     +    F + +             D        G   +G   E  +KGEI
Sbjct: 213 PPFQQLMEKKLVKEPVFGMYL-------------DDMKTGEGNGQLVLGGYDETKFKGEI 259

Query: 272 YYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLILPKQ 331
            +  L   + +YW +  +++ V D  +   NY             + IDSGT+L+  P +
Sbjct: 260 AW--LPVRRQAYWEVVFDSVTVGDDNIPLENY------------GAAIDSGTSLITFPSE 305

Query: 332 DALDIHTYFGNSITDGT-NFAIMCNSTQT---LTLEFDNKNWTIPSEKYLGDKYSQDSAY 387
                 +       D   N  + C + QT   LT  F    ++I  E Y+     Q +  
Sbjct: 306 LFNQFISKLSGVTKDRQGNVYVDCANKQTAPPLTFGFGGHKFSISGEDYIISVPGQSAR- 364

Query: 388 YGYCVSNIQGLDIDDAW---ILGDVFLEGIYAVFDVENQRLGFA 428
              C+  I  LDID A    I+GDVFL   Y+++D  N  +G A
Sbjct: 365 ---CMPAIVQLDIDSAGKVAIIGDVFLRRYYSIYDFGNNAVGLA 405

>TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON}
           Anc_8.677 YPL154C
          Length = 408

 Score = 78.2 bits (191), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 88/351 (25%), Positives = 149/351 (42%), Gaps = 54/351 (15%)

Query: 98  YFVDVTIGDVA--YPLIIDTGSAYLWVYGDSCNSSSCKGRKLF---PTTNVLQDVASFSL 152
           Y+ D+++G  A  + +I+DTGS+ LWV    C S +C     +    +++   +   F++
Sbjct: 91  YYTDISLGTPAQNFKVILDTGSSNLWVPSVDCGSLACFLHSKYDHSASSSYKPNGTDFAI 150

Query: 153 AYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDI-FENYPASGIFGLPSDNSQSIE 211
            Y SG   G +  D + V +L       F  A+  P + F      GI GL + N+ S++
Sbjct: 151 QYGSGSLEGYISQDTLSVGDLVIPKQ-DFAEATSEPGLAFAFGKFDGILGL-AYNTISVD 208

Query: 212 NIISKLRSSNAISME-----KFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGL 266
            ++      NAI  +     +F+  +G  +        G         G+   G   +  
Sbjct: 209 KVVPPFY--NAIDQDLLDEPRFAFYLGDSSDSEDSSVSG---------GVATFGGIDKSK 257

Query: 267 YKGEIYYNSLIP-DKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTL 325
           +KGEI   S +P  + +YW +K   + + D          F     H    + ID+GT+L
Sbjct: 258 FKGEI---SWLPVRRKAYWEVKFEGIGLGD---------EFAILDGHG---AAIDTGTSL 302

Query: 326 LILPKQDALDIHTYFGNSITDGTNFAIMCNSTQT---LTLEFDNKNWTIPSEKYLGDKYS 382
           + LP   A  I++  G        + + C +  +   LT  F  KN+TI         Y 
Sbjct: 303 ITLPSGLAEIINSEIGAKKGWSGQYTVDCETRSSLPDLTFNFSGKNYTI-------GPYD 355

Query: 383 QDSAYYGYCVSNIQGLDIDDA----WILGDVFLEGIYAVFDVENQRLGFAE 429
                 G C+S I  +D  +      I+GD FL   Y+V+D+ N  +G A+
Sbjct: 356 YTLEVSGSCISAITPMDFPEPVGPLAIVGDTFLRRFYSVYDLGNNAVGLAK 406

>TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.677
           YPL154C
          Length = 419

 Score = 78.6 bits (192), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 82/350 (23%), Positives = 147/350 (42%), Gaps = 54/350 (15%)

Query: 98  YFVDVTIGDVA--YPLIIDTGSAYLWVYGDSCNSSSCKGRKLF---PTTNVLQDVASFSL 152
           Y+ D+++G     + +I+DTGS+ LWV    C S +C     +    +T   ++   F++
Sbjct: 104 YYTDISLGTPKQNFKVILDTGSSNLWVPSKDCTSLACYLHSKYDHDESTTYEKNGTKFTI 163

Query: 153 AYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDI-FENYPASGIFGLPSDNSQSIE 211
            Y SG   G +  D +I+ +        F  A+  P + F      GI GL  D + ++ 
Sbjct: 164 QYGSGSMDGYISRDTLIIGDDLVIPEQDFAEATSEPGLAFAFGKFDGILGLAYD-TIAVN 222

Query: 212 NIISKLRSSNAISM-----EKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGL 266
            ++      NAI        KF+  +G  N +              + G    G   +  
Sbjct: 223 KVVPPFY--NAIKQGILDENKFAFYLGDTNKD------------NKSGGEATFGGYDKSK 268

Query: 267 YKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLL 326
           + G+I +  L   + +YW +K +++ + D   +   Y             + ID+GT+L+
Sbjct: 269 FTGDITW--LPVRRKAYWEVKFDSIALGDEVASLDGY------------GAAIDTGTSLI 314

Query: 327 ILPKQDALDIHTYFGNSITDGTNFAIMCNSTQTL---TLEFDNKNWTIPSEKYLGDKYSQ 383
            LP   A  I+T  G   +    + I C++   L   T  F+  N+T+         Y  
Sbjct: 315 TLPSGLAEVINTQIGAKKSWSGQYTIDCDTRDALPDMTFNFNGYNFTV-------SPYDY 367

Query: 384 DSAYYGYCVSNIQGLDIDDA----WILGDVFLEGIYAVFDVENQRLGFAE 429
                G C+S I  +D  +      I+GD FL   Y+++D++N  +G A+
Sbjct: 368 TLEMSGSCISAITPMDFPEPVGPLAIIGDAFLRKYYSIYDLDNNAVGLAK 417

>Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C
           (REAL)
          Length = 405

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 83/348 (23%), Positives = 150/348 (43%), Gaps = 51/348 (14%)

Query: 98  YFVDVTIGDVA--YPLIIDTGSAYLWVYGDSCNSSSCKGRKLF---PTTNVLQDVASFSL 152
           Y+ D+T+G     + +I+DTGS+ LWV  + C S +C     +    +++   +   F++
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI 150

Query: 153 AYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDI-FENYPASGIFGLPSDNSQSIE 211
            Y +G   G +  D + + +L T     F  A+  P + F      GI GL  D + S++
Sbjct: 151 QYGTGSLEGYISQDTLSIGDL-TIPKQDFAEATSEPGLTFAFGKFDGILGLGYD-TISVD 208

Query: 212 NIISKLRSS---NAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYK 268
            ++    ++   + +  +KF+  +            GD    + N G    G   E  +K
Sbjct: 209 KVVPPFYNAIQQDLLDEKKFAFYL------------GDTSKDSENGGEATFGGIDESKFK 256

Query: 269 GEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLIL 328
           G+I +  L   + +YW +K   + + D          +   +SH    + ID+GT+L+ L
Sbjct: 257 GDITW--LPVRRKAYWEVKFEGIGLGD---------EYAELESHG---AAIDTGTSLITL 302

Query: 329 PKQDALDIHTYFGNSITDGTNFAIMCNSTQTLT---LEFDNKNWTIPSEKYLGDKYSQDS 385
           P   A  I+   G        + + CN+  +L      F+  N+TI         Y    
Sbjct: 303 PSGLAEMINAELGAKKGWTGQYTLDCNTRDSLPDLIFNFNGYNYTI-------GPYDYTL 355

Query: 386 AYYGYCVSNIQGLDIDDA----WILGDVFLEGIYAVFDVENQRLGFAE 429
              G C+S I  +D  +      I+GD FL   Y+++D+ N  +G A+
Sbjct: 356 EVSGSCISAITPMDFPEPVGPLAIIGDAFLRKYYSIYDLGNNAVGLAK 403

>Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {ON}
           YPL154C (REAL)
          Length = 405

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 83/348 (23%), Positives = 148/348 (42%), Gaps = 51/348 (14%)

Query: 98  YFVDVTIGDVA--YPLIIDTGSAYLWVYGDSCNSSSCKGRKLF---PTTNVLQDVASFSL 152
           Y+ D+T+G     + +I+DTGS+ LWV  + C S +C     +    +++   +   F++
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI 150

Query: 153 AYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDI-FENYPASGIFGLPSDNSQSIE 211
            Y +G   G +  D + + +L T     F  A+  P + F      GI GL  D + S++
Sbjct: 151 QYGTGSLEGYISQDTLSIGDL-TIPKQDFAEATSEPGLTFAFGKFDGILGLGYD-TISVD 208

Query: 212 NIISKLRSS---NAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYK 268
            ++    ++   + +  +KF+  +            GD    + N G    G   E  +K
Sbjct: 209 KVVPPFYNAIQQDLLDEKKFAFYL------------GDTSKDSENGGEATFGGIDESKFK 256

Query: 269 GEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLIL 328
           G+I +  L   + +YW +K   + + D       Y    G        + ID+GT+L+ L
Sbjct: 257 GDITW--LPVRRKAYWEVKFEGIGLGD------EYAELEG------HGAAIDTGTSLITL 302

Query: 329 PKQDALDIHTYFGNSITDGTNFAIMCNSTQTLT---LEFDNKNWTIPSEKYLGDKYSQDS 385
           P   A  I+   G        + + CN+  +L      F+  N+TI         Y    
Sbjct: 303 PSGLAEMINAELGAKKGWTGQYTLDCNTRDSLPDLIFNFNGYNFTI-------GPYDYTL 355

Query: 386 AYYGYCVSNIQGLDIDDA----WILGDVFLEGIYAVFDVENQRLGFAE 429
              G C+S I  +D  +      I+GD FL   Y+++D+ N  +G A+
Sbjct: 356 EVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNDAVGLAK 403

>YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON}
           PEP4Vacuolar aspartyl protease (proteinase A), required
           for the posttranslational precursor maturation of
           vacuolar proteinases; important for protein turnover
           after oxidative damage; synthesized as a zymogen,
           self-activates
          Length = 405

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 83/348 (23%), Positives = 149/348 (42%), Gaps = 51/348 (14%)

Query: 98  YFVDVTIGDVA--YPLIIDTGSAYLWVYGDSCNSSSCKGRKLF---PTTNVLQDVASFSL 152
           Y+ D+T+G     + +I+DTGS+ LWV  + C S +C     +    +++   +   F++
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAI 150

Query: 153 AYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDI-FENYPASGIFGLPSDNSQSIE 211
            Y +G   G +  D + + +L T     F  A+  P + F      GI GL  D + S++
Sbjct: 151 QYGTGSLEGYISQDTLSIGDL-TIPKQDFAEATSEPGLTFAFGKFDGILGLGYD-TISVD 208

Query: 212 NIISKLRSS---NAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYK 268
            ++    ++   + +  ++F+  +            GD    T N G    G   E  +K
Sbjct: 209 KVVPPFYNAIQQDLLDEKRFAFYL------------GDTSKDTENGGEATFGGIDESKFK 256

Query: 269 GEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLIL 328
           G+I +  L   + +YW +K   + + D          +   +SH    + ID+GT+L+ L
Sbjct: 257 GDITW--LPVRRKAYWEVKFEGIGLGD---------EYAELESH---GAAIDTGTSLITL 302

Query: 329 PKQDALDIHTYFGNSITDGTNFAIMCNSTQTLT---LEFDNKNWTIPSEKYLGDKYSQDS 385
           P   A  I+   G        + + CN+   L      F+  N+TI         Y    
Sbjct: 303 PSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTI-------GPYDYTL 355

Query: 386 AYYGYCVSNIQGLDIDDA----WILGDVFLEGIYAVFDVENQRLGFAE 429
              G C+S I  +D  +      I+GD FL   Y+++D+ N  +G A+
Sbjct: 356 EVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVGLAK 403

>Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {ON}
           YPL154C (REAL)
          Length = 406

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 82/348 (23%), Positives = 149/348 (42%), Gaps = 51/348 (14%)

Query: 98  YFVDVTIGDVA--YPLIIDTGSAYLWVYGDSCNSSSCKGRKLF---PTTNVLQDVASFSL 152
           Y+ D+++G+    + +I+DTGS+ LWV    C S +C     +    +++   +   F++
Sbjct: 92  YYTDISLGNPPQNFKVILDTGSSNLWVPSTECGSLACFLHSKYDHEASSSYKPNGTEFAI 151

Query: 153 AYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDI-FENYPASGIFGLPSDNSQSIE 211
            Y +G   G +  D + + +L T     F  A+  P + F      GI GL  D + S++
Sbjct: 152 QYGTGSLEGYISQDTLSIGDL-TIPKQDFAEATSEPGLTFAFGKFDGILGLGYD-TISVD 209

Query: 212 NIISKLRSS---NAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYK 268
            ++    ++   + +  +KF+  +            GD    + N G    G   +  +K
Sbjct: 210 KVVPPFYNAIQQDLLDEKKFAFYL------------GDTSKDSENGGEATFGGIDKSKFK 257

Query: 269 GEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLIL 328
           G++ +  L   + +YW +K   + +            F   + H    + ID+GT+L+ L
Sbjct: 258 GDVTW--LPVRRKAYWEVKFEGIGLG---------HEFAELEGHG---AAIDTGTSLITL 303

Query: 329 PKQDALDIHTYFGNSITDGTNFAIMCNSTQT---LTLEFDNKNWTIPSEKYLGDKYSQDS 385
           P   A  I+   G        +A+ CN+      LT  F+  N+TI         Y    
Sbjct: 304 PSGLAEMINAEIGAKKGWSGQYALDCNTRDGLPDLTFNFNGYNFTI-------GPYDYTL 356

Query: 386 AYYGYCVSNIQGLDIDDA----WILGDVFLEGIYAVFDVENQRLGFAE 429
              G C+S I  +D  +      I+GD FL   Y+++D+ N  +G AE
Sbjct: 357 EVSGSCISAITPMDFPEPVGPLAIIGDAFLRKYYSIYDLGNDAVGLAE 404

>ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 418

 Score = 75.5 bits (184), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 80/345 (23%), Positives = 150/345 (43%), Gaps = 46/345 (13%)

Query: 98  YFVDVTIGDVA--YPLIIDTGSAYLWVYGDSCNSSSCKGRKLF---PTTNVLQDVASFSL 152
           Y+ +V++G     + +I+DTGS+ LWV    C+S +C     +    +++   +   F++
Sbjct: 105 YYTEVSLGTPPQNFKVILDTGSSNLWVPSTECSSLACFLHSKYDHDSSSSYKPNGTEFAI 164

Query: 153 AYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDI-FENYPASGIFGLPSDNSQSIE 211
            Y SG   G +  D + + +L+ T    F  A+  P + F      GI GL  D + S++
Sbjct: 165 RYGSGSLEGYISQDTLNLGDLSITKQ-DFAEATSEPGLQFAFGKFDGILGLGYD-TISVD 222

Query: 212 NIISKLRSS---NAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYK 268
            ++    ++     +   KF+  +G          DG+ QD     G+   G   +  Y+
Sbjct: 223 GVVPPFYNAWKQGLLDEPKFAFYLGR---------DGESQD----GGVATFGGVDDSKYE 269

Query: 269 GEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLIL 328
           GEI +  L   + +YW +K + + + +      N+             + ID+GT+L+ L
Sbjct: 270 GEITW--LPIRRKAYWEVKFDGIGLGEEYAELENH------------GAAIDTGTSLIAL 315

Query: 329 PKQDALDIHTYFGNSITDGTNFAIMCNSTQTLTLEFDNKNWTIPSEKYLGDKYSQDSAYY 388
           P   A  I+   G   +    + + C +  +L     N  +T+    +    Y       
Sbjct: 316 PSGLAEIINAEIGAKKSWTGQYTVECEARSSLP----NMTFTLGGHNFELTAYDYILEVS 371

Query: 389 GYCVSNIQGLDIDDA----WILGDVFLEGIYAVFDVENQRLGFAE 429
           G C+S I  +D  +      I+GD FL   Y+++D+ N  +G A+
Sbjct: 372 GQCISAIFPMDFPEPVGPLAIIGDSFLRKYYSIYDLGNNAVGLAD 416

>KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 409

 Score = 75.5 bits (184), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 89/350 (25%), Positives = 151/350 (43%), Gaps = 56/350 (16%)

Query: 98  YFVDVTIGDV--AYPLIIDTGSAYLWVYGDSCNSSSCKGRKLF---PTTNVLQDVASFSL 152
           YF ++T+G    ++ +I+DTGS+ LWV    C S +C     +    ++    + + F++
Sbjct: 96  YFTEITLGSPPQSFKVILDTGSSNLWVPSAECGSLACFLHTKYDHEASSTYKANGSEFAI 155

