Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0D01386g8.843ON52152125730.0
Kwal_27.102458.843ON51549817110.0
KLTH0C03806g8.843ON52550816410.0
YML116W (ATR1)8.843ON54251316360.0
Skud_13.258.843ON53752216180.0
CAGL0B02343g8.843ON53752115990.0
Suva_13.278.843ON55351515990.0
Smik_13.188.843ON54552515840.0
NDAI0E002808.843ON54951515500.0
NCAS0B002908.843ON54253215220.0
KNAG0J002608.843ON55050615190.0
KAFR0B03930singletonON55552415060.0
KNAG0G034308.843ON54251015040.0
Suva_13.4678.843ON54351314880.0
TDEL0B005508.843ON53751514790.0
NCAS0A02540singletonON53951614740.0
CAGL0M03003g8.843ON55851514720.0
Kpol_541.168.843ON52851914680.0
YMR279C8.843ON54050814630.0
NCAS0C004008.843ON51750914320.0
Skud_13.4518.843ON53951914260.0
Smik_13.4928.843ON54351314110.0
NDAI0K004008.843ON55351714000.0
TPHA0C047908.843ON55651513760.0
TBLA0D032708.843ON55048813690.0
KAFR0A028408.843ON52046513331e-180
TBLA0D03280singletonON58051613291e-178
KAFR0B039408.843ON54749113251e-178
TBLA0C01160singletonON60048210811e-141
Skud_15.545na 1ON5165138681e-110
YOR378Wna 1ON5155228341e-105
Smik_15.560na 1ON5164758301e-104
Suva_8.435na 1ON5155058251e-104
KLTH0C10560gna 1ON5155208031e-100
Kwal_23.6547na 1ON5115058011e-100
KLLA0B00352gna 1ON4984887551e-93
TDEL0G04950singletonON5124917474e-92
SAKL0C06116gsingletonON1851895504e-67
KNAG0D00130na 1ON5655425166e-58
KAFR0C04860na 1ON5345364543e-49
NCAS0A05720na 1ON5635213879e-40
NDAI0K02730singletonON6045593852e-39
CAGL0L02519gna 1ON5294793664e-37
Kpol_1039.192.242ON5732361242e-06
KLLA0C18931gna 2ON5531641189e-06
Skud_13.2442.473ON5621031108e-05
Smik_16.81na 3ON6252241091e-04
YMR088C (VBA1)2.473ON5621031063e-04
TDEL0D06610singletonON497871063e-04
Kwal_34.15746na 2ON5182091045e-04
Smik_13.2722.473ON5611291045e-04
Suva_10.11singletonON5401631045e-04
Suva_13.2652.473ON5611211036e-04
TDEL0D038003.245ON6402051036e-04
Skud_6.16na 4ON5491631028e-04
KLLA0E09879gsingletonON6302191028e-04
SAKL0D04070g3.245ON6672091029e-04
NCAS0A078102.473ON568981010.001
YNL065W (AQR1)2.242ON5862261010.001
SAKL0C02178gsingletonON5651101010.001
ZYRO0G03234g2.473ON5621331000.001
NDAI0H022002.473ON5711431000.002
KLLA0F13684g2.473ON571981000.002
Smik_6.24na 4ON544163990.002
SAKL0E02992g2.473ON57098990.002
NDAI0D010202.242ON592166980.002
Skud_14.2672.242ON562226970.003
SAKL0D04510gna 5ON531145960.004
Kpol_467.242.473ON370129940.006
Kwal_26.7984na 6ON612230950.007
CAGL0J01375g2.473ON56484940.007
NCAS0C03460na 3ON630144940.007
KLTH0G09372g2.242ON551167930.009
KLLA0E24113g8.570ON575176930.009
ABL040W2.473ON567141930.010
Kwal_56.237548.272ON589473930.010
TBLA0A103505.284ON521241920.011
SAKL0E08756g2.242ON565137920.012
YGR224W (AZR1)na 3ON613144920.012
SAKL0A08228gsingletonON569145920.012
TDEL0F039908.272ON631106920.014
Smik_14.2622.242ON561165910.015
Kwal_23.48242.242ON553162910.016
CAGL0J00363g5.284ON498234910.018
KLTH0C10142gsingletonON573131910.020
KLTH0H16214gsingletonON551109900.023
KLLA0A04631g8.272ON579121900.025
Ecym_73992.473ON56398900.026
KNAG0I019102.242ON598248890.028
TDEL0A024902.473ON55479890.029
SAKL0A00726gsingletonON598208890.030
SAKL0E04246gna 7ON56587890.034
TPHA0F012902.242ON562249880.037
TDEL0G03260singletonON612130880.038
Skud_8.1075.284ON522242880.039
ACL172C3.245ON631208880.040
NCAS0G029902.242ON581167880.041
NCAS0A065805.284ON528127880.042
ZYRO0G21890gsingletonON57682880.043
KLLA0F17776gna 7ON553130870.053
ZYRO0C01430g8.272ON590108870.057
KNAG0K01020singletonON599161870.060
Skud_7.560na 3ON642144860.064
ZYRO0G21868gna 8ON620155860.071
KLTH0D16962gsingletonON571147860.071
SAKL0F00440gsingletonON544116860.076
AGR076C8.272ON686287860.079
KNAG0B049005.284ON516189850.083
SAKL0H09328g8.570ON596252850.087
Kpol_543.448.272ON64348850.094
TBLA0G025502.242ON613138850.099
KLTH0C10120gsingletonON651132850.11
Skud_9.482.241ON599245840.11
TBLA0C01100na 9ON64995840.11
KAFR0J004805.284ON500249840.11
KNAG0A035408.570ON538251840.13
KLLA0F03311g2.242ON542227830.14
CAGL0B02079gna 3ON624149830.17
SAKL0C05588gsingletonON677142820.20
Smik_8.1175.284ON514236820.22
SAKL0H16808g8.272ON65748810.25
KNAG0E025602.473ON57883810.25
YPR198W (SGE1)singletonON543131810.28
KAFR0J009302.242ON566234810.31
YHR048W (YHK8)5.284ON514232810.31
Skud_3.172na 10ON521167800.32
Suva_8.3588.783ON522202790.44
YCR098C (GIT1)na 10ON518164790.45
CAGL0G08624g2.242ON583247790.45
ZYRO0F06314g8.631ON43168790.50
KLTH0C00462gna 11ON570199790.53
KLLA0B06798g3.245ON663205790.57
TPHA0B037705.284ON520131770.74
Skud_16.503singletonON543132770.75
ZYRO0G16302g5.284ON547244770.84
Smik_4.467.309ON881111770.87
TBLA0B00840singletonON637102770.89
Skud_2.1553.245ON688205770.94
Kwal_56.229493.245ON642167761.00
ADL258W2.242ON534188761.2
NDAI0D016805.284ON516127751.6
YDL194W (SNF3)7.309ON884111751.6
KLTH0B00594gsingletonON618130751.7
TPHA0A017508.272ON636148741.8
KAFR0G011107.437ON21481721.9
KAFR0J016202.242ON570228732.3
KLTH0D06710gna 6ON611217732.4
Ecym_6024na 5ON48983732.4
ZYRO0E10230gsingletonON558189732.5
Kpol_534.276.155ON502388732.6
Suva_14.4na 10ON518162732.7
KLTH0G13464g8.272ON593405732.8
TBLA0A03500singletonON57399723.2
SAKL0F12848g7.408ON1115136723.3
Kwal_26.6697singletonON577496723.6
TBLA0A01270singletonON522142723.6
ZYRO0A00330gsingletonON576221713.9
Kpol_461.153.53ON517226713.9
TDEL0D06570singletonON566232714.0
SAKL0G10758g5.284ON533129714.1
Suva_15.2365.284ON514236714.1
TDEL0C045902.242ON529254714.4
TBLA0B046406.155ON482138714.7
KAFR0B055508.261ON555130714.7
TBLA0B044808.570ON608253714.7
TBLA0F030408.272ON90666714.7
KAFR0D00790singletonON561209714.8
Smik_3.200na 10ON518140705.0
Smik_17.11singletonON544126705.7
KLLA0F08525g8.783ON493135706.0
KAFR0G00160singletonON636222706.6
Suva_4.4318.570ON572174696.7
Kpol_463.61.273ON65750706.7
TBLA0A03470singletonON578100696.8
Kpol_1051.155.284ON501134696.8
Kwal_14.728singletonON568212697.0
ZYRO0A03564g3.245ON684214697.0
AER339C8.723ON573239697.3
NDAI0D05010singletonON574198697.9
Kwal_26.9616singletonON562183698.5
TBLA0A03460singletonON568102698.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0D01386g
         (521 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   995   0.0  