Query: 153 AYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDI-FENYPASGIFGLPSDNSQSIE 211
            Y SG   G V  D + + +L   D   F  A+  P + F      GI GL  D S S+ 
Sbjct: 156 QYGSGSLEGYVSRDLLTIGDLVIPDQ-DFAEATSEPGLAFAFGKFDGILGLAYD-SISVN 213

Query: 212 NIISKLRSSNAISME-----KFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGL 266
            I+  +   NAI  +      F+  +G    +  + EDG         G  + G   E  
Sbjct: 214 RIVPPVY--NAIKNKLLDDPVFAFYLG----DSDKSEDG---------GEASFGGIDEEK 258

Query: 267 YKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLL 326
           Y GEI +  L   + +YW +K   + + +       Y    G        + ID+GT+L+
Sbjct: 259 YTGEITW--LPVRRKAYWEVKFEGIGLGE------EYATLEG------HGAAIDTGTSLI 304

Query: 327 ILPKQDALDIHTYFGNSITDGTNFAIMCNSTQT---LTLEFDNKNWTIPSEKYLGDKYSQ 383
            LP   A  ++   G        +++ C S  +   LTL F+  N+TI +  Y  +    
Sbjct: 305 ALPSGLAEILNAEIGAKKGWSGQYSVDCESRDSLPDLTLNFNGYNFTITAYDYTLE---- 360

Query: 384 DSAYYGYCVSNIQGLDIDDA----WILGDVFLEGIYAVFDVENQRLGFAE 429
                G C+S    +D  +      I+GD FL   Y+++D+ +  +G A+
Sbjct: 361 ---VSGSCISAFTPMDFPEPVGPLAIIGDAFLRKYYSIYDIGHDAVGLAK 407

>SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {ON}
           highly similar to uniprot|P07267 Saccharomyces
           cerevisiae YPL154C PEP4 Vacuolar aspartyl protease
           (proteinase A) required for the posttranslational
           precursor maturation of vacuolar proteinases synthesized
           as a zymogen self-activates
          Length = 404

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 83/348 (23%), Positives = 150/348 (43%), Gaps = 52/348 (14%)

Query: 98  YFVDVTIGDVA--YPLIIDTGSAYLWVYGDSCNSSSCKGRKLF---PTTNVLQDVASFSL 152
           Y+ ++++G     + +I+DTGS+ LWV    C S +C     +    +++   + +SF++
Sbjct: 91  YYTEISLGTPPQNFKVILDTGSSNLWVPSAECGSLACFLHAKYDHDSSSSYKANGSSFAI 150

Query: 153 AYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDI-FENYPASGIFGLPSDNSQSIE 211
            Y SG   G +  D + + +L T     F  A+  P + F      GI GL  D S S++
Sbjct: 151 QYGSGSLEGYISQDTLSIGDL-TIPKQDFAEATSEPGLAFAFGKFDGILGLAYD-SISVD 208

Query: 212 NIISKLRSS---NAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYK 268
            ++  + ++     +   KFS  +G+              D +++ G    G      Y+
Sbjct: 209 KVVPPVYNAIHNGLLDEPKFSFYLGN-------------ADKSTDGGEATFGGIDSSKYE 255

Query: 269 GEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLIL 328
           G I +  L   + +YW +K + + + D       Y    G        + ID+GT+L+ L
Sbjct: 256 GNITW--LPVRRKAYWEVKFDGIGLGD------EYAILDG------HGAAIDTGTSLIAL 301

Query: 329 PKQDALDIHTYFGNSITDGTNFAIMCNSTQT---LTLEFDNKNWTIPSEKYLGDKYSQDS 385
           P   A  ++   G        +++ C++  +   LTL F   N+TI         Y    
Sbjct: 302 PSGLAEILNAEIGAKKGWSGQYSVECDTRDSLPDLTLNFGGYNFTI-------TPYDYTL 354

Query: 386 AYYGYCVSNIQGLDIDDA----WILGDVFLEGIYAVFDVENQRLGFAE 429
              G C+S    +D  +      I+GD FL   Y+V+D+ N  +G A+
Sbjct: 355 EVSGSCISAFTPMDFPEPVGPLAIIGDAFLRKHYSVYDLGNDAVGLAK 402

>Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii ACR144W ACR143W
          Length = 415

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 81/344 (23%), Positives = 153/344 (44%), Gaps = 43/344 (12%)

Query: 98  YFVDVTIG--DVAYPLIIDTGSAYLWVYGDSCNSSSCKGRKLF---PTTNVLQDVASFSL 152
           Y+ ++ +G    ++ +++DTGS+ LWV   +C S +C     F    +++  ++ + FS+
Sbjct: 101 YYSEIGLGTPPQSFKVVMDTGSSNLWVPNKNCVSEACLNHARFDHDRSSSYAKNDSRFSV 160

Query: 153 AYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVP-DIFENYPASGIFGLPSDNSQSIE 211
           +Y  G   G V +D + + +L T  N  F  A+  P   F      GI GL  D   ++ 
Sbjct: 161 SYGKGSMEGFVSYDTLKIGDL-TIKNQGFAEATVEPGSAFVYGQFDGILGLAYDG-LAVN 218

Query: 212 NIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYKGEI 271
           +I+     +    +    +   ++    S+E+ GD     S  G    G   E  + GEI
Sbjct: 219 HIVPPFYEAVHQGLLDEPVFAFYL----SDEKKGD-----SLAGEVVFGGYDETKFTGEI 269

Query: 272 YYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLILPKQ 331
            +  +I  + +YW +++N++ +   K    NY               +D+GT+ +  P +
Sbjct: 270 SWLPVI--RKAYWEVELNSITLGSQKFQLQNY------------GGALDTGTSFITFPSE 315

Query: 332 DALDIHTYFGNSI-TDGTNFAIMCNST--QTLTLEFDNKNWTIPSEKYLGDKYSQDSAYY 388
              +  +  G ++  D  +    C+ +    LT E   +++TI S  Y+      D+   
Sbjct: 316 LYQEFVSKTGATVDPDDGHIIAPCSGSGFPDLTFELAGRSFTISSSDYV--VQWDDTT-- 371

Query: 389 GYCVSNIQGLDIDDAW---ILGDVFLEGIYAVFDVENQRLGFAE 429
             C   I  LD+  A    I+GDVFL   Y+++D+    +G A+
Sbjct: 372 --CAVAITPLDLGGAGKMVIIGDVFLRRWYSIYDLSKNAVGLAK 413

>ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 393

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 81/343 (23%), Positives = 147/343 (42%), Gaps = 47/343 (13%)

Query: 98  YFVDVTIGDVA--YPLIIDTGSAYLWVYGDSCNSSSCKGRKLF---PTTNVLQDVASFSL 152
           Y VD+T+G  A  + + +DTGS+ LW+  D C S  C+ R  +    ++       +  L
Sbjct: 83  YSVDITLGTPAQNFRVALDTGSSLLWIPSDRCTSQICRTRNRYRSGASSTFKATDKTLRL 142

Query: 153 AYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDIFENYPASGIFGL--PSDNSQSI 210
            Y  G A   V +D +     A  +N  FG A  + D F      GI G+  PS     I
Sbjct: 143 QYVKGDAKARVSYDTLYFAG-AKIENQGFGEAEAIGDDFSGARFDGIIGIGYPS-IGYGI 200

Query: 211 ENIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYKGE 270
           +  I+ L  S  +    F I I +             Q+  S  G   +G      +KG+
Sbjct: 201 KPPINTLIDSGGLKDPMFGIYISN------------AQNRNSPVGEIVLGGYNTQKFKGD 248

Query: 271 IYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLILPK 330
           I +  ++  + ++W   ++   V ++ ++                +++ D+G++ +I+P+
Sbjct: 249 IKWLPVL--RKAFWETDLSAFKVGNFALDVQGL------------TAVFDTGSSFIIMPE 294

Query: 331 QDALDIHTYF-GNSITDGTNFAIMC---NSTQTLTLEFDNKNWTIPSEKYLGDKYSQDSA 386
               D  + F G S  DGT++ + C   NS   LTL+F      + +  Y+  +  +++ 
Sbjct: 295 DTYTDFVSQFPGASHDDGTDY-VDCSTVNSGPDLTLDFGGVALKLSARDYV-MQLGRNT- 351

Query: 387 YYGYCVSNIQG-LDIDDAWILGDVFLEGIYAVFDVENQRLGFA 428
               C+  + G   +    ILGD FL   Y +++  +  +G A
Sbjct: 352 ----CILAVSGNSRVTGEVILGDTFLRRYYTIYNFGDNTIGVA 390

>KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {ON}
           Anc_8.677 YPL154C
          Length = 416

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 87/350 (24%), Positives = 144/350 (41%), Gaps = 50/350 (14%)

Query: 98  YFVDVTIGDVA--YPLIIDTGSAYLWVYGDSCNSSSCKGRKLFP---TTNVLQDVASFSL 152
           YF D++IG     + +I+DTGS+ LWV    CNS +C     +    ++  +++   F++
Sbjct: 99  YFADISIGSPGQTFRVIMDTGSSNLWVPSVDCNSLACFLHNKYDHRVSSTYVRNGTRFAI 158

Query: 153 AYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDI-FENYPASGIFGLPSDNSQSIE 211
            Y SG   G + +D + V +L       F  A+  P + F      GIFGL  D + S+ 
Sbjct: 159 RYGSGALEGYMSNDTVTVGDLQIPKQ-DFAEATSEPGLAFAFGKFDGIFGLAFD-TISVN 216

Query: 212 NIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYKGEI 271
             +      NA++        G ++A       GD + L    G    G   E  + G I
Sbjct: 217 RAVPPFY--NAVNR-------GLLDAPQFAFYLGD-KRLRKEGGEVTFGGYDETRFTGNI 266

Query: 272 YYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLILPKQ 331
            +  L   + +YW +  N +         + Y   T +       + ID+GT+L+ LP  
Sbjct: 267 TW--LPVRREAYWEVDFNGISFG------SQYAPLTAT------GAAIDTGTSLITLPSG 312

Query: 332 DALDIHTYFGNSITDGTNFAIMCNSTQTL---TLEFDNKNWTIPSEKYLGDKYSQDSAYY 388
            A  ++   G        + + C+   TL   T      N++I    Y  +         
Sbjct: 313 LAEILNAQIGARKNWSGQYVLDCSRRSTLPDITFNLGGSNFSIGPYDYTLEA-------S 365

Query: 389 GYCVSNIQGLDIDDA----WILGDVFLEGIYAVFDV----ENQRLGFAEG 430
           G C+S I  +D  +      I+GD FL   Y+V+D+     N  +G AE 
Sbjct: 366 GTCISAIVPMDFPEPVGPLAIIGDAFLRRWYSVYDLGNSTTNSTVGLAEA 415

>TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8.318
           YLR120C
          Length = 1000

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 95/395 (24%), Positives = 161/395 (40%), Gaps = 83/395 (21%)

Query: 72  SSNETFAKIQVKPGISILQSDEHSQAYFVDVTIGDVAYPL--IIDTGSAYLWVYGD---S 126
           S++ET  K+  + G  I+ ++ ++  Y  ++ +G  A  +  I+DTGS+ LWV G    +
Sbjct: 50  STSET--KLVKRDGEDIVLTNRNT-FYSAEIEVGTPAQTMNVIVDTGSSDLWVIGHDNLT 106

Query: 127 C-----NSSSCKGRKLF---PTTNVLQDVASFSLAYTSGV-AVGDVYHDRIIVNELATTD 177
           C      S +C+    F    ++   ++   F++ Y SG   +G    D +I+  +  T 
Sbjct: 107 CPLASDGSFNCERFGSFSISKSSTFTKNSTEFAITYVSGNNCIGVWGQDNLIIGGVNAT- 165

Query: 178 NFTFGVASEVPDIFENYPASGIFG--LPSDNSQSI--------ENIISKLRSSNAISMEK 227
             +FGV      +     ++GI G  LP   + ++        +N    L++   IS + 
Sbjct: 166 GLSFGV------VHTTTSSAGILGIGLPDTETTAVGQYGHYKYDNFPMVLKNKGIISHQG 219

Query: 228 FSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYKGEIYYNSLIPDKNSYWSLK 287
           +SI +                  +S  G F +G      Y G +Y   L+   N+Y+S  
Sbjct: 220 YSIYL---------------DSSSSTYGEFLLGGVDTSKYTGTLYKLPLVNWYNTYFSSP 264

Query: 288 INNLYVNDYKVNFTNYENFTGSKSHNTRSS-----IIDSGTTLLILPKQDALDIHTYFGN 342
                  D+ V        T S S  T +      I+D+G+T+  +P      + +  G 
Sbjct: 265 ------GDFHVTLQGLGLITNSGSAVTLTETKMAVILDTGSTVTGIPATLYNALLSSLGG 318

Query: 343 --SITDGTNFAIMCNSTQTLTLEFDNKNWTIPSEKY---LGDKYSQDSAYYGYCVSNIQG 397
             S T G         T  L   F   N+ +P   +   LGD              N+  
Sbjct: 319 YYSSTHGAYVFTCPTETSKLVFNFGGINYKLPMSSFINTLGD--------------NVCS 364

Query: 398 LDI----DDAWILGDVFLEGIYAVFDVENQRLGFA 428
           L +    D  +ILGD FL  +YA FD+EN+ +G A
Sbjct: 365 LKVSSRSDSNFILGDDFLRNVYAAFDLENKEIGLA 399

>NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {ON}
           Anc_7.182
          Length = 547

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 74/306 (24%), Positives = 127/306 (41%), Gaps = 41/306 (13%)

Query: 146 DVASFSLAYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDIFENYPASGIFGLPSD 205
           D + F L YT G      + D I   E    DN+           +   P  G+ G+   
Sbjct: 136 DNSRFYLQYTDGS-----FEDGIWSKETVQIDNYNITSLQLAVANYATTPVGGLLGISFP 190

Query: 206 NSQSIE-----------NIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDVQDLTSNK 254
             +S++           N    L++ N I +  +S+ +  +N      +DG +     + 
Sbjct: 191 RRESVKGYDGALNEYYPNFPQVLKNENIIDIVLYSMYLNDLN------QDGSLLFGAIDT 244

Query: 255 GIFAIGDELEGLYKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNT 314
             F  GD +   Y     Y +++ DK +  +L I  +   +   + T  E F  SK    
Sbjct: 245 SKFE-GDMIT--YPMVNVYPNVV-DKPATLALTIQGVAAQNTN-DCTQNETFMTSK---- 295

Query: 315 RSSIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM-CNSTQTLT-----LEFDNKN 368
              ++DSGTTL+  PK+ A  +  +   + ++     I+ C S + L       +F    
Sbjct: 296 FPVLLDSGTTLMSAPKELADKMADFVNATYSEDDRIYILNCPSQEVLNDIEYIFDFGGLQ 355

Query: 369 WTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFA 428
             IP EK++    S D +  G C   +      D  +LGD+FL  +YAVFD+++ ++  A
Sbjct: 356 VKIPLEKFILP--SDDGS--GPCAFGVLPETTTDRMVLGDIFLSFVYAVFDLDHYQISLA 411

Query: 429 EGNENA 434
             N+NA
Sbjct: 412 NINKNA 417

>YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON}
           YPS3Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 508

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 92/362 (25%), Positives = 143/362 (39%), Gaps = 38/362 (10%)

Query: 98  YFVDVTIGDVAYPL--IIDTGSAYLWVYGDS---CNS-SSCKGRKLFPTTNV----LQDV 147
           Y V++ IG  +  L  ++DTGSA LWV G     C S   C    +F  T          
Sbjct: 63  YSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYCGSVMDCDQYGVFDKTKSSTFKANKS 122

Query: 148 ASFSLAYTSGV-AVGDVYHDRIIVNELATTDNFTFGVASEVPDIFENYPASGIFGLPSDN 206
           + F  AY  G  A G    D++  NEL  +   +F VA+E    F      G+ G+    
Sbjct: 123 SPFYAAYGDGTYAEGAFGQDKLKYNELDLS-GLSFAVANESNSTF------GVLGIGLST 175

Query: 207 SQSIENIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGL 266
            +   +    +    +   + F + + H  A  +      + D + + G    G      
Sbjct: 176 LEVTYSGKVAIMDKRSYEYDNFPLFLKHSGAIDATAYSLFLNDESQSSGSILFGAVDHSK 235

Query: 267 YKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNF----TNYENFTGSKSHNTRSSIIDSG 322
           Y+G++Y    IP  N Y S    +    D  +      T+  N T + +     +++DSG
Sbjct: 236 YEGQLY---TIPLVNLYKSQGYQHPVAFDVTLQGLGLQTDKRNITLTTTK--LPALLDSG 290

Query: 323 TTLLILPKQDALDIHTYFGNSITDGTNF-AIMCNSTQTLT-LEFDNKNWTIPSEKYLGDK 380
           TTL  LP Q    +      S +    +    C S+   T + FD   + I +   L D 
Sbjct: 291 TTLTYLPSQAVALLAKSLNASYSKTLGYYEYTCPSSDNKTSVAFDFGGFRINAP--LSDF 348

Query: 381 YSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAE-----GNENAL 435
             Q S   G CV  I     +   ILGD FL   Y V+D++N  +  A+     G EN  
Sbjct: 349 TMQTSV--GTCVLAIIPQAGNATAILGDSFLRNAYVVYDLDNYEISLAQAKYGTGKENVE 406

Query: 436 LV 437
           ++
Sbjct: 407 VI 408

>Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {ON}
           YLR121C (REAL)
          Length = 497

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 91/371 (24%), Positives = 138/371 (37%), Gaps = 76/371 (20%)

Query: 98  YFVDVTIGDVAYPL--IIDTGSAYLWV----------------YG--DSCNSSSCKGRKL 137
           Y V++ IG  +  L  ++DTGSA LWV                YG  D   SS+ K  K 
Sbjct: 63  YSVELAIGTPSQSLTVLLDTGSADLWVPSKGNPYCGSVMDCDQYGVFDKTKSSTFKANKS 122

Query: 138 FPTTNVLQDVASFSLAYTSGV-AVGDVYHDRIIVNEL---------ATTDNFTFGVAS-E 186
            P          F  AY  G  A G    DR+  N L         A   N TFGV    
Sbjct: 123 SP----------FYAAYGDGTFAQGAFGQDRLKYNGLDLSGLSFAVANESNSTFGVLGIG 172

Query: 187 VPDIFENYPASGIFGLPSDNSQSIENIISKLRSSNAISMEKFSILIGHINAEVSEEEDGD 246
           +P +   Y  SG   +    S   +N    L+ S AI    +S+ +              
Sbjct: 173 LPALEVTY--SGKVAVVDKKSYEYDNFPLFLKRSGAIDATAYSLFL-------------- 216

Query: 247 VQDLTSNKGIFAIGDELEGLYKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENF 306
             D + + G    G      Y+G +Y    +P  N Y S    +    D  ++    +  
Sbjct: 217 -NDESQSSGSILFGAVDHSKYEGRLY---TVPLVNLYRSQGYQHPVAFDVTLHGIGLQ-- 270

Query: 307 TGSKSHNTR------SSIIDSGTTLLILPKQDALDIHTYFGNSITDGTNF-AIMCNSTQT 359
             +  HNT        +++DSGTTL  LP Q    +      + +    +    C S+  
Sbjct: 271 --TDRHNTTLTATKIPALLDSGTTLTYLPSQAVALLAKSLNATYSKALGYYEYACPSSDN 328

Query: 360 LT-LEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVF 418
            T + FD   + I +       ++  ++  G CV  +     +   ILGD FL   Y V+
Sbjct: 329 DTSVAFDFGGFHINAPV---SDFTMQTSVGGTCVLAVIPQAGNATAILGDSFLRNAYVVY 385

Query: 419 DVENQRLGFAE 429
           D++N  +  A+
Sbjct: 386 DLDNYEVSLAQ 396

>SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {ON}
           some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 542

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 60/122 (49%), Gaps = 11/122 (9%)

Query: 317 SIIDSGTTLLILPKQDALDIHTYFGNSITDGTN-FAIMC---NSTQTLTLEFDNKNWTIP 372
           +++DSGTTLL+ P++ A  +  Y   +  D    + + C   N       +F +    +P
Sbjct: 291 ALLDSGTTLLVAPQEFADSMANYVNATYNDLEGIYTMTCPPENDDTEFLFDFGDLKIKVP 350

Query: 373 SEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEGNE 432
            + ++     +D+ Y G+ V     L   D  ILGD+FL   Y V+D+E+  +  A+ N 
Sbjct: 351 LKNFI--LAPEDNEYCGFGV-----LPTVDTMILGDMFLSAAYVVYDLESYEVSLAQANW 403

Query: 433 NA 434
           N+
Sbjct: 404 NS 405

>AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR121C (YPS3),
           YDR144C (MKC7) and YLR120C (YPS1); Tandem gene
           duplication in Saccharomyces cerevisiae
          Length = 499

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 101/382 (26%), Positives = 152/382 (39%), Gaps = 73/382 (19%)

Query: 89  LQSDEHSQAYFVDVTIGDVAYPL--IIDTGSAYLWVYGDSC----------NSSSCKGRK 136
           ++ D     Y V+++IG     +  ++DTGS+ LWV G             N  +C    
Sbjct: 65  IEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHG 124

Query: 137 LFPTTNV---LQDVASFSLAYT-SGVAVGDVYHDRIIVNELATTDNFTFGVA----SEVP 188
            F T+       +   F + Y  S  A G    DR+ + + A  D  TF VA    S V 
Sbjct: 125 SFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQ-ANVDGLTFAVAHASNSSVA 183

Query: 189 DIFENYPA------SGIFGLPSDNSQSIENIISKLRSSNAISMEKFSILIGHINAEVSEE 242
            +    PA      S  FG   DN   +      L+ +N I    +S+ I  +NA+    
Sbjct: 184 VLGIGLPAMETTMSSQQFGYQYDNLPMV------LKRNNVIKKTVYSMFINELNAKT--- 234

Query: 243 EDGDVQDLTSNKGIFAIGDELEGLYKGEIYYNSLIPDKNSYWSLKINN---LYVNDYKVN 299
             G V        +F   D  +  YKG +   + +P  N+ +  ++N    L+V    + 
Sbjct: 235 --GSV--------LFGAVDHSK--YKGTL---NTVPLVNANYRRRVNKPVELHVTLAAIG 279

Query: 300 FT------NYENFTGSKSHNTRSSIIDSGTTLLILPKQDALDIHTYFGNSI-TDGTNFAI 352
                     +   GSK      +++DSGTTL   P Q A  +    G    ++   + +
Sbjct: 280 LHTGRDEDKVQTLLGSKV----PALLDSGTTLTYFPMQLADRLARAAGARWHSEEVGYIV 335

Query: 353 MCNST---QTLTLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDV 409
            CNS    QT  + +D   + I S   L D YS  +   G C   I      D  ILGDV
Sbjct: 336 DCNSRRLHQTAYI-YDFGGFQIRSP--LSD-YSMMTNVRGTCRFGIMPHS-SDYVILGDV 390

Query: 410 FLEGIYAVFDVENQRLGFAEGN 431
           FL   Y VFD+E   +  A+ N
Sbjct: 391 FLTRAYVVFDLEALEVSMAQAN 412

>Suva_9.186 Chr9
           (310161..310220,310267..310332,310362..310451,
           310470..310622,310626..310658,310662..310688,
           310692..310742,310746..310787,310807..310833,
           310840..311922) [1632 bp, 543 aa] {OFF} YIL015W (PSEUDO)
          Length = 543

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 10/121 (8%)

Query: 318 IIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM-CNSTQ---TLTLEFDNKNWTIPS 373
           ++DSGT+LL  PK  A  + ++   S +      I+ C  +      T +F +    +P 
Sbjct: 237 LLDSGTSLLNAPKSIADKMASFVNASYSADEGIYILDCPESTYDVEYTFDFGDLQINVPL 296

Query: 374 EKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEGNEN 433
              +    ++     GYC   +Q    +D+ +LGDVFL   Y VFD++N ++  A+ N N
Sbjct: 297 TSLILSPETEG----GYCGFAVQ--PTNDSMVLGDVFLSSAYVVFDLDNYKISLAQANWN 350

Query: 434 A 434
           A
Sbjct: 351 A 351

>Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W
           (REAL)
          Length = 333

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 10/121 (8%)

Query: 318 IIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM-CNSTQ---TLTLEFDNKNWTIPS 373
           ++DSGT+LL  PK  A  + ++   S +      I+ C  +      T +F +    +P 
Sbjct: 27  LLDSGTSLLNAPKSIADKMASFVNASYSADEGIYILDCPESTYDVEYTFDFGDLQINVPL 86

Query: 374 EKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEGNEN 433
              +    ++     GYC   +Q    +D+ +LGDVFL   Y VFD++N ++  A+ N N
Sbjct: 87  TSLILSPETEG----GYCGFAVQ--PTNDSMVLGDVFLSSAYVVFDLDNYKISLAQANWN 140

Query: 434 A 434
           A
Sbjct: 141 A 141

>CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3
          Length = 521

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 59/128 (46%), Gaps = 14/128 (10%)

Query: 317 SIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM---CNST---QTLTLEFDNKNWT 370
           +++DSG+T+ +LP+ D  D+     N   DG    I    C S    Q L   F    ++
Sbjct: 300 TLLDSGSTISLLPR-DVADLVAQQVNGTVDGKGNCIKLPKCPSKKDNQKLIFNFSGAEFS 358

Query: 371 IPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEG 430
           +    ++         + G C      LD  +  +LGD F+  +Y VF+++++ L  A+ 
Sbjct: 359 VNVTDFM-------EKHKGKCYLQFSALDGINFALLGDNFMNNVYTVFNLDDKELSLAQA 411

Query: 431 NENALLVP 438
           N N+ L P
Sbjct: 412 NYNSSLKP 419

>KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 64/133 (48%), Gaps = 12/133 (9%)

Query: 314 TRSSIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIMCNSTQT----LTLEFDNKNW 369
           T  +++DSGTT+   P Q A +I   F  +    + F  M  S  T    L  +F   + 
Sbjct: 345 TIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHI 404

Query: 370 TIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAE 429
           T P + ++  + SQ       CV  I G   ++  +LGDVFL   Y V+D+EN  +  A+
Sbjct: 405 TAPLDDFVVQQSSQT------CVLAI-GPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQ 457

Query: 430 GNENALLVPYSKE 442
            N ++ L P S E
Sbjct: 458 ANFDSSL-PESVE 469

>YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspartyl
           protease secreted into the periplasmic space of mating
           type a cells, helps cells find mating partners, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest
          Length = 587

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 86/399 (21%), Positives = 150/399 (37%), Gaps = 87/399 (21%)

Query: 88  ILQSDEHSQ-AYFVDVTIGDVAYPLIIDTGSAYLWVYGDS-------------------- 126
           +LQ +E    A  +D+     +  ++ DTGSA  WV   S                    
Sbjct: 36  LLQHEEEMYYATTLDIGTPSQSLTVLFDTGSADFWVMDSSNPFCLPNSNTSSYSNATYNG 95

Query: 127 --------CNSSSCKGRKLFPTTNVLQDVASFSLAYTSGV-AVGDVYHDRIIVNELATTD 177
                   C S S        T   L++   F + Y  G  A G    + + +N +    
Sbjct: 96  EEVKPSIDCRSMSTYNEHRSSTYQYLEN-GRFYITYADGTFADGSWGTETVSINGI-DIP 153

Query: 178 NFTFGVASEVPDIFENYPASGIFGLPSDNSQSIE-----------NIISKLRSSNAISME 226
           N  FGVA      +   P SG+ G+     +S++           N    L+S   I + 
Sbjct: 154 NIQFGVAK-----YATTPVSGVLGIGFPRRESVKGYEGAPNEYYPNFPQILKSEKIIDVV 208

Query: 227 KFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYKGEIY-------YNSLIPD 279
            +S+ +   +               S  G    G   E  + G+++       Y +++ D
Sbjct: 209 AYSLFLNSPD---------------SGTGSIVFGAIDESKFSGDLFTFPMVNEYPTIV-D 252

Query: 280 KNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLILPKQDALDIHTY 339
             +  ++ I  L   +       +E FT +K       ++DSGT+LL  PK  A  + ++
Sbjct: 253 APATLAMTIQGLGAQNKSS--CEHETFTTTK----YPVLLDSGTSLLNAPKVIADKMASF 306

Query: 340 FGNSITDGTNFAIMCNSTQTLTLE----FDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNI 395
              S ++     I+        +E    F +   ++P    +    ++ S Y G+ V   
Sbjct: 307 VNASYSEEEGIYILDCPVSVGDVEYNFDFGDLQISVPLSSLILSPETEGS-YCGFAVQ-- 363

Query: 396 QGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEGNENA 434
                +D+ +LGDVFL   Y VFD++N ++  A+ N NA
Sbjct: 364 ---PTNDSMVLGDVFLSSAYVVFDLDNYKISLAQANWNA 399

>Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W
           (REAL)
          Length = 516

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 58/121 (47%), Gaps = 10/121 (8%)

Query: 318 IIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM-CNSTQ---TLTLEFDNKNWTIPS 373
           ++DSGT+LL  PK  A  + ++   S +      I+ C  +      T +F +    +P 
Sbjct: 285 LLDSGTSLLNAPKTIADKMASFVNASYSADEGIYILNCPDSADDIEYTFDFGDLQINVPL 344

Query: 374 EKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEGNEN 433
              +     +     GYC   +Q    +D+ +LGDVFL   Y VFD++N ++  A+ N N
Sbjct: 345 TSLILSPEVEG----GYCGFAVQ--PTNDSMVLGDVFLSSAYVVFDLDNYKISLAQANWN 398

Query: 434 A 434
           A
Sbjct: 399 A 399

>KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 90/368 (24%), Positives = 154/368 (41%), Gaps = 65/368 (17%)

Query: 98  YFVDVTIGDVAYPL--IIDTGSAYLWVYGDS---CN---SSSCK--GRKLFPTTNVLQDV 147
           Y +D+ IG  +  +  ++DTGS+ LWV G +   C    SS CK  G   +  ++  QD 
Sbjct: 51  YSIDLAIGTPSQKVTVLLDTGSSDLWVTGANNPYCQTSLSSECKEYGTFDYGQSSTFQDR 110

Query: 148 -ASFSLAYTSGVAV-GDVYHDRIIVNELATT-DNFTFGVASEVPDIFENYPASGIFGLPS 204
            ++  + Y  G  V G    D + +N  A    N   GVA     +      +G+ GL  
Sbjct: 111 NSALKINYQDGTKVDGRWGVDTLELNNGAIQLQNTMIGVADSSDSV------AGVIGLG- 163

Query: 205 DNSQSIENIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAI----- 259
                       L ++N +     S    +   ++ ++    V D T    +FAI     
Sbjct: 164 ---------FPGLETTNNVQANGESYTYANFPMQLKQQ---GVTDAT----VFAIALDNS 207

Query: 260 --GDEL-----EGLYKGEIYYNSLIPDKNSYWSLKIN-NLYVNDYKVNFTNYENFTGSKS 311
             GD L     EG Y G +Y   ++  + +   +++   L       +  + E F    S
Sbjct: 208 YGGDILFGAVDEGKYIGGLYTLPVVNSRGTATPIRMEVTLQGIGVDSDGGDQETF----S 263

Query: 312 HNTRSSIIDSGTTLLILPKQDALDIHTYFGNSITDGTN--FAIMCNST---QTLTLEFDN 366
                +++DSG+T++ LP+  A  I+   G    DG++  + I C +      L  +F  
Sbjct: 264 STPMLALVDSGSTMVYLPELIATAIYNKVGARY-DGSSEMYTIDCGTNVENDNLIFDFGG 322

Query: 367 KNWTIPSEKYL-GDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRL 425
            + + P   Y+  D+ S +    G C+  I      +  +LGD FL   Y VFD+++  +
Sbjct: 323 FHISTPVSNYIITDQRSSN----GQCLFGILSQS-GNTVVLGDTFLSSAYVVFDLDHYEI 377

Query: 426 GFAEGNEN 433
             A+GN N
Sbjct: 378 SMAQGNSN 385

>Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}
           similar to Ashbya gossypii AGL192W
          Length = 502

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 84/358 (23%), Positives = 146/358 (40%), Gaps = 50/358 (13%)

Query: 98  YFVDVTIGDVA--YPLIIDTGSAYLWVYGDSC-----NSSSCKGRKLF--------PTTN 142
           Y V+++IG  A    +++DTGS+ LW+ G        NS S +    F         +++
Sbjct: 76  YSVNLSIGTPAQEVTVLVDTGSSDLWIIGADVDCGPDNSDSTEPLDCFEYGAFDKSKSSS 135