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   663   0.0  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   636   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   634   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   627   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   620   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   620   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   614   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      601   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      590   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   589   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   584   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   583   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   577   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   574   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   572   0.0  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   571   0.0  
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   570   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   568   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      556   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   553   0.0  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   548   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               543   0.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   534   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   531   0.0  
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   518   e-180
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   516   e-178
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   514   e-178
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   421   e-141
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   338   e-110
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   325   e-105
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   324   e-104
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   322   e-104
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   313   e-100
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   313   e-100
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   295   1e-93
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   292   4e-92
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   216   4e-67
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   203   6e-58
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     179   3e-49
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            153   9e-40
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   152   2e-39
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   145   4e-37
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    52   2e-06
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    50   9e-06
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    47   8e-05
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    47   1e-04
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    45   3e-04
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    45   3e-04
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    45   5e-04
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    45   5e-04
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    45   5e-04
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    44   6e-04
TDEL0D03800 Chr4 (695403..697325) [1923 bp, 640 aa] {ON} Anc_3.2...    44   6e-04
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    44   8e-04
KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {...    44   8e-04
SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} simila...    44   9e-04
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    44   0.001
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    44   0.001
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    44   0.001
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    43   0.001
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    43   0.002
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    43   0.002
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    43   0.002
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    43   0.002
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    42   0.002
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    42   0.003
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    42   0.004
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    41   0.006
Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {O...    41   0.007
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    41   0.007
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    41   0.007
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    40   0.009
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    40   0.009
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    40   0.010
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    40   0.010
TBLA0A10350 Chr1 (2550231..2551796) [1566 bp, 521 aa] {ON} Anc_5...    40   0.011
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    40   0.012
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    40   0.012
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    40   0.012
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    40   0.014
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    40   0.015
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    40   0.016
CAGL0J00363g Chr10 (27627..29123) [1497 bp, 498 aa] {ON} highly ...    40   0.018
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    40   0.020
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    39   0.023
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    39   0.025
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    39   0.026
KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {O...    39   0.028
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    39   0.029
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    39   0.030
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    39   0.034
TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {O...    39   0.037
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               39   0.038
Skud_8.107 Chr8 (179754..181322) [1569 bp, 522 aa] {ON} YHR048W ...    39   0.039
ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON} Syn...    39   0.040
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    39   0.041
NCAS0A06580 Chr1 (1303456..1305042) [1587 bp, 528 aa] {ON} Anc_5...    39   0.042