Query: 143 VLQDVASFSLAYT-SGVAVGDVYHDRIIVNELATTDNFTFGVA----SEVPDIFENYPAS 197
              +   F ++Y  +  A G+   D++ + +L   D  TF VA    S V  +       
Sbjct: 136 WKNNHTEFYISYGDTSFASGEWGTDKLDLGDL-NADGLTFAVATASNSSVAVLGIGLTGI 194

Query: 198 GIFGLPSDNSQSIENIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIF 257
            +     DN    +N+   L+ +  I    +S+ +  ++A             TS   +F
Sbjct: 195 EVTRASGDNGYEYDNLPIVLKRNGVIDKTAYSLYLNDLDA-------------TSGSVLF 241

Query: 258 AIGDELEGLYKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSS 317
              D  +  Y G +    L+     Y   K   L++    + F++ +   G+ S     +
Sbjct: 242 GAVDHSK--YTGTLATVPLVNVNARYGFPKPIELHITLNGLGFSSGKK-RGTISATKVPA 298

Query: 318 IIDSGTTLLILPKQDALDIHTYFGNSITDGT--NFAIMCNSTQT----LTLEFDNKNWTI 371
           ++DSGTTL   P + A  I +  G ++ +     F I C+  +     L   F     T 
Sbjct: 299 LLDSGTTLSYFPTELAAAIASNVG-AVWNARLRKFLIPCSQAKRNNIDLIYNFGGVEITS 357

Query: 372 PSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAE 429
           P   YL +   +D      C+  I     +D  ILGDVFL  +Y V+D+E   +  A+
Sbjct: 358 PLVNYLSETNVED-----VCLLGIVPTSSNDI-ILGDVFLTSVYTVYDLEALEVSIAQ 409

>Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {ON}
           YLR121C (REAL)
          Length = 507

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 84/349 (24%), Positives = 133/349 (38%), Gaps = 29/349 (8%)

Query: 98  YFVDVTIGDVAYPL--IIDTGSAYLWVYGDS---CNS-SSCKGRKLF----PTTNVLQDV 147
           Y V++ IG  +  L  ++DTGSA LWV G     C S   C    +F     +T      
Sbjct: 63  YSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYCGSVMDCDQYGVFDKSKSSTFKANKS 122

Query: 148 ASFSLAYTSGV-AVGDVYHDRIIVNELATTDNFTFGVASEVPDIFENYPASGIFGLPSDN 206
           + F  AY  G  A G    D++  N L  +    F VA+E    F      G+ G+    
Sbjct: 123 SPFYAAYGDGTFAEGAFGQDKLKYNNLDLS-GLPFAVANESNSTF------GVLGIGLST 175

Query: 207 SQSIENIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGL 266
            +   +    +    +   + F + + H  A  +      + D +   G    G      
Sbjct: 176 LEVTYSGKVAVMDKRSYEYDNFPLFLKHSGAIDATAYSLFLNDESQASGSILFGAVDHSK 235

Query: 267 YKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRS--SIIDSGTT 324
           Y+G++Y    IP  N Y S    +    D  +     +    + +  T    +++DSGTT
Sbjct: 236 YEGQLY---TIPLVNMYKSQGYQHPVAFDVTLQGLGLQTDKRNTTLTTTKFPALLDSGTT 292

Query: 325 LLILPKQDALDIHTYFGNSITDGTNF-AIMCNSTQTLT-LEFDNKNWTIPSEKYLGDKYS 382
           L  LP Q    +      S +    +    C S+   T + FD   + I +   L D   
Sbjct: 293 LTYLPSQAVALLAKSLNASYSKTLGYYEYTCPSSDNKTSIAFDFGGFRINAP--LSDFTM 350

Query: 383 QDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEGN 431
           Q S   G C   +     +   ILGD FL   Y V+D++N  +  A+  
Sbjct: 351 QTSV--GTCALALIPQAGNATAILGDSFLRNAYVVYDLDNYEISLAQAK 397

>Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W
           (REAL)
          Length = 593

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 82/394 (20%), Positives = 148/394 (37%), Gaps = 82/394 (20%)

Query: 87  SILQSDEHSQAYFVDVTIGDVAYPLIIDTGSAYLWVYGDSCN-------------SSSCK 133
           S+ + ++   A  +D+        ++ DTGSA  W+  DS N             +++  
Sbjct: 36  SLQRKEDMYYATTLDIGTPSQQLTVLFDTGSADFWIM-DSSNPFCLSTSSTSSYLNATYD 94

Query: 134 GRKLFPTTNVLQ---------------DVASFSLAYTSGVAVGDVYHDRIIVNELATTDN 178
           G  + P+ +                  D   F + Y  G      +    +  +     N
Sbjct: 95  GSIITPSVDCQSMVTYSEGNSSTYQNLDNGRFYIIYADGTFADGTWGTETVSIDGIVIPN 154

Query: 179 FTFGVASEVPDIFENYPASGIFGLPSDNSQSIE-----------NIISKLRSSNAISMEK 227
             FG+A      +   P SG+ G+     +S++           N    L+S   I +  
Sbjct: 155 IQFGLAK-----YATTPVSGVLGIGFPRRESVKGYEGAPNKYYPNFPQILKSEQIIDVVA 209

Query: 228 FSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYKGEIYYNSL------IPDKN 281
           +S+ +        E   G +        IF   DE +  + G+++   +      I D  
Sbjct: 210 YSLFLNS-----PESGTGSI--------IFGAIDESK--FSGDLFTFPMVNEYPNIVDTP 254

Query: 282 SYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLILPKQDALDIHTYFG 341
           +  ++ I  L   +   N   YE F  +K       ++DSGT+LL  PK  A  + ++  
Sbjct: 255 ATLAMTIQGLGAQNK--NSCEYETFMTTK----YPVLLDSGTSLLNAPKVIADKMASFVN 308

Query: 342 NSITDGTNFAIM-CNSTQ---TLTLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQG 397
            + +      I+ C +       T +F +   ++P    L        A  GYC   +Q 
Sbjct: 309 ATYSAEEGIYILDCPAFADEIEYTFDFGDLKISVP----LTSLILSPEAEGGYCGFAVQ- 363

Query: 398 LDIDDAWILGDVFLEGIYAVFDVENQRLGFAEGN 431
              +D+ +LGDVFL   Y VFD++N ++  A+ N
Sbjct: 364 -PTNDSMVLGDVFLSSAYVVFDLDNYKISLAQAN 396

>ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 506

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 61/133 (45%), Gaps = 16/133 (12%)

Query: 308 GSKSHNTRSS-----IIDSGTTLLILPKQDALDIHTYFGNSITDG---TNFAIMCNST-Q 358
           GS++ NT ++     ++DSGTT + LP+  A  +   +G S  D     ++ I C S  +
Sbjct: 341 GSETQNTLTTTPFIGLLDSGTTAVYLPEPVADMVANAYGGSFDDDPEVQSYVISCPSDDE 400

Query: 359 TLTLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVF 418
            +   F   N       Y+ D  +      G C+ NI     D   ILGD FL   Y V+
Sbjct: 401 KIVFNFGGFNIETSLSNYITDNGN------GQCILNISPTS-DYMGILGDSFLRDSYVVY 453

Query: 419 DVENQRLGFAEGN 431
           D++N  +  A+ N
Sbjct: 454 DMDNNEISLAQAN 466

>ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 486

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 88/390 (22%), Positives = 150/390 (38%), Gaps = 81/390 (20%)

Query: 98  YFVDVTIGDVAYPL--IIDTGSAYLWVYG------------DSCNSSSCKGRKLFPTTNV 143
           Y V++++G  A  L  ++DTGS+ LWV G            DS ++         P+   
Sbjct: 70  YSVELSVGTPAQKLSVLLDTGSSDLWVPGADNLFCENHAVSDSNSTDKPLKSPTLPSPQP 129

Query: 144 LQDV---ASFSLAYTSGV----------------AVGDVYHDRIIVNELATTDNFTFGVA 184
             D     +F  + +S                  A+G    D + +N L+   N + GVA
Sbjct: 130 TIDCNQYGTFDYSKSSSFKANDSSLLIRYGDQSYALGRFGQDTVEMNSLSI-PNVSLGVA 188

Query: 185 SEVPDIFENYPASGIFGLPSDN----------SQSIENIISKLRSSNAISMEKFSILIGH 234
            +  ++ +     G+ GL + N          S + EN    L+S   I    +S+ +  
Sbjct: 189 HQA-NVTQGVLGIGLAGLETTNTGFSSTLNSKSYTYENFPQVLKSQGIIDANAYSLFLNS 247

Query: 235 INAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYKGEIY----YNSLIPDKNSYWSLKINN 290
             A                +G    G      Y G +Y     N+  P     + + +  
Sbjct: 248 PGAS---------------QGGILFGGVDHSKYTGPLYTVPIINTGAPGNPIQFQVTLQG 292

Query: 291 LYVNDYKVNFTNYENFTGSKSHNTRSS-----IIDSGTTLLILPKQDALDIHTYFGNSIT 345
           + ++  K N TN  N   S S+ T ++     ++DSGTTL+ LP+     +    G +  
Sbjct: 293 VGISLDKSNGTN-TNAADSTSNVTLTASKFPVLLDSGTTLMTLPRPVTDQMAKQLGATYN 351

Query: 346 DGTNF-AIMC---NSTQTLTLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDID 401
             T++  + C   N    L L+F           ++    SQ+    G C+  I   D D
Sbjct: 352 SETSYYQLKCPSQNDNTRLILDFGGFQVNAKITNHI--TRSQN----GECLLGITPSDTD 405

Query: 402 DAWILGDVFLEGIYAVFDVENQRLGFAEGN 431
            +  LGDVFL   Y V+D++N  +  A+ +
Sbjct: 406 -SGTLGDVFLVDAYVVYDLDNYEISLAQAD 434

>NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa]
           {ON} Anc_7.182
          Length = 540

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 56/120 (46%), Gaps = 11/120 (9%)

Query: 318 IIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM-CNSTQTLT-----LEFDNKNWTI 371
           ++DSGTTL+  PK+ A  +  +   + ++     IM C + +TL       +F      +
Sbjct: 300 LLDSGTTLMGAPKEIADMMADFMNATFSEDEGIYIMECPTKETLANTDYIFDFGGVQIKV 359

Query: 372 PSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEGN 431
           P   ++    S+     G+ V      D  +  +LGD+FL   Y VFD++N ++  A  N
Sbjct: 360 PLSNFILSAQSEGGPC-GFAVLP----DDSNTMVLGDIFLSSAYVVFDLDNYQISLAAAN 414

>CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa]
           {ON} similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015w BAR1
          Length = 541

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 60/131 (45%), Gaps = 11/131 (8%)

Query: 311 SHNTRSSIIDSGTTLLILPKQDALDIHTYFGNSITDGTN-FAIMCNS-----TQTLTLEF 364
           S+    +++D+G+TL+ LP      I +Y   + +D    F + C S     T  L   F
Sbjct: 273 SNTKLPALLDTGSTLIELPHPITQSIASYLNATWSDDHGLFVLACPSDDFLTTTDLAFTF 332

Query: 365 DNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQR 424
              +  IP   ++     + +   G  +++ +G       ILGD FL  +Y VFD++N  
Sbjct: 333 GELHMKIPLRSFILLPDEESNGLCGLGITSSKG-----RVILGDSFLTHVYTVFDLDNYM 387

Query: 425 LGFAEGNENAL 435
           +  A   +++L
Sbjct: 388 ISLAPMAKSSL 398

>KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa]
           {ON} Anc_8.318 YLR120C
          Length = 575

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 56/119 (47%), Gaps = 11/119 (9%)

Query: 317 SIIDSGTTLLILPKQDALDIHTYFGNSITDGTNF-AIMCNSTQ---TLTLEFDNKNWTIP 372
           +++DSGTT++  P+     +    G S +D   F A+ C S+        +F   + T+P
Sbjct: 362 ALLDSGTTIVYFPETLLELVADQLGASYSDELGFYAMSCVSSSDDTEFVFDFGGFHITVP 421

Query: 373 SEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEGN 431
              +L      +      C+  +   D D++ ILGD FL   Y V+D+EN  +  A+ N
Sbjct: 422 LSDFLIRVSGSE------CILAMAAQD-DESIILGDYFLTNAYVVYDLENYEISMAQAN 473

>AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
           (PEP4)
          Length = 268

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 63/153 (41%), Gaps = 19/153 (12%)

Query: 280 KNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLILPKQDALDIHTY 339
           K  +W ++ N++   +  V                  +I+D+G++L +LP +     +  
Sbjct: 130 KKGFWEVEFNSISTGESTVQGEGL------------GAILDTGSSLTLLPTEIFDKFNGA 177

Query: 340 FGNSITDGTNFAIMCNSTQT---LTLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQ 396
              ++   T   + C++ +T   +  E   K + I   +Y+    S+         S  Q
Sbjct: 178 LEAALGSKTGGRVSCSARETAPEIVFELGGKKFAITGNEYIMPAGSECMVTIRPQASGAQ 237

Query: 397 GLDIDDAWILGDVFLEGIYAVFDVENQRLGFAE 429
                +  ILG  FL   Y+V+D+ + R+G AE
Sbjct: 238 ----SNVVILGTPFLRKFYSVYDLGSDRVGLAE 266

>KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]
           {ON} some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease
          Length = 511

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 58/126 (46%), Gaps = 16/126 (12%)

Query: 311 SHNTRSSIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM-C---NSTQTLTLEFDN 366
           +H    +++DSG+T++  P++    I    G + ++     ++ C   N  +T   +F  
Sbjct: 289 AHKKAPALLDSGSTIMGAPQEALESIAQELGAAFSESDGLYVLDCPASNDDRTFYFDFGE 348

Query: 367 KNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDI---DDAWILGDVFLEGIYAVFDVENQ 423
               +P    L   Y  +S    YC     GL I    + WILGD+ L+  Y V+D++N 
Sbjct: 349 LKLKVPIHDLL---YLPESGQ-NYC-----GLAIIASGEEWILGDLVLKSAYVVYDLDNL 399

Query: 424 RLGFAE 429
            +  A+
Sbjct: 400 EISIAQ 405

>ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {ON}
           weakly similar to YYIL015W uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 551

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 57/120 (47%), Gaps = 5/120 (4%)

Query: 317 SIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIMCNSTQT--LTLEFDNKNWTIPSE 374
           +++DSGTTL+ LP   A ++    G   +  T + ++   ++     + FD   + I  E
Sbjct: 308 ALLDSGTTLMYLPTALADELAKSLGGKFSPSTGYYLIPKPSENDDTKITFDFGGFHI--E 365

Query: 375 KYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEGNENA 434
             L +   Q S      +  I   + D A I GDVFL   Y V+D+E+  +  A+ N N+
Sbjct: 366 TKLSNYILQGSGPQDVAILGILRTEGDRA-IFGDVFLVDAYVVYDLEDYEISLAQANFNS 424

>Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {ON}
           YLR121C (REAL)
          Length = 745

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 93/395 (23%), Positives = 151/395 (38%), Gaps = 72/395 (18%)

Query: 77  FAKIQVKPGISI----------LQSDEHSQAYFVDVTIGDVA--YPLIIDTGSAYLWVYG 124
           FAK Q  PG  +          + S+E S  Y V++ +G  +    +++DTGSA LWV  
Sbjct: 34  FAKRQNGPGSELGKRAGGDENFVLSNEQS-FYSVELALGTPSQNVTVLLDTGSADLWVPS 92

Query: 125 DS---CNSS-SCKGRKLFPTTN----VLQDVASFSLAYTSGVAVGDVY-HDRIIVNELAT 175
           ++   C S+ +C    +F   N         A F  +Y  G     V+  D++  +    
Sbjct: 93  NANPYCGSAMNCDQYGVFDKANSSTFTANHSAPFYASYGDGTFAEGVFGQDKLHYSGGLD 152

Query: 176 TDNFTFGVASE-----------VPDIFENYPASGIFGLPSDNSQSIENIISKLRSSNAIS 224
               +F VA++           +P +   Y  SG   +    S   +N    L+ S AI 
Sbjct: 153 LSGLSFAVANKSNSTVGVLGIGLPMLEVTY--SGKVAVADKRSYQYDNFPLFLKRSGAID 210

Query: 225 MEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYKGEIYYNSLIPDKNSYW 284
              +S+ +                D T   G    G      Y G++Y    IP  N Y 
Sbjct: 211 ATAYSLFL---------------NDETQTSGSVLFGAVDHSKYLGQLY---TIPLVNLYK 252

Query: 285 SLKINNLYVNDYKVNFTNYENFTGSKSHNTR------SSIIDSGTTLLILPKQDALDIHT 338
           +         D  +     +    +++HNT        +++DSGTTL  LP  DA+ +  
Sbjct: 253 AQGYQRPVAFDVTLQGLGLQ----TRAHNTTLTTTRIPALLDSGTTLTYLPA-DAVALMA 307

Query: 339 YFGNSITDGT----NFAIMCNSTQTLTLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSN 394
              N+          +A   +     ++ FD   + I +   L D   Q +   G CV  
Sbjct: 308 KSLNATFSKELGYYEYACPTSGDNATSVVFDLGGFHINAP--LSDFTMQTNV--GTCVLA 363

Query: 395 IQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAE 429
           I     +   ILGD FL   Y V+D++N  +  A+
Sbjct: 364 IVPQAGNATAILGDSFLRSAYVVYDLDNYEVSLAQ 398

>Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C
           (REAL)
          Length = 540

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 118/301 (39%), Gaps = 50/301 (16%)

Query: 150 FSLAYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDIFENYPASGIFG--LPS--- 204
           F+L Y         Y   ++     T  NFTFGV+++  +        GI G  LPS   
Sbjct: 162 FNLTYGDNSYYAGTYGTDVVSLGNITLSNFTFGVSNDTTN------NGGILGVSLPSAEV 215

Query: 205 --DNSQSIE---------NIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDVQDLTSN 253
             D   ++          N    L+S   I    +S+ +   +A       G +      
Sbjct: 216 TDDTEDALSSNTTPFIYNNFPMALKSQGKIKKIAYSLFLNEPSARF-----GSI------ 264

Query: 254 KGIFAIGDELEGLYKGEIYYNSLIPDKNSYWSLKINN--LYVNDYKVNFTNYENFTGSKS 311
             +F   D+ E  Y G++Y    +P   +Y +L   +  ++V    V   + ++   + S
Sbjct: 265 --LFGAVDKSE--YSGQLY---TLPMLQAYNTLDATDAGMFVTAQSVAILDSKSGNKTVS 317

Query: 312 HNTRSSIIDSGTTLLILPKQDALDIHTYF-GNSITDGTNFAIMCNSTQTLTLEFDNKNWT 370
                 + DSGT+  +LP + A  I   F G   +D   +   C       L FD   + 
Sbjct: 318 EVQFPVLFDSGTSTSVLPTKIADAIGRSFDGKYSSDDQGYIFDCAKVNNTLLSFDFGGFN 377

Query: 371 IPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEG 430
           I +        ++D     +C+  +Q L  D  ++LGD FL   Y V+D+EN  +  A+ 
Sbjct: 378 ISANISNFVTPAKD-----HCI--LQILPSDTIFVLGDAFLVDTYVVYDLENHEVSVAQA 430

Query: 431 N 431
           +
Sbjct: 431 S 431

>YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON}
           YPS1Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 569

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 53/120 (44%), Gaps = 10/120 (8%)

Query: 317 SIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM-CNSTQTLTLEFDNKNWTI--PS 373
           +++DSGTTL  LP+     I T  G   +    + ++ C S  ++ + FD   + I  P 
Sbjct: 368 ALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSMEIVFDFGGFHINAPL 427

Query: 374 EKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEGNEN 433
             ++    +        C+  I     D   ILGD FL   Y V+D+EN  +  A+   N
Sbjct: 428 SSFILSTGTT-------CLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYN 480

>ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 572

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 62/224 (27%), Positives = 96/224 (42%), Gaps = 27/224 (12%)

Query: 211 ENIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYKGE 270
           +N    L+S  AI+   +S+ +  ++A       GD+        +F   D  +  YKG+
Sbjct: 271 QNFPQVLKSKGAINKAAYSLFLNSLDAS-----SGDI--------LFGAVDRSK--YKGD 315

Query: 271 IYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLILPK 330
           +Y   L+    + +   +    V    V FTN  + T   +     +++DSGT+L+ LP 
Sbjct: 316 LYTLPLLNSDPTKYKNPME-FDVTLQGVGFTNGSSKTTFTTTKI-PALLDSGTSLIYLPD 373

Query: 331 QDALDIHTYFGNSITDGTNF-AIMCNSTQTLT-LEFDNKNWTIP---SEKYLGDKYSQDS 385
             A  I    G S  +   +  I C S    + L FD   +TI    S   LG   S D 
Sbjct: 374 ALAKGIAHKLGGSYNEDIGYYVIGCPSENDDSQLVFDFGGFTIKNNLSNYLLG---SPDD 430

Query: 386 AYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAE 429
                CV  I  L  D   ILGDVFL   Y V+D+++  +  A+
Sbjct: 431 GDDSQCVLGI--LPSDVQAILGDVFLADAYVVYDLDDYEVSLAQ 472

>Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)
          Length = 342

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 65/272 (23%), Positives = 107/272 (39%), Gaps = 48/272 (17%)

Query: 175 TTDNFTFGVASEVPDIFENYPASGIFG--LPS-DNSQSI-----------ENIISKLRSS 220
           T ++F+FGVA+      EN    GI G  LP+ +N+ S+           EN    L+S 
Sbjct: 30  TLESFSFGVANNT----EN--QGGILGISLPAGENTHSLGGAYNTTPFEYENFPMALKSH 83

Query: 221 NAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYKGEIYYNSLIPDK 280
             I    +S+ +    A                 G    G   +  Y G++Y    +P  
Sbjct: 84  GKIEKIAYSLFLNEPKAHF---------------GSILFGAVDKSKYSGQLY---TLPML 125

Query: 281 NSYWSLKI--NNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLILPKQDALDIHT 338
            +Y +L      ++V    V   N ++   + S      + DSGTT   LP + A  I  
Sbjct: 126 QAYDTLDSVSPGMFVTAQSVAVLNGDSGNKTVSKVRFPVLFDSGTTYSSLPTEVAHAIGK 185

Query: 339 YFGNSITDG-TNFAIMCNSTQTLTLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQG 397
            F    + G   +   C+  +   L  D   + I +        ++D     +C+ NI+ 
Sbjct: 186 SFDGKYSSGDQGYTFDCSKVKDTLLSIDFGGFNISANISNFVTRTKD-----HCLLNIEA 240

Query: 398 LDIDDAWILGDVFLEGIYAVFDVENQRLGFAE 429
              D  ++LGD FL   Y VFD+E+  +  A+
Sbjct: 241 --ADSGFVLGDAFLVDAYVVFDLESHEVSIAQ 270

>Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)
          Length = 464

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 69/304 (22%), Positives = 125/304 (41%), Gaps = 51/304 (16%)

Query: 150 FSLAYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDIFENYPASGIFG--LPS-DN 206
           F+++Y   +     Y   ++     T  NFTFGV+++    +      GI G  LPS + 
Sbjct: 158 FNISYADNMYYAGTYGTDVVSLGNITLSNFTFGVSNDTKMSY------GILGVSLPSVEE 211

Query: 207 SQSIENIISK-------------LRSSNAISMEKFSILIGHINAEVSEEEDGDVQDLTSN 253
           +  IE+ +S              L+S   I    +S+ +   +A                
Sbjct: 212 TDDIEDALSSNTTPFVYENFPMALKSQGKIEKIAYSLFLNEPSARF-------------- 257

Query: 254 KGIFAIGDELEGLYKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSHN 313
            G    G   +  Y G++Y   ++   N+  +L  + ++V        + ++   + S  
Sbjct: 258 -GSILFGAVDKSKYSGQLYTLPMLQAYNTLDAL-YSGMFVTAQSAAIIDSKSGNKTVSEV 315

Query: 314 TRSSIIDSGTTLLILPKQDALDIHTYF-GNSITDGTNFAIMC---NSTQTLTLEFDNKNW 369
               + DSGT+  +LP + A  I   F G   +D   +   C   N+TQ L+++F   N 
Sbjct: 316 QFPVLFDSGTSTSVLPTEIADAIGRSFDGKYSSDDEGYIFDCSKVNNTQ-LSIDFGGFNI 374

Query: 370 TIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAE 429
           +     ++    ++D     +CV  +Q L  D   +LGD FL   Y V+D+EN  +  A+
Sbjct: 375 SANISNFV-TPLTKD-----HCV--LQILPSDTVSVLGDAFLVDTYVVYDLENHEVSVAQ 426

Query: 430 GNEN 433
            + N
Sbjct: 427 ASFN 430

>Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {ON}
           complement(141395..143161) [1767 nt, 589 aa]
          Length = 588

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 96/382 (25%), Positives = 159/382 (41%), Gaps = 42/382 (10%)

Query: 74  NETFAKIQVKP-GISILQSDEHSQAYFVDVTIGDVA--YPLIIDTGSAYLWVYGDS---C 127
           N+ +A I  +  G+  ++    S  Y V ++IG  A    +++DTGS+ LWV G +   C
Sbjct: 84  NKRYANIVKRDNGVEEVEIMNQSNFYSVSLSIGSNAQNVTVLLDTGSSDLWVTGSNNPLC 143

Query: 128 -------NSSSCKGRKLF-PTTNVL--QDVASFSLAYT-SGVAVGDVYHDRIIVNELATT 176
                  ++  C     F P+T+     +  SFS++Y  S  A G    D + + +L  T
Sbjct: 144 SRGDSNSDAVDCAKFGTFNPSTSDTWSSNETSFSISYADSSYASGTWGQDTLKLQDLDVT 203

Query: 177 DNFTFGVASEVPDIFENYPASGI----FGLPS-DNSQSIENIISKLRSSNAISMEKFSIL 231
              +F VA        NY  S +     GLPS + + S  N ++  R       E F +L
Sbjct: 204 -GLSFAVA--------NYTNSTVGVLGIGLPSLEVTYSGSNNVAGTR----YQYENFPLL 250

Query: 232 IGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYKGEIYYNSLIPDKNSYWSLKINNL 291
           + +  A  +      + DL S  G    G      Y G +Y   L+    +    +    
Sbjct: 251 LKNSGATKANAYSLYLNDLDSRTGSVLFGGVDHNKYSGTLYTIPLVNTLRAAGFSQPVEF 310

Query: 292 YVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFA 351
            V    +  ++ E+   + +     +++DSGTTL+ LP      I   +       T + 
Sbjct: 311 DVTLQGMGISDDEHGNVTLTTTKIPALLDSGTTLVYLPSALVSLIADEYDAVYNSRTGYY 370

Query: 352 IM-C-NSTQTLTLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDV 409
           +M C +S +   + FD   + I +   L     Q  A  G CV  I       A ILGD 
Sbjct: 371 VMNCPDSDEDSQIVFDFGGFHISTN--LTTYIIQ--AVGGICVLGILPQSSGTA-ILGDS 425

Query: 410 FLEGIYAVFDVENQRLGFAEGN 431
           FL+  Y V+D++N  +  A+ +
Sbjct: 426 FLQHAYVVYDLDNLEISMAQAS 447

>NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON} 
          Length = 559

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 90/392 (22%), Positives = 153/392 (39%), Gaps = 42/392 (10%)

Query: 63  HYKDTAVSNSSNETFAKIQVKPGISILQSDEHSQAYFVDVTIGDVAYP-----LIIDTGS 117
           HY DTA ++S       ++ + G    + +  +Q  F  V + DV  P     +++DTGS
Sbjct: 45  HY-DTASTDSRKPKLELVK-RDGSDYEEVELTNQQSFYSVEV-DVGTPSQRVTVLLDTGS 101

Query: 118 AYLWVYGD---------SCNSSSCKGRKLFPTTNVL---QDVASFSLAYTSG-VAVGDVY 164
           +  WV G          S     C     F +++      +  +F++ Y  G  A+G   
Sbjct: 102 SDFWVMGSDNPYCSDDTSTTGIDCSEFGTFDSSSSSTFHNNGTAFNIHYGDGSFALGTWG 161

Query: 165 HDRIIVNELATTDNFTFGVASEVPDIFENYPASGIFGLPSDNSQSIENIISKLRSSNAIS 224
            D + ++++ T D  +  VA+       +  + G+ GL     ++  +    ++S     
Sbjct: 162 TDTVSIDDI-TLDALSLAVANS------SNSSMGVIGLGLAGLETTYSSSHAVKSGQTYQ 214

Query: 225 MEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYKGEIYYNSLIPDKNSYW 284
              F + + +     +      + D     G    G     LY G++Y    IP  N Y 
Sbjct: 215 YANFPLALKNAGIVAANAYSLYLNDPEETTGNILFGAVDHSLYSGQLY---TIPLVNIYS 271

Query: 285 SLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSII---DSGTTLLILPKQDALDIHTYFG 341
                N    D  +N     + +GS +  + + II   DSGTTL   P Q    +    G
Sbjct: 272 GSGFKNAVEFDVTLNGIGIVDSSGSATTVSTTPIIALLDSGTTLTYFPTQYVSLLAAQLG 331

Query: 342 NSITDGTNF-AIMCNSTQ--TLTLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGL 398
              +    +  I C++ Q  T  L FD   + I +   L D   Q       C  +I   
Sbjct: 332 AQYSSSNGYYTISCDAMQDTTTKLVFDFGGFHINAT--LADFVVQSGT--STCFLSIIPQ 387

Query: 399 DIDDAWILGDVFLEGIYAVFDVENQRLGFAEG 430
           +   A ILGD FL   Y V+D++N  +  A+ 
Sbjct: 388 NSSSA-ILGDTFLNNAYVVYDLDNLEISMAQA 418

>Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)
          Length = 304

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 51/115 (44%), Gaps = 8/115 (6%)

Query: 318 IIDSGTTLLILPKQDALDIHTYFGNSITDG-TNFAIMCNSTQTLTLEFDNKNWTIPSEKY 376
           + DSGTT   LP + A  I   F    + G   +   C+  +   L  D   + I +   
Sbjct: 88  LFDSGTTYSSLPTEVAHAIGKSFDGKYSSGDQGYTFDCSKVKDTLLSIDFGGFNISANIS 147

Query: 377 LGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEGN 431
                ++D     +C+ NI+    D  ++LGD FL   Y VFD+E+  +  A+ +
Sbjct: 148 NFVTRTKD-----HCLLNIEA--ADSGFVLGDAFLVDAYVVFDLESHEVSIAQAS 195

>CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
          Length = 539

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 80/208 (38%), Gaps = 43/208 (20%)

Query: 247 VQDLTSNKGIFAIGDELEGLYKGEIYYNSLIPD-------KNSYWSLKINNLYVNDYKVN 299
           + D  S KG+   G      Y+G ++   ++ +         S   + +N L   D K N
Sbjct: 236 LNDTNSKKGVILFGGVDHSKYQGTLWTVPMVNNLLTLNQTTTSRPEITLNGLGFRDDKKN 295

Query: 300 FTNYENFTGSKSHNTRSSIIDSGTTLLILPKQDALDIHTYFGNSI---TDGTNFAIMCNS 356
            T +    G K       ++D+GTTL   PKQ    I      +I   T G       N+
Sbjct: 296 VTLW----GEKI----PVLLDTGTTLAYAPKQVVDVIAKRVNGTIDSKTGGIKLKKCPNA 347

Query: 357 TQTLTLEFDNKNWTIP-----------SEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWI 405
                L F+     IP            + YL  +Y ++ +  G               +
Sbjct: 348 KDNSELIFNFAGAEIPVSLLNMVEKRKGKCYLEIRYHEELSKTGM--------------L 393

Query: 406 LGDVFLEGIYAVFDVENQRLGFAEGNEN 433
           LGD+F+  +Y+VF++E+  + FA  N N
Sbjct: 394 LGDIFMRHVYSVFNMEDMEVSFAVANGN 421

>KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON} 
          Length = 538

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 86/371 (23%), Positives = 150/371 (40%), Gaps = 50/371 (13%)

Query: 89  LQSDEHSQAYFVDVTIGDVAYPLI--IDTGSAYLWVYGDS---CNSSS----CKGRKLF- 138
           L+       Y +D+ IG     +   IDTGS+ LWV G +   CN S+       R+LF 
Sbjct: 83  LEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTVPSRELFN 142

Query: 139 ----------PTTNVLQDVASFSLAYT-SGVAVGDVYHDRIIVNELATTDNFTFGVASEV 187
                      ++    + + F + Y  +  A G    D + +N L  T   TF VA+  
Sbjct: 143 CSQYGTFNTNKSSTWSSNNSRFFIQYGDTTFASGTWGRDVMSINGLNVT-GLTFAVANA- 200