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...    39   0.043
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    38   0.053
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    38   0.057
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    38   0.060
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    38   0.064
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...    38   0.071
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    38   0.071
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    38   0.076
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    38   0.079
KNAG0B04900 Chr2 (940751..942301) [1551 bp, 516 aa] {ON}               37   0.083
SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} simila...    37   0.087
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    37   0.094
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    37   0.099
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    37   0.11 
Skud_9.48 Chr9 (109346..111145) [1800 bp, 599 aa] {ON} YIL120W (...    37   0.11 
TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432     37   0.11 
KAFR0J00480 Chr10 (84206..85708) [1503 bp, 500 aa] {ON} Anc_5.28...    37   0.11 
KNAG0A03540 Chr1 (450487..452103) [1617 bp, 538 aa] {ON} Anc_8.5...    37   0.13 
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    37   0.14 
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    37   0.17 
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    36   0.20 
Smik_8.117 Chr8 (181800..183344) [1545 bp, 514 aa] {ON} YHR048W ...    36   0.22 
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    36   0.25 
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    36   0.25 
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    36   0.28 
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    36   0.31 
YHR048W Chr8 (204607..206151) [1545 bp, 514 aa] {ON}  YHK8Presum...    36   0.31 
Skud_3.172 Chr3 complement(280981..282546) [1566 bp, 521 aa] {ON...    35   0.32 
Suva_8.358 Chr8 complement(630597..632165) [1569 bp, 522 aa] {ON...    35   0.44 
YCR098C Chr3 complement(297049..298605) [1557 bp, 518 aa] {ON}  ...    35   0.45 
CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {...    35   0.45 
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    35   0.50 
KLTH0C00462g Chr3 complement(49362..51074) [1713 bp, 570 aa] {ON...    35   0.53 
KLLA0B06798g Chr2 (596500..598491) [1992 bp, 663 aa] {ON} simila...    35   0.57 
TPHA0B03770 Chr2 (890983..892545) [1563 bp, 520 aa] {ON}               34   0.74 
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    34   0.75 
ZYRO0G16302g Chr7 complement(1336890..1338533) [1644 bp, 547 aa]...    34   0.84 
Smik_4.46 Chr4 (89787..92432) [2646 bp, 881 aa] {ON} YDL194W (REAL)    34   0.87 
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    34   0.89 
Skud_2.155 Chr2 complement(291487..293553) [2067 bp, 688 aa] {ON...    34   0.94 
Kwal_56.22949 s56 complement(342503..344431) [1929 bp, 642 aa] {...    34   1.00 
ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic ho...    34   1.2  
NDAI0D01680 Chr4 complement(395646..397196) [1551 bp, 516 aa] {O...    33   1.6  
YDL194W Chr4 (111580..114234) [2655 bp, 884 aa] {ON}  SNF3Plasma...    33   1.6  
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    33   1.7  
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    33   1.8  
KAFR0G01110 Chr7 (252842..253486) [645 bp, 214 aa] {ON} Anc_7.43...    32   1.9  
KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {...    33   2.3  
KLTH0D06710g Chr4 complement(582430..584265) [1836 bp, 611 aa] {...    33   2.4  
Ecym_6024 Chr6 (43495..44964) [1470 bp, 489 aa] {ON} similar to ...    33   2.4  
ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {...    33   2.5  
Kpol_534.27 s534 (61814..63322) [1509 bp, 502 aa] {ON} (61814..6...    33   2.6  
Suva_14.4 Chr14 (4495..6051) [1557 bp, 518 aa] {ON} YCR098C (REAL)     33   2.7  
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    33   2.8  
TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {O...    32   3.2  
SAKL0F12848g Chr6 complement(1004963..1008310) [3348 bp, 1115 aa...    32   3.3  
Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}...    32   3.6  
TBLA0A01270 Chr1 complement(300796..302364) [1569 bp, 522 aa] {O...    32   3.6  
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    32   3.9  
Kpol_461.15 s461 complement(27790..29343) [1554 bp, 517 aa] {ON}...    32   3.9  
TDEL0D06570 Chr4 complement(1183554..1185254) [1701 bp, 566 aa] ...    32   4.0  
SAKL0G10758g Chr7 (913417..915018) [1602 bp, 533 aa] {ON} simila...    32   4.1  
Suva_15.236 Chr15 (408206..409750) [1545 bp, 514 aa] {ON} YHR048...    32   4.1  
TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.2...    32   4.4  
TBLA0B04640 Chr2 complement(1082147..1083595) [1449 bp, 482 aa] ...    32   4.7  
KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa] ...    32   4.7  
TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON} Anc_8...    32   4.7  
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    32   4.7  
KAFR0D00790 Chr4 (168111..169796) [1686 bp, 561 aa] {ON}               32   4.8  
Smik_3.200 Chr3 complement(296300..297856) [1557 bp, 518 aa] {ON...    32   5.0  
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    32   5.7  
KLLA0F08525g Chr6 complement(793929..795410) [1482 bp, 493 aa] {...    32   6.0  
KAFR0G00160 Chr7 (51436..53346) [1911 bp, 636 aa] {ON}                 32   6.6  
Suva_4.431 Chr4 (759282..761000) [1719 bp, 572 aa] {ON} YBR180W ...    31   6.7  
Kpol_463.6 s463 (13470..15443) [1974 bp, 657 aa] {ON} (13470..15...    32   6.7  
TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}     31   6.8  
Kpol_1051.15 s1051 (29969..31474) [1506 bp, 501 aa] {ON} (29969....    31   6.8  
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...    31   7.0  
ZYRO0A03564g Chr1 (283783..285837) [2055 bp, 684 aa] {ON} simila...    31   7.0  
AER339C Chr5 complement(1259842..1261563) [1722 bp, 573 aa] {ON}...    31   7.3  
NDAI0D05010 Chr4 complement(1193201..1194925) [1725 bp, 574 aa] ...    31   7.9  
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    31   8.5  
TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}     31   8.6  