Query: 188 PDIFENYPASGIFGLPSDNSQSIENIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDV 247
                +  ++ + G+       +E   +   SS++ +   F +++ +     S      +
Sbjct: 201 -----SNSSNSVLGI---GLTQLETTYNGSNSSHSYTYANFPVVLKNAGLTESISYSLFL 252

Query: 248 QDLTSNKGIFAIGDELEGLYKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFT 307
            +L +  G    G      Y G +Y    +P  N+Y      N    ++ V        +
Sbjct: 253 NELDAESGSILFGAVDHSKYSGNLY---TLPLVNTYKDRGFPNPI--EFAVTLQGIGIVS 307

Query: 308 GSK----SHNTRSSIIDSGTTLLILPKQDALDIHTYFGNSITDGTN-FAIMC---NSTQT 359
           GSK    +    ++I+DSGT+L +LP      I +      +   + + + C   NST T
Sbjct: 308 GSKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNT 367

Query: 360 LTLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFD 419
             L FD   +TI           +D      C+  +  +D +++ ILGD FL   Y V+D
Sbjct: 368 -NLVFDFGGFTIKGTLSNFILEIEDDI----CILGLSSVD-ENSVILGDTFLASAYVVYD 421

Query: 420 VENQRLGFAEG 430
           +EN ++  A+ 
Sbjct: 422 LENLQISMAQA 432

>CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 482

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 53/123 (43%), Gaps = 12/123 (9%)

Query: 316 SSIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM--C---NSTQTLTLEFDNKNWT 370
           ++++D+G T  +LP + A  + +    +I D   F  +  C      +T+   F     +
Sbjct: 302 ATLLDTGVTTSVLPAKVAALVASKVNGTIDDDNGFIKLDKCPNKKEKRTVVFNFGGAEIS 361

Query: 371 IPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEG 430
           I       D         G C   +Q  D  +   LGD+FL  +Y V+++E++ +  A  
Sbjct: 362 I-------DIRDLTRKIKGKCYLQMQARDDIEFAALGDIFLRHVYVVYNLEDEEISIANA 414

Query: 431 NEN 433
           N N
Sbjct: 415 NFN 417

>KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {ON} 
          Length = 530

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 88/371 (23%), Positives = 153/371 (41%), Gaps = 58/371 (15%)

Query: 94  HSQAYF-VDVTIGDVA--YPLIIDTGSAYLWVYGDS---CNSSSCKGRKLFPTTNVL--Q 145
           + Q++F V++ +G  A    +++DTGS+ LW+ G     C + S  G    P  + +   
Sbjct: 61  NQQSFFSVELDVGTPAQNVTVLVDTGSSDLWITGADNPYCLTYSGSGADSIPRRDRVDCS 120

Query: 146 DVASFSLAYTSG-----------VAVGDVY-------HDRIIVNELATTDNFTFGVASEV 187
           +  +FSL  +S            +  GD          D + + ++  T   +F VA+  
Sbjct: 121 EYGTFSLEDSSTWSQNSSAPPFYITYGDTTFASGVWGQDHLHLQDVNVT-GVSFAVANRT 179

Query: 188 PDIFENYPASGIFGLPSDNSQS----IENIISKLRSSNAISMEKFSILIGHINAEVSEEE 243
                     G+ GL + NS S      N    L++S A     +S+ +  +     EEE
Sbjct: 180 NSTV-GVMGIGLPGLETTNSGSRPYTYANFPQVLKNSGATQSALYSLYLNDL-----EEE 233

Query: 244 DGDVQDLTSNKGIFAIGDELEGLYKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNY 303
            G +        +F   D  +  Y G +Y   +I    SY         +    +  ++ 
Sbjct: 234 RGSI--------LFGAVDHSK--YTGSMYTLPIINRLQSYGYTTPIQFDITLQGIGLSSS 283

Query: 304 ENFTGSKSHNTRS---SIIDSGTTLLILPKQDALDIHTYFGNSITDG-TNFAIMC-NSTQ 358
           E+  G +   T +   +++DSGTT+  LP      I    G S++     + + C N  +
Sbjct: 284 ES-NGDEVTITSTKMPALLDSGTTMTYLPSNIVSQIAQQLGASMSARFGQYVLPCSNVPE 342

Query: 359 TLTLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVF 418
            + L +D   + I S   L +   Q S     C+  +   D + A ILGD FL   Y V+
Sbjct: 343 NMHLVYDFGGFHINSN--LTNYIVQASQTL--CILGLFPRDSNTA-ILGDTFLTDAYVVY 397

Query: 419 DVENQRLGFAE 429
           D+EN ++G A+
Sbjct: 398 DLENLQIGLAQ 408

>CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7
          Length = 505

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 58/127 (45%), Gaps = 14/127 (11%)

Query: 317 SIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM--CNS---TQTLTLEFDNKNWTI 371
           ++ DSGT+   +P   A  I +    +I + T    +  C S   T+ +   F+     I
Sbjct: 298 ALFDSGTSYSYVPYTMAQVIASQVNGTIDNKTEAIRLPKCPSKKDTREVVFNFNGVEIAI 357

Query: 372 PSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDA--WILGDVFLEGIYAVFDVENQRLGFAE 429
           P +++    Y + S   G C  ++     ++    +LGD FL  +Y VFD+E Q L  A 
Sbjct: 358 PLKQF----YQKKS---GKCYLDLMVAPPNNGPGLLLGDTFLRQVYTVFDLEAQELSIAR 410

Query: 430 GNENALL 436
            N N+ L
Sbjct: 411 ANFNSSL 417

>Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 79/315 (25%), Positives = 115/315 (36%), Gaps = 70/315 (22%)

Query: 150 FSLAY-TSGVAVGDVYHDRIIVNELATTDNFTFGVASE-----------VPDIFENYPAS 197
           FS+ Y  S  A G   HDR+ +N L  T   +F VA+E           +P +   Y  S
Sbjct: 194 FSITYGDSTFASGTWGHDRLSLNNLNVT-GLSFAVANETNSTVGVLGIGLPGLESTY--S 250

Query: 198 GIFGLPSDNSQSIENIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIF 257
           G+    +  S +  N    L++S AI    +S+   H +               S  G  
Sbjct: 251 GVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSD---------------SKHGTI 295

Query: 258 AIGDELEGLYKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTG-SKSHNTRS 316
             G    G Y G++Y    IP         IN L    YK          G   SH  R 
Sbjct: 296 LFGAVDHGKYAGDLY---TIP--------IINTLQNRGYKDPIQFQVTLQGIGVSHGERD 344

Query: 317 S------------IIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM-C----NSTQT 359
                        ++DSGTT+  +P      I +  G + +    + IM C        +
Sbjct: 345 ENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESS 404

Query: 360 LTLEFDN---KNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYA 416
           L  +F      NW + + + L D  S        C+  I     D A ILGD FL   Y 
Sbjct: 405 LIFDFGGFYIANW-LSNFQLLTDSRSN------VCILGIAPQS-DPAIILGDNFLVSTYV 456

Query: 417 VFDVENQRLGFAEGN 431
           V+D++N  +  A  +
Sbjct: 457 VYDLDNMEISMAHAD 471

>Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C
           (REAL)
          Length = 227

 Score = 37.4 bits (85), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 49/115 (42%), Gaps = 7/115 (6%)

Query: 318 IIDSGTTLLILPKQDALDIHTYF-GNSITDGTNFAIMCNSTQTLTLEFDNKNWTIPSEKY 376
           + DSGT+   LP + A  I   F G   +D   +   C+      L  D   + I +   
Sbjct: 119 LFDSGTSTSALPTEIADAIGRSFDGKYSSDNQGYIFDCSKVNNTLLSIDFGGFNISANI- 177

Query: 377 LGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEGN 431
                S       +C+ NI+    D  ++LGD FL   Y VFD+E+  +  A+ +
Sbjct: 178 ---SNSVTPITKDHCLLNIEA--DDSGYVLGDAFLIDTYVVFDLESHEVSVAQAS 227

>YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}
           YPS6Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance
          Length = 537

 Score = 37.7 bits (86), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 75/331 (22%), Positives = 128/331 (38%), Gaps = 59/331 (17%)

Query: 121 WVYGDSCNSSSCKGRKLFPTTNVLQDVASFSLAYTSGVAVGDVYHDRIIVNELATTDNFT 180
           W   D+ NSS+ +    F           F+  Y  G      Y   ++  E  T ++FT
Sbjct: 142 WGTFDASNSSTFENNATF-----------FNNTYGDGTYYAGTYGTDVVSFENITLNDFT 190

Query: 181 FGVASEVPDIFENYPASGIFG--LP-SDNSQSIE-------------NIISKLRSSNAIS 224
           FGV++   D   N   SGI G  LP ++ +  IE             N   +L++   I+
Sbjct: 191 FGVSN---DTIGN--PSGILGISLPIAEFTDGIEYALALNRTPFIYDNFPMELKNQGKIN 245

Query: 225 MEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYKGEIYYNSLIPDKNSYW 284
              +S+ +   +A                 G    G   +  Y G++Y    +P   ++ 
Sbjct: 246 KIAYSLFLNGPDAHF---------------GSILFGAVDKSKYTGQLY---TLPMLQAFN 287

Query: 285 SLKIN-NLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLILPKQDALDIHTYF-GN 342
           +L  N  + +    V   + E+   + S      ++DSGTT   LP + A  I   F G 
Sbjct: 288 TLGSNPGMIITAQSVAILDSESGNKTVSDIQFPVMLDSGTTFSYLPTEIAEAIGKSFDGE 347

Query: 343 SITDGTNFAIMCNSTQTLTLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDD 402
             +D   +   C+      L  D   + I +        ++D      CV N++    + 
Sbjct: 348 YSSDDQGYIFDCSKVNDTLLSVDFGGFNISANISNFVTSAKDR-----CVLNVK--QSES 400

Query: 403 AWILGDVFLEGIYAVFDVENQRLGFAEGNEN 433
            ++LGD FL   Y V+D+EN  +  A+ + N
Sbjct: 401 TYMLGDAFLVDAYVVYDLENYEISIAQASFN 431

>KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.182
           YIL015W
          Length = 563

 Score = 37.7 bits (86), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 83/391 (21%), Positives = 151/391 (38%), Gaps = 83/391 (21%)

Query: 93  EHSQAYFVDVTIGDVAYPL--IIDTGSAYLWV---YGDSCNSSS----------CKGRKL 137
           E    Y   + IGD    +  I D+GSA  WV   Y   C SSS            G+ +
Sbjct: 52  EDESFYATTLKIGDPPQEITVIFDSGSADTWVMSRYNPFCLSSSNITANGLKTLYDGKAI 111

Query: 138 FPTTNVLQDVASFSLAYTSGVAVGD-----VYHDRIIVNELATTDNFTFGVASEVPDI-- 190
            P  +  Q     +   TS   + +     +Y D+   + +  T+ F FG   ++P++  
Sbjct: 112 IPKVDCSQIKTYNANRSTSFQELNNGRFYIIYGDKTFADGIWGTETFEFG-GVKIPNVQF 170

Query: 191 ----FENYPASGIFGLPSDNSQSIENIISKLRSSNAISMEKFSILIGHINAEVSEEEDGD 246
               +   P  G+ G+     +S++                     G+ NA   E    +
Sbjct: 171 GLADYATTPIGGVLGIGFQRRESVK---------------------GYTNAP--EVFYPN 207

Query: 247 VQDLTSNKGIF-AIGDELEGLYKGEIYYNSLIPDKNSYW----SLKINNLYVNDYKVNFT 301
              +  N+GI   +   L       I + ++  D+NSY     +  + N++ N      T
Sbjct: 208 FPQVLKNEGIIDTVAYSLSLGQSSHIMFGAI--DRNSYIGDMVTFPMINMFPNAVSKPAT 265

Query: 302 NYENFTGSKSHNTRS------------SIIDSGTTLLILPKQDALDIHTYFGN--SITDG 347
                 G  + N +             +++DSG+TL+  P + A  +  + G   S +DG
Sbjct: 266 LSITIQGLGAQNKQECKFQTFSTTKYPALLDSGSTLISAPVEIADKMAAFIGAQWSESDG 325

Query: 348 TNFAIMCNSTQT---LTLEFDNKNWTIP-SEKYLGDKYSQDSAYYGYCVSNIQGLDIDDA 403
             + + C +  T      +F +  +T+P S   L  +   +   +G   S       D+ 
Sbjct: 326 I-YTLECPNDTTNIDYIFDFGDMKFTLPLSNLILPSQGGSNVCGFGLQRS-------DNE 377

Query: 404 WILGDVFLEGIYAVFDVENQRLGFAEGNENA 434
            +LGDVFL     VFD+++ ++  A+ N+ +
Sbjct: 378 IVLGDVFLCSTLVVFDLDHYQISLAKSNQKS 408

>ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 531

 Score = 37.4 bits (85), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 57/118 (48%), Gaps = 9/118 (7%)

Query: 317 SIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM-CNSTQTLTLEFDNKNWTIPS-- 373
           +++DSGTTL+ LP +    +          G  + +  C+      L F+   + I S  
Sbjct: 334 ALLDSGTTLVYLPDKMLAMLAEQLNAHWDRGIGYYVTDCSRVDNTNLYFNFGGFNIVSNM 393

Query: 374 EKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEGN 431
             Y+  + +++S     CV  +Q     +A ILGD+F++  Y VFD+++  +  A+ N
Sbjct: 394 STYVVSRSNENS-----CVLGLQP-GGPEAAILGDMFMQHAYIVFDLDDFEISMAQAN 445

>NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 53/123 (43%), Gaps = 11/123 (8%)

Query: 313 NTRSSIIDSGTTLLILPKQDALDIHTYFGNSITDGTNF-AIMCN---STQTLTLEFDNKN 368
           N   +++DSGTT+   P++    I    G   +    F A+ CN   S+     +F   +
Sbjct: 370 NKFPALLDSGTTISYFPQEVVQTIARQLGARYSSALGFYAMSCNGVSSSTNFVFDFGGFH 429

Query: 369 WTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFA 428
            T P   +L    S ++          Q +      +LGD+FL   Y V+D++N  +  A
Sbjct: 430 ITGPVSDFLLPT-SGNTCVLAMAPQESQHI------LLGDIFLTHAYVVYDLDNYEISLA 482

Query: 429 EGN 431
           + N
Sbjct: 483 QAN 485

>KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 767

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 56/135 (41%), Gaps = 17/135 (12%)

Query: 304 ENFTGSKSHNTRSSIIDSGTTLLILPKQDALDIHTYFGNSITDGTN-FAIMCNS----TQ 358
           E FT +K     ++++DSGTTL+    +    I  Y   S + G   F   C S    TQ
Sbjct: 329 ETFTTTK----IAALMDSGTTLMYTAPEIVNKIALYVNASFSPGYGLFMFRCPSDGDDTQ 384

Query: 359 TLTLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVF 418
               +F       P   Y+     ++    G   SN QG       I GD FL   Y V+
Sbjct: 385 -FIFDFGGFQIKSPLSNYILRTDDENICGLGLISSN-QGT------IFGDEFLASAYVVY 436

Query: 419 DVENQRLGFAEGNEN 433
           D+EN  L  A+ N N
Sbjct: 437 DLENLELSLAQANWN 451

>AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL015W (BAR1)
          Length = 452

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 79/393 (20%), Positives = 153/393 (38%), Gaps = 81/393 (20%)

Query: 86  ISILQSDEHSQAYFVDVTIGDVAYPL--IIDTGSAYLWVYGDS---C------------- 127
           + +  +D+H   Y +++ +G     L  ++DTGSA LW+  ++   C             
Sbjct: 37  MPLHHNDDH---YDIEIEVGTPPQKLHAVLDTGSADLWLQAENNPFCVGAKDEKQEVRGV 93

Query: 128 ---NSSSCKGRKLF-----PTTNVLQDVASFSLAYTSGVAVGDVYHDRIIVNELATTDNF 179
               S  C+G K F      T  +L +   F + Y      G    DR+++     +   
Sbjct: 94  TVTPSIDCRGIKTFCNESSTTLRILPN--PFYIDYADTFVDGSWATDRLVIGGHDVS-GM 150

Query: 180 TFGVASEVPDIFENYPASGIFGLPSDNSQSIE-----------NIISKLRSSNAISMEKF 228
            FGV         N   SG+ G+   N +S+            N+  +L+   ++    +
Sbjct: 151 KFGVGRT-----SNTELSGVLGVGHANLESVRGYAGAPNATYPNLPRQLKLDGSVQKLAY 205

Query: 229 SILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYKGEIYYNSLI---PDKNSYWS 285
           S+ +     + + E DG++        +F   D  +  Y G+++   ++   P  NS   
Sbjct: 206 SVSL-----QKTSERDGEI--------LFGAIDTSK--YVGKLHTFPILNIDPHLNSP-- 248

Query: 286 LKINNLYVNDYKVNFTNYENFTGSKSHNTR-SSIIDSGTTLLILPKQDALDIHTYFGNSI 344
              +N Y+    ++     + TG    N+   +++D+GT  +++    A DI      + 
Sbjct: 249 ---SNFYIALQGIDIQGGRSSTGRPLINSSFHALLDTGTGGMVV-SSLAEDIGAALNATY 304

Query: 345 -TDGTNFAIMC---NSTQTLTLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDI 400
            T+   F I C   + T+     F      +P   ++      ++   G C   I     
Sbjct: 305 DTEQCVFVIQCPTEDDTRQFNFNFGELQIAVPISNFVVPASGLET---GQCALAIMP-GT 360

Query: 401 DDAWILGDVFLEGIYAVFDVENQRLGFAEGNEN 433
            + + LG  FL+ +Y VF++E+  +  A  N N
Sbjct: 361 SETFALGIPFLKEVYTVFNLEDNEISMARANTN 393

>Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144C
           (MKC7) - aspartyl protease related to Yap3p [contig 105]
           FULL
          Length = 651

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 96/250 (38%), Gaps = 40/250 (16%)

Query: 198 GIFGLPS------DNSQSIENIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDVQDLT 251
           G+ GL S      D      N    L+ +N IS   +S+ I  ++AE             
Sbjct: 214 GLTGLESSADPFDDEPSQYPNFPVVLKQNNVISKMAYSLYINSLDAEA------------ 261

Query: 252 SNKGIFAIGDELEGLYKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYEN-FTGSK 310
              G    G      Y G +Y   L+     Y+  +I    V    +   + +N F  + 
Sbjct: 262 ---GSVLFGAVDHSKYTGGLYTIPLVNALAQYFVDEILEFDVTVQGLGIESKKNCFQKTL 318

Query: 311 SHNTRSSIIDSGTTLLILPKQDALDIHTYFGNSITDGTN-FAIMC----NSTQTLTLEFD 365
           +     +++DSGTTL+ +    A  I    G +++D    +   C    + TQ L  +F 
Sbjct: 319 TTAQFPALMDSGTTLIYIDPDLADAIADSLGATMSDDYELYTFECPAKDDDTQ-LVFDFG 377

Query: 366 NKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAW--ILGDVFLEGIYAVFDVENQ 423
               T P   Y+ +   +           + GL +  ++  ILGD FL   Y VFD+EN 
Sbjct: 378 GFQITNPLSNYVLETDDE----------KVCGLGVVPSYSNILGDEFLASAYVVFDLENL 427

Query: 424 RLGFAEGNEN 433
            L   + N N
Sbjct: 428 ELSIGQANLN 437

>Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR039C
           (REAL)
          Length = 387

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 13/120 (10%)

Query: 318 IIDSGTTLLILPKQDALDIHTYF-GNSITDGTNFAIMC---NSTQTLTLEFDNKNWTIPS 373
           + DSGT+  +LP + A  I   F G   +D   +   C   N+TQ L+++F   N +   
Sbjct: 170 LFDSGTSTSVLPTEIADAIGRSFDGKYSSDDEGYIFDCSKVNNTQ-LSIDFGGFNISANI 228

Query: 374 EKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEGNEN 433
             ++    ++D     +CV  +Q L  D   +LGD FL   Y V+D+E+  +  A+ + N
Sbjct: 229 SNFV-TPLTKD-----HCV--LQILPSDTVSVLGDAFLVDTYVVYDLESHEVSVAQASFN 280

>SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some
           similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 592

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 59/126 (46%), Gaps = 15/126 (11%)

Query: 313 NTRSSI-IDSGTTLLILPKQDALDIHTYFGNSIT-DGTNFAIMCNSTQTLT-LEFDNKNW 369
            TRS + +DSG+T  + P + A  I    G S + D   + + C S    T   +D   +
Sbjct: 340 TTRSLVYLDSGSTGTVFPSEYAELIADSLGASYSGDYEAYVMKCPSKDDDTNFVYDFGGF 399

Query: 370 TI--PSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDA--WILGDVFLEGIYAVFDVENQRL 425
           TI  P   Y+ +    DS     CV +I   D DD    +LGD FL   Y V+D+E+  +
Sbjct: 400 TISSPLSNYM-EATGDDSV----CVLDI---DTDDIPYIVLGDAFLVSAYVVYDLEDYEI 451

Query: 426 GFAEGN 431
             A+ N
Sbjct: 452 SIAQAN 457

>TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa]
           {ON} Anc_7.182 YIL015W
          Length = 395

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 26/123 (21%), Positives = 56/123 (45%), Gaps = 9/123 (7%)

Query: 316 SSIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIMCNST-----QTLTLEFDNKNWT 370
           S ++DSGT+LL  P      I      +  + T+  ++ + T     + + + F   ++ 
Sbjct: 265 SVVLDSGTSLLSAPDHYVSKIAGLLNATFDNTTHMYLLPSETDLTLYKDMIINFKFMDFN 324

Query: 371 IPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEG 430
           +P           DS    Y  + +   +++  ++LGD+FL  +Y +F+++N  +     
Sbjct: 325 VPINMLEFILPYDDS----YVFAILPTKNVNTGFVLGDIFLPHVYTIFNLDNYTISLGLS 380

Query: 431 NEN 433
           N+N
Sbjct: 381 NQN 383

>ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]
           {ON} weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 521

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 76/363 (20%), Positives = 130/363 (35%), Gaps = 70/363 (19%)

Query: 111 LIIDTGSAYLWVYGDS---CNSSS--------------------CKGRKLFPTTNVLQ-- 145
           L++D+GSA  WV   +   C+S++                    C+G       +  Q  
Sbjct: 62  LVVDSGSADTWVMASTNPFCSSNAKSGASKNYTYNGKAITETIDCQGLTALDVNSSSQFR 121

Query: 146 --DVASFSLAYTSGVAVGDVYHDRIIVNELATTDNFTFGVAS----EVPDIFE-NYPAS- 197
             +V  F + YT G      +    +    A      FGVA     E+P I    +P   
Sbjct: 122 DLNVGRFYINYTDGSFDDGYWATDEVSAAGAHISGLQFGVAQYASEEIPGILGLGFPRRE 181

Query: 198 GIFGLPSDNSQSIENIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIF 257
            + G P   ++  +N    L+    I +  +S+ +   N               S  G  
Sbjct: 182 SVRGYPGAPNKFYDNFPQMLKKDGIIDVVAYSMYLNDPNG--------------SGGGSV 227

Query: 258 AIGDELEGLYKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSKSH---NT 314
             G      Y G++Y     P  N Y ++      +      F   +   G +     N 
Sbjct: 228 LFGGVDPSKYSGDLY---TFPMANQYPNIVSKPATLAVTLQGFGAQKKSEGRQETFDTNN 284

Query: 315 RSSIIDSGTTLLILPKQDALDIHTYFGN-----SITDGTNFAIMC---NSTQTLTLEFDN 366
            + ++DSGT+L+  P ++ +    +F N     S  DG  + + C   +       +F +
Sbjct: 285 YAVLLDSGTSLMGAP-EEVVSKMAHFINKNARFSEDDGI-YVMDCPPKDDDTEFVFDFGD 342

Query: 367 KNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLG 426
               +P    +     +      YC   +  L  D  W LGDVFL   Y VFD++N ++ 
Sbjct: 343 LQIAVPVSTLILPPSGES-----YCGLGV--LPKDGTWTLGDVFLSYAYLVFDLDNYKVS 395

Query: 427 FAE 429
            A+
Sbjct: 396 MAK 398

>YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}
           MKC7GPI-anchored aspartyl protease, member of the yapsin
           family of proteases involved in cell wall growth and
           maintenance; shares functions with Yap3p and Kex2p
          Length = 596

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 69/299 (23%), Positives = 113/299 (37%), Gaps = 38/299 (12%)

Query: 150 FSLAY-TSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDIFENYPASGIFGLPSDNSQ 208
           FS+AY  +  A G   HD++ +N+L  T   +F VA+E           G+ G+     +
Sbjct: 194 FSIAYGDTTFASGTWGHDQLSLNDLNIT-GLSFAVANETNSTV------GVLGIGLPGLE 246

Query: 209 SIENIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYK 268
           S  + +S      + +   F +++ +     S        D  S  G    G    G Y 
Sbjct: 247 STYSGVSLSSVQKSYTYNNFPMVLKNSGVIKSTAYSLFANDSDSKHGTILFGAVDHGKYA 306

Query: 269 GEIYYNSLIPDKNSYWSLKINNLYVNDYK------VNFTNYENFTGSKSHNTRS------ 316
           G++Y    IP         IN L    YK      V         G K  N  +      
Sbjct: 307 GDLY---TIP--------IINTLQHRGYKDPIQFQVTLQGLGTSKGDKEDNLTTLTTTKI 355

Query: 317 -SIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM-C--NSTQTLTLEFDNKNWTIP 372
             ++DSGTT+  +P +    +    G + +    + IM C     +  ++ FD   + + 
Sbjct: 356 PVLLDSGTTISYMPTELVKMLADQVGATYSSAYGYYIMDCIKEMEEESSIIFDFGGFYL- 414

Query: 373 SEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEGN 431
              +L D      +    C+  I     D   ILGD FL   Y V+D++N  +  A+ N
Sbjct: 415 -SNWLSDFQLVTDSRSNICILGI-APQSDPTIILGDNFLANTYVVYDLDNMEISMAQAN 471

>KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {ON} 
          Length = 540

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 75/180 (41%), Gaps = 17/180 (9%)

Query: 260 GDELEGLYKGEIYYNSL--IPDKNSYWSLKINN---LYVNDYKVNFTNYENFTGSKSHNT 314
           G  L G      Y N L  +P  N+Y    + +    YV  Y + F   + F  + +   
Sbjct: 269 GSVLFGAVDHSKYENGLFTVPMVNTYKDQGVQHPIEFYVTMYGLGFKK-DGFLNTITTTN 327

Query: 315 RSSIIDSGTTLLILPKQDALDIHTYFGNSITDGTN-FAIMCNSTQTLT-LEFDNKNWTI- 371
              ++DSG+T   LP      + +    + ++  N + + C S +  T L FD   + I 
Sbjct: 328 FPVLLDSGSTTSYLPDTLVSMLASALNATFSEKINGYTLKCPSEEDATFLSFDLGGFLID 387

Query: 372 -PSEKYLGDKYSQDSAYYGYCVSNIQGL-DIDDAWILGDVFLEGIYAVFDVENQRLGFAE 429
            P    +  ++         CV  ++G  + +  +ILGD FL   Y V+D+E+  +   +
Sbjct: 388 VPLSDLVAKRHKNQ------CVLMVKGQGEGEGGYILGDTFLSSAYVVYDLESYEISIGQ 441

>TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.318
           YLR120C
          Length = 600

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 90/399 (22%), Positives = 156/399 (39%), Gaps = 83/399 (20%)

Query: 83  KPGISILQSDEH--------SQAYFVDVTIGDVA--YPLIIDTGSAYLWVYG-------- 124
           KP + I++ D +        S  Y + ++IG  A    ++IDTGS+ LWV G        
Sbjct: 65  KPKLDIVKRDGYEEIELKNESSFYSIKLSIGTPAQNVTVLIDTGSSDLWVTGSDNPLCSS 124

Query: 125 --------DSCNSSS--CKGRKLFP---TTNVLQDVASFSLAYTSG-VAVGDVYHDRIIV 170
                   D  + SS  C     F    +++   +  SF++ Y  G  A+G+   D + +
Sbjct: 125 DDATFTGSDGSSQSSIDCSLYGTFDIDDSSSFTSNDTSFAITYGDGSYALGNWGQDVLSL 184

Query: 171 NELATTDNFTFGVAS-----------EVPDIFENYPASGIFGLPSDNSQSIENIISKLRS 219
            ++  T   +F VA+            +P +   Y  S    L   N    +N+   LR+
Sbjct: 185 QDIDVT-GLSFAVANYTNSTVGVLGIGLPSLEATYSGS----LAGSNPYQYDNLPLVLRN 239

Query: 220 SNAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYKGEIYYNSLIPD 279
           S A+    +S+ +         +ED       S++G    G      Y+G +   + +P 
Sbjct: 240 SGAVKSYAYSLFL--------NDED-------SSEGSILFGGVDHSKYEGTL---NTLPL 281

Query: 280 KNSYWSLKINNLYVNDYKVNFTNYENFTGSK----SHNTRSSIIDSGTTLLILPKQDALD 335
            N   S    + Y  ++ +        T SK    S     +++DSGTTL  LP      
Sbjct: 282 VNYQKSSGFQSPY--EFDITLQGLGISTSSKNTTVSDTQIVALLDSGTTLTYLPVTLTSL 339

Query: 336 IHTYFGNSITDGTNFAIM-CNSTQ---TLTLEFDNKNWTIPSEKYLGDKYSQDSAYYGYC 391
           +      S +    +  M C S+     +  +F   +  +P   ++       ++    C
Sbjct: 340 LAAELNASYSARLGYYTMSCPSSSDSTEIVFDFGGFHINVPLTSFIV------TSSMNVC 393

Query: 392 VSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEG 430
           +  I     D A ILGD FL+  Y V+D+EN  +  A+ 
Sbjct: 394 ILGIIPRSGDQA-ILGDSFLQHAYVVYDLENLEISLAQA 431

>CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa]
           {ON} similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 601

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 52/119 (43%), Gaps = 11/119 (9%)

Query: 317 SIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIMCNSTQT----LTLEFDNKNWTIP 372
           +++DSGTTL  LP+     I      + ++   + +    +Q+    +  +F   +   P
Sbjct: 375 ALLDSGTTLTYLPQALVTRIVQKLQATYSNRAGYYVFSCPSQSDDTEVVFDFGGFHINAP 434

Query: 373 SEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEGN 431
              ++    S DS   G    +  G+      ILGD FL   Y V+D+EN  +  A+ N
Sbjct: 435 ITNFIIGS-SGDSCILGIMPQSGGGI------ILGDSFLNSAYVVYDLENYEISMAQAN 486

>KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.319
           YLR121C
          Length = 521

 Score = 34.3 bits (77), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 53/123 (43%), Gaps = 11/123 (8%)

Query: 316 SSIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM-C----NSTQTLTLEFDNKNWT 370
           ++++DSGTTL  LP+     I    G   +    + I+ C    NS  TL  +F   +  
Sbjct: 301 AALLDSGTTLTYLPQALVQVIADSIGARWSSRYGYYIVSCRAVENSDTTLVFDFGGFHIN 360

Query: 371 IPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEG 430
                ++ + +         C+  I      ++ ILGD FL   Y VFD+EN  +  A+ 
Sbjct: 361 GKLTDFIVETFGN------VCLLTIIEETGSNSAILGDNFLINAYVVFDLENNEISMAQA 414

Query: 431 NEN 433
             N
Sbjct: 415 LHN 417

>Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score = 33.9 bits (76), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 109/463 (23%), Positives = 163/463 (35%), Gaps = 129/463 (27%)

Query: 62  QHYKDTAVSNSSNETFAKIQVKPG--ISILQSDEHSQAYFVDVTIGDVAYPL--IIDTGS 117
           + Y D+  + SSN+      VK G    ++     +  Y VD+ IG  +  +  ++DTGS
Sbjct: 43  KKYGDSFENASSNKKTEARLVKRGDDYEVVDLSNQNSFYSVDLDIGTPSQKVTVLVDTGS 102

Query: 118 AYLWVYGDS---CN------SSSCKGRK-----LFPTTNVLQDVAS-------------- 149
           + LWV G +   C+      SSS K RK     L    +V+Q VAS              
Sbjct: 103 SDLWVTGSNNPYCSTKSGHTSSSSKERKDEDNILSLVQSVVQSVASEISYDTTITDTDAT 162

Query: 150 -----------------------------------FSLAYTS-GVAVGDVYHDRIIVNEL 173
                                              FS+ Y     A G   HD++ +N L
Sbjct: 163 ATQDSTSSALQTIDCTTYGVFDSSKSSTFQSNKTDFSITYGDLTFASGTWGHDQLNLNNL 222

Query: 174 ATTDNFTFGVASEVPDIFENYPASGIFGLPS----------DNSQSIENIISKLRSSNAI 223
             T   +F VA+E           G+ GL S            S +  N    L++S AI
Sbjct: 223 NVT-GLSFAVANETNSTV-GVLGIGLAGLESTYSGATLSSAQESYTYNNFPMVLKNSGAI 280