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  995 bits (2573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/521 (94%), Positives = 493/521 (94%)

Query: 1   MWFKRSNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFAS 60
           MWFKRSNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFAS
Sbjct: 1   MWFKRSNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFAS 60

Query: 61  MMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLK 120
           MMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLK
Sbjct: 61  MMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLK 120

Query: 121 KTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTT 180
           KTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTT
Sbjct: 121 KTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTT 180

Query: 181 RKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNTI 240
           RKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNTI
Sbjct: 181 RKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNTI 240

Query: 241 PTNVRGSSMDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYET 300
           PTNVRGSSMDW            FNFVWNQGPIVGWDT                FFLYET
Sbjct: 241 PTNVRGSSMDWIGSGIGLLGMILFNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFLYET 300

Query: 301 KYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFM 360
           KYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFM
Sbjct: 301 KYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFM 360

Query: 361 FLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILS 420
           FLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILS
Sbjct: 361 FLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILS 420

Query: 421 FGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLL 480
           FGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLL
Sbjct: 421 FGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLL 480

Query: 481 KGYRAALYLGIGLASLGVFISALFMLENYLRMRRRNVKEEV 521
           KGYRAALYLGIGLASLGVFISALFMLENYLRMRRRNVKEEV
Sbjct: 481 KGYRAALYLGIGLASLGVFISALFMLENYLRMRRRNVKEEV 521

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/498 (63%), Positives = 387/498 (77%), Gaps = 1/498 (0%)

Query: 20  QSATAFTEHSDVQVDDKKWPS-IQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLI 78
           QS++A  E  D Q +     S +Q+P YF  PWKEY+F+ +SM+SQLLNQA TTQT  L 
Sbjct: 16  QSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLF 75

Query: 79  NILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICG 138
           ++LSK+ ++  SQQ WLMASFPLVSGSFILVSGK+GDIYGLKKTLL GYVV +IWSLICG
Sbjct: 76  DVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICG 135

Query: 139 LTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGAT 198
           L+SY  +V+FF+++R+FQGLGIAF+LPN+MGIVGNIY   T  KN+V SLIGACAPIGAT
Sbjct: 136 LSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGAT 195

Query: 199 MGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSMDWXXXXXXX 258
           +G +FSGLIG  ++ W WTFYAY ITAA+N  +++W+IPN IPTNV    MDW       
Sbjct: 196 LGCVFSGLIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGV 255

Query: 259 XXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETKYANDPLIPRPAMHNHRL 318
                FNFVWNQ PI GW +                F  YE ++A  PL+P   + N +L
Sbjct: 256 FGLILFNFVWNQAPIAGWGSAYIIVLLIVAVVALIAFITYEIRFAKQPLLPHSVLFNRKL 315

Query: 319 LMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAISVGYTIKR 378
           +M L ++FFGWGSFGIWTFYY  F+LNLR Y+PLWAGG+YFMF IWGI+A++ VGYTI +
Sbjct: 316 MMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHK 375

Query: 379 IPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASSIILSDEL 438
             P++ILFLSM+AFDCGCIML+VTPV QTYFRM LG+MIILSFGMDLSFPA+SIILSD+L
Sbjct: 376 TGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQL 435

Query: 439 PMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALYLGIGLASLGV 498
           P + QGMAGSLVSTMI+YSMS+CLGI+GT EHQ+NKNG DLLKGY+AALY+GIGLASLGV
Sbjct: 436 PSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLASLGV 495

Query: 499 FISALFMLENYLRMRRRN 516
            IS  FM+E++   RR+ 
Sbjct: 496 VISGAFMIEDWWTSRRKR 513

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/508 (60%), Positives = 377/508 (74%), Gaps = 1/508 (0%)

Query: 12  SQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGT 71
           S+ +     S      H D  +       +Q+P YF   WKEYLF+ +SM+SQLLNQA  
Sbjct: 9   SKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSQLLNQAAA 68

Query: 72  TQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTI 131
            Q   L ++LS++  +  SQQ WLMASFPLVSGSFILVSGK+GDIYGLKKTLL GY V +
Sbjct: 69  LQANPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVV 128

Query: 132 IWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGA 191
           IWSLICGL+SY  +V+FFI++R+FQGLGIAF+LPN+ GIVGNIY   T  KNMV S+IGA
Sbjct: 129 IWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGA 188

Query: 192 CAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSMDW 251
           CAPIGAT+G LFSGLIGT SE WAWTFYAYTI AA+N  ++ +VIP+ IPTNV    MDW
Sbjct: 189 CAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDW 248

Query: 252 XXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETKYANDPLIPRP 311
                       FNFVWNQ P  GWD+                F ++E ++A +PL+PR 
Sbjct: 249 LGSFLGVCGLIMFNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARFAKEPLLPRA 308

Query: 312 AMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAIS 371
            + N +L+M L ++F GWGSFGIWT+YY  FVLNLR YTPLWAGGSYFMF I+G IAA  
Sbjct: 309 VLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFL 368