Query: 224 SMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYKGEIYYNSLIPDKNSY 283
               +S+ +   NA+                G    G    G Y G++Y    IP     
Sbjct: 281 KSAAYSLFLNETNAK---------------HGSILFGAVDHGKYSGDLY---TIP----- 317

Query: 284 WSLKINNLYVNDYK--VNFTNYENFTGSKSHNTRSSII---------DSGTTLLILPKQD 332
               IN L  + YK  + F       G    ++ S+ I         DSGTT+  +P + 
Sbjct: 318 ---IINTLQDHGYKDPIQFQVTLQGLGLAKGDSESTTITTTKIPALLDSGTTISYMPVEL 374

Query: 333 ALDIHTYFGNSITDGTNFAIMCNSTQTLT---LEFDNKNWTIP---SEKYLGDKYSQDSA 386
              +    G S +    + +M   T T     + FD   + I    S   L    S D  
Sbjct: 375 MEMLADKLGASYSSKVGYYLMDCITDTDDDINVVFDFGGFYISGNLSSYQLSADSSSDVC 434

Query: 387 YYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAE 429
             G+   +      D   ILGD FL   Y V+D++N  +  A+
Sbjct: 435 ILGFAPQS------DSTVILGDNFLSNAYVVYDLDNMEISMAQ 471

>CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 516

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 21/35 (60%)

Query: 402 DAWILGDVFLEGIYAVFDVENQRLGFAEGNENALL 436
           D  ILGD F+  +Y VFD+E   +  A+ N N+ L
Sbjct: 385 DLVILGDNFMRSVYTVFDLEANEVSIAQANFNSSL 419

>CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 591

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 55/126 (43%), Gaps = 20/126 (15%)

Query: 317 SIIDSGTTLLILPKQDALDIHTYFGNS----ITDGTNFAIM--C---NSTQTLTLEFDNK 367
           +++DSGTT+  LP    +D+H+         +   T F  +  C   N    L   F   
Sbjct: 366 ALLDSGTTVSYLP----IDLHSLVAKQLKGIVDPQTGFIELKNCPAKNDNTQLVFNFGGA 421

Query: 368 NWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGF 427
             +I   +++ +K   D+ Y  +      G+      +LGD FL   Y V+D+E+  +  
Sbjct: 422 FISIKYTEFI-EKSDDDNCYVTFMPQGEPGI------LLGDNFLRNAYIVYDLEDMEISI 474

Query: 428 AEGNEN 433
           A+ N N
Sbjct: 475 AQANFN 480

>TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 51/118 (43%), Gaps = 11/118 (9%)

Query: 317 SIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM-CNS---TQTLTLEFDNKNWTIP 372
           +++DSGTT+  LP      + +  G S  +     ++ C S    +    +F     ++P
Sbjct: 364 ALLDSGTTMTYLPDALVATVASTLGASFDEAQGLYLLDCPSGSDDREFNFDFGGFQISVP 423

Query: 373 SEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEG 430
              ++ +      A    CV  +     + A ILGD FL   Y V+D+EN  +  A+ 
Sbjct: 424 LSNFILE------ALPDVCVLTLFESHAERA-ILGDSFLTEAYVVYDLENLEISMAQA 474

>Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON}
           (70588..72576) [1989 nt, 663 aa]
          Length = 662

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 44/90 (48%), Gaps = 11/90 (12%)

Query: 98  YFVDVTIGDVAY--PLIIDTGSAYLWV--YGDSC--NSSSCKGRKLFPTTNVLQDVASFS 151
           YF++ T+G+      L +D    YLW+   G  C  +S++C  R ++  ++     ++ S
Sbjct: 52  YFLNATLGNPEQFQRLRLDIAQPYLWIPNIGSKCPDSSTTCNERTVYDPSS-----SNTS 106

Query: 152 LAYTSGVAVGDVYHDRIIVNELATTDNFTF 181
           + Y SG      + D +  N  A TD F+F
Sbjct: 107 IPYRSGHVFDFEFIDALFANGSAYTDRFSF 136

>Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON}
           YDR144C (REAL)
          Length = 590

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 78/313 (24%), Positives = 116/313 (37%), Gaps = 66/313 (21%)

Query: 150 FSLAY-TSGVAVGDVYHDRIIVNELATTDNFTFGVASE-----------VPDIFENYPAS 197
           FS+ Y  S  A G   HD++ +N L  T   +F VA+E           +P +   Y  S
Sbjct: 194 FSITYGDSTFASGTWGHDQLNLNNLNVT-GLSFAVANETNSTVGVLGIGLPGLESTY--S 250

Query: 198 GIFGLPSDNSQSIENIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIF 257
           G+       S +  N    L++S AI    +S+     N+E                G  
Sbjct: 251 GVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSE---------------HGTI 295

Query: 258 AIGDELEGLYKGEIYYNSLIPDKNSYWSLKINNLYVNDYK------VNFTNYENFTGSKS 311
             G    G Y G++Y    IP         IN L  N YK      V        TG   
Sbjct: 296 LFGAVDHGKYTGDLY---TIP--------IINILQNNGYKDPIQFHVTLQGIAVATGDGM 344

Query: 312 HNTRS-------SIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM-C--NSTQTLT 361
            N  +       +++DSGTT+  LP +    +    G S +    + +M C     + +T
Sbjct: 345 DNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDIT 404

Query: 362 LEFDNKNWTIPS---EKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVF 418
           + FD   + I S      L    S D    G+   +      D   ILGD FL   Y V+
Sbjct: 405 VVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQS------DPTVILGDNFLVSTYIVY 458

Query: 419 DVENQRLGFAEGN 431
           D++N  +  A  +
Sbjct: 459 DLDNMEISMANAD 471

>CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 56/131 (42%), Gaps = 29/131 (22%)

Query: 317 SIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM--CNSTQ---TLTLEFDNKNWTI 371
           +++D+GTT   +P   A  +       I   T+   +  C S +   T+   F      I
Sbjct: 304 ALLDTGTTYTYMPSSVAQYLANQTNGVIDKKTSLIKLAKCPSKKSNDTIVFNFSGAQIKI 363

Query: 372 PS----EKYLGDKY----SQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQ 423
                 EK+ G  Y    SQ+S+++                +LGD F+  +Y VFD++++
Sbjct: 364 KMVDFVEKHKGKCYLPCVSQESSFF----------------LLGDSFMRHVYTVFDLDDK 407

Query: 424 RLGFAEGNENA 434
            +  A+ N N+
Sbjct: 408 EISIAQANFNS 418

>CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 23/36 (63%)

Query: 401 DDAWILGDVFLEGIYAVFDVENQRLGFAEGNENALL 436
           +DA I GD FL  +Y V+++E++ +  A  N N+ L
Sbjct: 388 NDAIIFGDNFLRSVYLVYNLEDKEISIAPANFNSSL 423

>Suva_11.25 Chr11 complement(54969..58109) [3141 bp, 1046 aa] {ON}
           YKL197C (REAL)
          Length = 1046

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 51/121 (42%), Gaps = 21/121 (17%)

Query: 264 EGLYKGEIYYNSLI---PDKNSYWSLKINNLYVNDYKVNFTNYEN---FTGSKSHNTRSS 317
           E L    I   SL+   P  N   S+K      N+Y  N  N  N   F   K    RS+
Sbjct: 167 EALTSARITDGSLVVVAPKVNKERSMK------NEYHPNIDNNPNSDAFRPLKRKILRST 220

Query: 318 IIDSGTT---LLILPKQDALDIHTYFGNSITDGTNFAIMCNSTQTLTLEFDNKNWTIPSE 374
           I D+G T   L ++   D +++      S T G    + CNS Q+   E DNK   +P +
Sbjct: 221 IRDNGLTEKDLFVVYVDDEIEL------SSTKGYVSIVQCNSRQSKKNEVDNKVVGVPPK 274

Query: 375 K 375
           K
Sbjct: 275 K 275

>SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 556

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 19/28 (67%)

Query: 404 WILGDVFLEGIYAVFDVENQRLGFAEGN 431
           +ILGDVFL   Y V+D++N  +  A+ N
Sbjct: 446 FILGDVFLTSAYVVYDLDNFEISLAQAN 473

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 43/86 (50%), Gaps = 12/86 (13%)

Query: 56  GSSY--TPQHYKDTAVSNSSNETFAKIQVKPGISILQSDEHSQAYFVDVTIGDVAYPLII 113
           GS+Y  + +H K  AV +  ++ F +I++K  +S    +        +VT+       ++
Sbjct: 38  GSTYEESSKHNKPYAVLSKRDDGFQEIELKNQVSFFSVELEIGTPRQNVTV-------LV 90

Query: 114 DTGSAYLWVYGDS---CNSSSCKGRK 136
           DTGS+ LWV G +   C + S   R+
Sbjct: 91  DTGSSDLWVTGSNNPYCRAGSVGNRR 116

>KAFR0D04990 Chr4 (981180..982868) [1689 bp, 562 aa] {ON} Anc_5.419
           YHR109W
          Length = 562

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 284 WSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLILPKQDALDIHT 338
           W LK + +++ND  V  T   N  GS       + ID+ T LL +P Q A++IHT
Sbjct: 7   WVLKNSKIFLNDNVV--TGKSNLGGSGLFIRGDTTIDADTILLRIPPQCAINIHT 59

>ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 528

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 58/121 (47%), Gaps = 11/121 (9%)

Query: 318 IIDSGTTLLILPKQDALDIHT-YFGNSITDGTNFAIMC-NSTQTLTLEFDNKNWTIPSE- 374
           ++DSGTT + LP + A  I + Y G    +   + I C  S     + FD    TI ++ 
Sbjct: 377 VLDSGTTAMYLPYKLAKSIASRYHGILGPEDQGYIIDCPKSGDNDYITFDFGGVTIKTDI 436

Query: 375 -KYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEGNEN 433
             Y+ ++ S++    G   ++      D   + GDVFL   Y V+D+E + +  A+ + N
Sbjct: 437 RNYIFEQ-SENKCLLGIIPNS------DILAVFGDVFLTDAYVVYDLEGKEISLAQASFN 489

Query: 434 A 434
           +
Sbjct: 490 S 490

>ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 54/126 (42%), Gaps = 25/126 (19%)

Query: 317 SIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM-CNSTQTLT----------LEFD 365
           +++DSG+TL  LP+     +    G   ++  N+ +M C S    T          +E +
Sbjct: 382 ALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETN 441

Query: 366 NKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRL 425
              +T P         S D+     CV  I     D + ILGD FL   Y V+D+E+  +
Sbjct: 442 LTTYTTP--------ISSDT-----CVLRILPSG-DSSAILGDAFLVHAYVVYDLEDFEI 487

Query: 426 GFAEGN 431
             A+ N
Sbjct: 488 SMAQAN 493

>KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 20/29 (68%)

Query: 406 LGDVFLEGIYAVFDVENQRLGFAEGNENA 434
           LGD+FL   Y V+D++N+ +  A+ N NA
Sbjct: 388 LGDLFLTHAYVVYDLDNKEISMAQINYNA 416

>TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {ON} 
          Length = 689

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 56/119 (47%), Gaps = 7/119 (5%)

Query: 317 SIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM-C-NSTQTLTLEFDNKNWTIPSE 374
           +++DSGTTL   PK     +      S ++   + +M C +S     L FD   + I + 
Sbjct: 466 ALLDSGTTLTYFPKDMLNLLAKRINASYSEALGYYVMNCPDSRDNTQLVFDFGGFHIKTN 525

Query: 375 KYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEGNEN 433
                 +   SA  G CV  +   + + A ILGD+FL   Y V+++++  +  A+ N N
Sbjct: 526 L---TNFVLSSAS-GKCVLGLLPYNGNSA-ILGDIFLTHAYVVYNLDDLEISMAQANFN 579

>Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {ON}
           YLR120C (REAL)
          Length = 572

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 114/300 (38%), Gaps = 42/300 (14%)

Query: 150 FSLAYTSGV-AVGDVYHDRIIVNELATTDNFTFGVASEVPDIFENYPASGIFGLPSDNSQ 208
           FS++Y  G  A G    D + +++L  T   +F VA+E           G+ G+     +
Sbjct: 210 FSISYGDGTFASGTFGTDVLDLSDLNVT-GLSFAVANETNSTM------GVLGIGLPELE 262

Query: 209 SIENIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYK 268
              +  +  R       + F I++ +  A  +      + D  +  G    G      Y 
Sbjct: 263 VTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYT 322

Query: 269 GEIYYNSLIPDKNSY----------WSLKINNLYVNDYKVNFTNYENFTGSKSHNTRS-- 316
           G +Y    IP  N+           + + IN + V+D K          G K+  T    
Sbjct: 323 GTLY---TIPIVNTLSASGFSSPIQFDVTINGIGVSDSK---------NGEKTLTTTKIP 370

Query: 317 SIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM-CNSTQTLTLEFDNKNWTIPSE- 374
           +++DSGTTL  LP+     I    G   +    + ++ C S  +  + FD   + I +  
Sbjct: 371 ALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSDDSTQIVFDFGGFHINASL 430

Query: 375 -KYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEGNEN 433
             ++    S        C+  I     +   ILGD FL   Y V+D++N  +  A+   N
Sbjct: 431 SSFILSTGST-------CLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYN 483

>Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {ON}
           YLR120C (REAL)
          Length = 569

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 56/128 (43%), Gaps = 27/128 (21%)

Query: 317 SIIDSGTTLLILPK------QDALDIH--TYFGNSITDGTNFAIMCNSTQTLTLEFDNKN 368
           +++DSGTTL  LP+       D LD    +  G  + D  + +   NSTQ   + FD   
Sbjct: 368 ALLDSGTTLTYLPQAVVAMIADELDAQYSSRLGYYVLDCPSNS---NSTQ---IVFD--- 418

Query: 369 WTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDI---DDAWILGDVFLEGIYAVFDVENQRL 425
                  + G   +   + +     NI  L I   DD  ILGD FL   Y V+D++N  +
Sbjct: 419 -------FGGFHINASLSSFILNAGNICLLGIIATDDTTILGDSFLTNAYVVYDLDNLEI 471

Query: 426 GFAEGNEN 433
             A+   N
Sbjct: 472 SMAQAQYN 479

>Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {ON}
           YLR120C (YPS1) - GPI-anchored aspartic protease [contig
           171] FULL
          Length = 629

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 5/65 (7%)

Query: 79  KIQVKPGISILQSDEHSQAYFVDVTIGDVA--YPLIIDTGSAYLWVYGDS---CNSSSCK 133
           +++   G +  + D     Y V + +G  A    L+IDTGS+ +WV G +   C  SS K
Sbjct: 60  RVKRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGK 119

Query: 134 GRKLF 138
            + + 
Sbjct: 120 SKHVL 124

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 405 ILGDVFLEGIYAVFDVENQRLGFAEGN 431
           ILGD FL   Y V+D+EN  +  A+ N
Sbjct: 466 ILGDNFLTAAYVVYDLENLEISMAQAN 492

>Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C
           (YPS1) - GPI-anchored aspartic protease [contig 47] FULL
          Length = 570

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 405 ILGDVFLEGIYAVFDVENQRLGFAEGN 431
           ILGD FL   Y V+D+EN  +  A+ N
Sbjct: 443 ILGDNFLTAAYVVYDLENLEVSMAQAN 469

>TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {ON}
           Anc_8.318 YLR120C
          Length = 596

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 51/117 (43%), Gaps = 9/117 (7%)

Query: 318 IIDSGTTLLILPKQDALDIHTYFGNSITDGTN-FAIMC---NSTQTLTLEFDNKNWTIPS 373
           ++DSGTT++ LP+     I  +      +  + + I C   N     +  FD   + I +
Sbjct: 380 LLDSGTTMVYLPRSIVEQIMRHEEAQYVEELDLYQIKCPSPNKKNQTSFSFDFGGFQIKA 439

Query: 374 EKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEG 430
              L D         G C+  +   D++   ILGD FL   Y V+D+E+  +  A+ 
Sbjct: 440 S--LSDFIVPTDN--GQCIFGMIPQDMN-VGILGDSFLTHAYVVYDLEDYEISMAQA 491

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,242,358
Number of extensions: 2464486
Number of successful extensions: 7988
Number of sequences better than 10.0: 148
Number of HSP's gapped: 8160
Number of HSP's successfully gapped: 160
Length of query: 506
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 392
Effective length of database: 40,409,475
Effective search space: 15840514200
Effective search space used: 15840514200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)