Query: 372 VGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASS 431
           VG+TI +  P++IL  S++AFD GCIMLSVTPVDQTYFRM LG M+ILSFGMDLSFPASS
Sbjct: 369 VGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASS 428

Query: 432 IILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALYLGI 491
           IILSD+LP + QGMAGSLV+TMINYSMS+CLG++GT E Q+NK+G DLLKGYRAALY+GI
Sbjct: 429 IILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGI 488

Query: 492 GLASLGVFISALFMLEN-YLRMRRRNVK 518
           GLAS+G+F+S  + +E+ + R R R+V+
Sbjct: 489 GLASVGIFVSGAYAIEDWWTRRRERSVR 516

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/513 (61%), Positives = 385/513 (75%), Gaps = 6/513 (1%)

Query: 11  SSQSKELGTQ-SATAFTEHSDVQVD-DKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQ 68
           SS+   +G   +ATAFT+  D  VD ++KW   Q+P YF   W+EYLFIF  M+SQLLNQ
Sbjct: 27  SSRDNNIGESLTATAFTQSEDEMVDSNQKW---QNPNYFKYAWQEYLFIFTCMISQLLNQ 83

Query: 69  AGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYV 128
           AGTTQTLS++NILS +F S  + ++WLMASFPLVSGSFIL+SG++GDIYGLKK LLVGYV
Sbjct: 84  AGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYV 143

Query: 129 VTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISL 188
           + IIWSLICG+T Y+ S  FFIISRAFQGLGIAF+LPN++GI+GNIYV GT RKN+VIS 
Sbjct: 144 LVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISF 203

Query: 189 IGACAPIGATMGVLFSGLIGTLS-ERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGS 247
           +GA APIGAT+G LF+GLIGT   ++W W FYAY+I A IN  LSI+ IP+TIPTN+   
Sbjct: 204 VGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNIHHF 263

Query: 248 SMDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETKYANDPL 307
           SMDW             NFVWNQ PI GW+                 F +YE ++A  PL
Sbjct: 264 SMDWIGSVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISVIFLVVFIIYEIRFAKTPL 323

Query: 308 IPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGII 367
           +PR  + +  ++  +LA+FFGWGSFGI+TFYYF F LN+R+YT LWAGG+YFMFLIWGII
Sbjct: 324 LPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGII 383

Query: 368 AAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSF 427
           AA+ VG+TIK + PS+ LF SM+AF+ G IM SVTPV +TYFR  LG MIILSFGMDLSF
Sbjct: 384 AALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSF 443

Query: 428 PASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAAL 487
           PASSII SD LPME QGMAGSLV+T++NYSMS+CLG+  TVE Q+N +G  LLKGYR A 
Sbjct: 444 PASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKGYRGAQ 503

Query: 488 YLGIGLASLGVFISALFMLENYLRMRRRNVKEE 520
           YLGIGLASL   IS L+M+E++++ RR     E
Sbjct: 504 YLGIGLASLACMISGLYMVESFIKGRRARAAAE 536

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/522 (58%), Positives = 387/522 (74%), Gaps = 9/522 (1%)

Query: 3   FKRSNESVSSQSK----ELGTQSATAFTEH-SDVQVDDKKWPSIQDPTYFSAPWKEYLFI 57
           F+  NESVS+  K    +   ++ T  T+H  ++ VD ++W   Q+P YF   W EYLFI
Sbjct: 17  FEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRW---QNPNYFKNSWHEYLFI 73

Query: 58  FASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIY 117
           F  M+SQLLNQAGTTQTLS++NI++ +F S+ + +TWLMASFPLVSGSFIL+SG++GDIY
Sbjct: 74  FTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIY 133

Query: 118 GLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVA 177
           GLKK L +GYVV IIWSLICGLT Y+ S  FFIISRAFQGLGIAF+LPN++GI+GNIYV+
Sbjct: 134 GLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVS 193

Query: 178 GTTRKNMVISLIGACAPIGATMGVLFSGLIGTLS-ERWAWTFYAYTITAAINMGLSIWVI 236
           GT RKN+VISL+GA AP+GAT+G LF+GLIGT + ++W W FYAYTIT+ IN+ LS++ I
Sbjct: 194 GTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSI 253

Query: 237 PNTIPTNVRGSSMDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFF 296
           PN IPTN++  SMDW             NFVWNQ PI GWD                 F 
Sbjct: 254 PNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYIIVLLVISVVFLVVFI 313

Query: 297 LYETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGG 356
           +YE ++A  PL+PR  + +  ++  +LA+FFGWGSFGI+TFYYF F LN+R Y+ +WAGG
Sbjct: 314 IYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGG 373

Query: 357 SYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMM 416
           +YFMFLIWGIIAA+ VG  IK++ PS+ LFLSM+AF+ G IM SVTPV +TYFR  LG M
Sbjct: 374 TYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTM 433

Query: 417 IILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNG 476
           IILSFGMD SFPASSII SD LPME QGMAGSLV+T++NYSMS+CLG+  TVE  ++ +G
Sbjct: 434 IILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDG 493

Query: 477 DDLLKGYRAALYLGIGLASLGVFISALFMLENYLRMRRRNVK 518
             +LKGYR A YLGIGLASL   IS L+M+E  ++  +   +
Sbjct: 494 KHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKAR 535

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/521 (58%), Positives = 381/521 (73%), Gaps = 16/521 (3%)

Query: 3   FKRSNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMM 62
           FK+ N  +  + K+  TQ+             ++KW   Q+P YF +  KEYLF+ +  +
Sbjct: 26  FKQDNNDIVDE-KQCDTQAIDG----------NQKW---QNPEYFDSTLKEYLFLCSCFV 71

Query: 63  SQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKT 122
           SQLLNQAG  QT  ++NI++ + DS   +Q WLMA+FPL+SGSFIL+SG+IGDIYGLKKT
Sbjct: 72  SQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKT 131

Query: 123 LLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRK 182
           LLVGY+  I+WSLICGLT Y  S  FFI+SRAFQGLGI+ ILPNI+GIVG+IY+AG+ RK
Sbjct: 132 LLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRK 191

Query: 183 NMVISLIGACAPIGATMGVLFSGLIGTL-SERWAWTFYAYTITAAINMGLSIWVIPNTIP 241
           NMVISLIG  APIGAT+G +FSGLIGT  + +W W FY+Y ITAAIN  LSIW+IPNTIP
Sbjct: 192 NMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIP 251

Query: 242 TNVRGSSMDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETK 301
           TNV G  MDW             NFVWNQ PI GWD+                FF+YE  
Sbjct: 252 TNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYLIVLLIISVLLLIAFFIYELH 311

Query: 302 YAN-DPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFM 360
           + N +PL+P+  + + + ++ L A+FFGWGSFGI++FYYF F LNLR YTPLWAGG+YFM
Sbjct: 312 FVNGNPLLPKEVLKSPKTIIVLFALFFGWGSFGIFSFYYFTFQLNLRHYTPLWAGGTYFM 371

Query: 361 FLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILS 420
           FLIWGI+AA+ VG+TIK++ PS+ILFLSM+AF+CG I++SVTP+ QTYFR  LGMMIILS
Sbjct: 372 FLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILS 431

Query: 421 FGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLL 480
           FGMDLSFPASSI+LSD+LP++ QGMAGSLV+TM+NYSMS CLG+AG VE  +N +G D+L
Sbjct: 432 FGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVL 491

Query: 481 KGYRAALYLGIGLASLGVFISALFMLENYLRMRRRNVKEEV 521
           KGYR A YLGIGLAS+   IS   ML   ++ R+      V
Sbjct: 492 KGYRGAFYLGIGLASMACIISGALMLSEIIQGRKNEKDSAV 532

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/515 (59%), Positives = 378/515 (73%), Gaps = 5/515 (0%)

Query: 8   ESVSSQSKELGTQSATAFTEHSD-VQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLL 66
           E  S ++ + G  +    T   D V    +KW   Q+P YF  PW+EYLFIF  M+SQLL
Sbjct: 36  EDSSPRNNKEGALTTIVLTNSEDEVMKTKQKW---QNPNYFKYPWQEYLFIFTCMISQLL 92

Query: 67  NQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVG 126
           NQ+GTTQTLS++NIL+ +F S  + ++WLMASFPLVSGSFIL+SG++GDI+GLK  LL+G
Sbjct: 93  NQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIG 152

Query: 127 YVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVI 186
           YV+ IIWSLICGLT Y+ S  FFI+SRAFQGLGIAF+LPN++GI+GN+YV GT RKN+VI
Sbjct: 153 YVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVI 212

Query: 187 SLIGACAPIGATMGVLFSGLIGTLS-ERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVR 245
           S IGA APIGAT+G  F+GLIGT++  +W W FYAYTITA IN+ LSI+ IPN IPTNV 
Sbjct: 213 SFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNNIPTNVH 272

Query: 246 GSSMDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETKYAND 305
             SMDW             N VWNQ PI GW+                 F +YE  +A  
Sbjct: 273 RFSMDWIGSGLGVIGLVLLNLVWNQAPISGWNQAYIIVLLIISVLFLVLFGVYEIHFAKS 332

Query: 306 PLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWG 365
           PL+P+  M +  ++  +L++FFGWGSFGI+TFYYF F LN+R YTPLWAGGSYFMFLIWG
Sbjct: 333 PLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWG 392

Query: 366 IIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDL 425
           IIAA+ VG++IKR+ PS+ LF +M+AF+ G IM SVTPV +TYFRM +G MIILSFGMDL
Sbjct: 393 IIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGMDL 452

Query: 426 SFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRA 485
           SFPASSII SD LPME QGMAGSLV+T++NYSMS+CLG+  TVE Q++ +G  +LKGYR 
Sbjct: 453 SFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGYRG 512

Query: 486 ALYLGIGLASLGVFISALFMLENYLRMRRRNVKEE 520
           A YLGIGLASL   IS L+M+E Y++  R     E
Sbjct: 513 AQYLGIGLASLACIISGLYMVECYIKDHRAKAVAE 547

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/525 (58%), Positives = 383/525 (72%), Gaps = 11/525 (2%)

Query: 4   KRSNESV---SSQSKELGTQS---ATAFTEHSDVQVD-DKKWPSIQDPTYFSAPWKEYLF 56
           +  NE+V      S++ G++     TAFT   D  V+ ++KW   Q+P YF   W+EYLF
Sbjct: 18  EVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKW---QNPKYFKYAWQEYLF 74

Query: 57  IFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDI 116
           IF  M+SQLLNQAGTTQTLS++NILS +F S  + ++WLMASFPLVSGSFIL+SG++GDI
Sbjct: 75  IFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDI 134

Query: 117 YGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYV 176
           YGLKK LLVGYV+ IIWSLICG+T+Y+ S  FFII RAFQGLGIAF+LPN++GI+GNIYV
Sbjct: 135 YGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYV 194

Query: 177 AGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLS-ERWAWTFYAYTITAAINMGLSIWV 235
            GT RKN+VIS +GA APIGAT+G LF+GLIGT +  +W W FYA++I + IN GLSI+ 
Sbjct: 195 GGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIYA 254

Query: 236 IPNTIPTNVRGSSMDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXF 295
           IPN IPTN+   SMDW             NFVWNQ PI GW                  F
Sbjct: 255 IPNNIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWSQAYIIVILIISVIFLAVF 314

Query: 296 FLYETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAG 355
            +YE  +A  PL+P   + ++ ++  +LA+FFGWGSFGI+TFYYF F LN+R YT LWAG
Sbjct: 315 IIYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAG 374

Query: 356 GSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGM 415
           G+YFMFLIWGIIAA+ VG+TIK + PS+ LF SM+AF+ G IM SVTPV +TYFR  LG 
Sbjct: 375 GTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQLGT 434

Query: 416 MIILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKN 475
           MIILSFGMDLSFPASSII SD LPME QGMAGSLV+T++NYSMS+CLG+  TVE Q++ +
Sbjct: 435 MIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPD 494

Query: 476 GDDLLKGYRAALYLGIGLASLGVFISALFMLENYLRMRRRNVKEE 520
           G  LLKGYR A YLGIGLASL   IS L+M+E+++   +     E
Sbjct: 495 GKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAATE 539

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/515 (58%), Positives = 367/515 (71%), Gaps = 11/515 (2%)

Query: 4   KRSNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMS 63
           K  N  VS        Q      +HS       KW   Q+P YF   W+EYLFIF+ MMS
Sbjct: 36  KEENNEVSEDELPSSEQEDNTIGDHS-------KW---QNPDYFQNKWQEYLFIFSCMMS 85

Query: 64  QLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTL 123
           QLLNQA T QTLS++NI++ +F S   ++TWL+ASFPLVSGSFIL+SG+IGDIYGLKKTL
Sbjct: 86  QLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTL 145

Query: 124 LVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKN 183
           + GY+  IIWSLI G T Y+ +  FFIISRAFQGLGIAFILPN+MGIVGNIY   T RKN
Sbjct: 146 IGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKN 205

Query: 184 MVISLIGACAPIGATMGVLFSGLIGTLS-ERWAWTFYAYTITAAINMGLSIWVIPNTIPT 242
           +VIS+IGA APIGA MG LF+GLIGT + ++W W FYA+ I +AIN+ +SI+ IPN IPT
Sbjct: 206 IVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYAFAIASAINLAISIYSIPNNIPT 265

Query: 243 NVRGSSMDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETKY 302
           N+ G +MDW             NFVWNQGPIVGW                  FF YE KY
Sbjct: 266 NIHGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLIISIIALVLFFTYEIKY 325

Query: 303 ANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFL 362
           A  P++P     N  ++M L A+F GWGSFGI++FYYF F+LNLR Y+ LWAG +YFMF 
Sbjct: 326 AKSPILPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFA 385

Query: 363 IWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFG 422
           IWG +AA+ VG  IKRI  S+ILF SM+AF+ G IMLSVTPVDQTYFRM LG MIILSFG
Sbjct: 386 IWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFG 445

Query: 423 MDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKG 482
           MD+SFPA++IILSD L M+ QGMAGSL +TM+NYSMS+CLG+  TVE QINK+G ++LKG
Sbjct: 446 MDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKG 505

Query: 483 YRAALYLGIGLASLGVFISALFMLENYLRMRRRNV 517
           YRAA YLG+GLA LG+ IS ++M E     R+  +
Sbjct: 506 YRAAEYLGVGLAGLGIVISGIYMAEVLWAKRKERL 540

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/532 (56%), Positives = 381/532 (71%), Gaps = 24/532 (4%)

Query: 11  SSQSKELGTQSATAFTE------HSDV--------------QVDDKKWPSIQDPTYFSAP 50
           S +S+E+   +A++ TE      H D+              Q++  KW   Q+P YF   
Sbjct: 9   SHRSEEIMESAASSITEETSIIKHGDIEEIEKDVISQTETPQLEHSKW---QNPDYFQNQ 65

Query: 51  WKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVS 110
           W+EYLFIF+ MMSQLLNQA T QTLS++NI++ +F+S   ++TWL+ASFPLVSGSFIL+S
Sbjct: 66  WQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILIS 125

Query: 111 GKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGI 170
           G+IGDIYGLKKTL+ GY+  IIWS+I GLT Y+ S  FFI+SRAFQGL IAFILPN+MGI
Sbjct: 126 GRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGI 185

Query: 171 VGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLS-ERWAWTFYAYTITAAINM 229
           VGNIY   + RKN+VIS+IGA APIGA  G LF+GLIGT   ++W W FYA+ I +A N+
Sbjct: 186 VGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNL 245

Query: 230 GLSIWVIPNTIPTNVRGSSMDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXX 289
            +SI+ IPN++PTNV G +MDW             NFVWNQGPIVGW T           
Sbjct: 246 AISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIALLVVSV 305

Query: 290 XXXXXFFLYETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREY 349
                FF YE KYA  PL+P     N  ++M L A+F GWGSFGI++FYYF F+LNLR Y
Sbjct: 306 FFLALFFTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHY 365

Query: 350 TPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYF 409
           + LWAG +YFMF IWG +AA+ VG  IK+I  + ILF+SM+AF+ G IMLSVTPVDQTYF
Sbjct: 366 SALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYF 425

Query: 410 RMILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVE 469
           RM LG MIILSFGMD+SFPA++IILSD L M+ QGMAGSL +TM+NYSMS+CLG+  TVE
Sbjct: 426 RMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVE 485

Query: 470 HQINKNGDDLLKGYRAALYLGIGLASLGVFISALFMLENYLRMRRRNVKEEV 521
            QINK+G+DLLKGYR A YLGIGLA LG+ I+A+++ E     R++++   V
Sbjct: 486 RQINKSGNDLLKGYRGAEYLGIGLAGLGIIITAIYLGEILWGKRKQHLAANV 537

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/506 (56%), Positives = 362/506 (71%), Gaps = 4/506 (0%)

Query: 3   FKRSNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMM 62
           + +++++   + K   T+S   +   S+   +D  W   Q+PTYF+  W+EY FI   M+
Sbjct: 27  YTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPW---QNPTYFANRWQEYAFISTCML 83

Query: 63  SQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKT 122
           +QLLNQAG  Q  + +NIL+  F+SS  +QTWLMASFPLVSGSFILVSG+IGDIYGLKKT
Sbjct: 84  AQLLNQAGQAQATAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKT 143

Query: 123 LLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRK 182
           L+ GY+V +IWSLICG  +YT +  FFI+ RAFQGLGIAFILPN+MG++GNIY A T RK
Sbjct: 144 LIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRK 203

Query: 183 NMVISLIGACAPIGATMGVLFSGLIGTLS-ERWAWTFYAYTITAAINMGLSIWVIPNTIP 241
           N VIS +G CAPIGA +G ++SGLI   + ++W W FYAY I  AINM ++I+ IP+T+P
Sbjct: 204 NFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVP 263

Query: 242 TNVRGSSMDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETK 301
           TN+ G  MDW            FNFVWNQGPI GW+                 FF+YE K
Sbjct: 264 TNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIK 323

Query: 302 YANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMF 361
           +A  PL+P   + N  + M LLAVF GWGSFGIWTFYY+ F LNLR Y+ +WAGG++FMF
Sbjct: 324 FAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMF 383

Query: 362 LIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSF 421
           +IWG IAA  V  TIKR+ PS++L  SM  F  GCIMLSVTPV Q+Y++M LGM IILSF
Sbjct: 384 VIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSF 443

Query: 422 GMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLK 481
           GMDLSFPASSIILSD LP + QGMAGSLV+TM+NYS S+CLG+  T E Q+NKNG D LK
Sbjct: 444 GMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLK 503

Query: 482 GYRAALYLGIGLASLGVFISALFMLE 507
           GYRAALY+GIGL + G+ ++  ++ E
Sbjct: 504 GYRAALYVGIGLGACGMLVAFCYLFE 529

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/524 (56%), Positives = 374/524 (71%), Gaps = 12/524 (2%)

Query: 4   KRSNESVSSQSKELGTQSATAFTEH-SDVQVDDKKWPSI----------QDPTYFSAPWK 52
           ++ N +V +    L   S+T+ +E  S + V +   P            Q+P+YFS+ WK
Sbjct: 21  EKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKFSDNNTPWQNPSYFSSRWK 80

Query: 53  EYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGK 112
           EYLFI   M+S LLNQAG TQ  S +N++   F++ +S +TWLMASFPLVSGSFILVSG+
Sbjct: 81  EYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGR 140

Query: 113 IGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVG 172
           IGDIYGLK+T++ G +V IIWSLICG  +Y+SSV FFII RAFQGLGIAF+LPN+MG+VG
Sbjct: 141 IGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVG 200

Query: 173 NIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLSER-WAWTFYAYTITAAINMGL 231
           NIY  G+ RKN+VIS IG CAP GA  G  ++GLI T +E+ W W FYAY     +N+ L
Sbjct: 201 NIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVL 260

Query: 232 SIWVIPNTIPTNVRGSSMDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXX 291
           +I+ IP+T+P NV G SMDW            FNFVWN+ PIVGW+              
Sbjct: 261 AIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYIIVLLIFSLLI 320

Query: 292 XXXFFLYETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTP 351
              FF+YE K+A  PL+P+   HNH ++M L A+F GWGSFGIWTFYY+ F+LNLR YTP
Sbjct: 321 IVVFFIYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTP 380

Query: 352 LWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRM 411
           L AG S+ MF++WG IAA +V +TIKR+ PS++LF SM+AF  G IMLS+TPV QTY++M
Sbjct: 381 LEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKM 440

Query: 412 ILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQ 471
             GM IIL+FGMDLSFPASSIILSD LPME QGMAGSLV+T++NYS S+CLG+  T E Q
Sbjct: 441 TFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQ 500

Query: 472 INKNGDDLLKGYRAALYLGIGLASLGVFISALFMLENYLRMRRR 515
           +NKNG DLLKGYRAALY+GIGL  +GV I+ALF+ E+  + R R
Sbjct: 501 VNKNGTDLLKGYRAALYVGIGLGVVGVIIAALFLFESLRQKRGR 544

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/510 (57%), Positives = 367/510 (71%), Gaps = 6/510 (1%)

Query: 11  SSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAG 70
           ++ S +LG+ + T  + H      + KW   QD TYF   W+EY+F+   MMSQLLNQA 
Sbjct: 31  NTDSDKLGSGNET--STHVATTDPNCKW---QDTTYFQNRWQEYIFVGTCMMSQLLNQAC 85

Query: 71  TTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVT 130
             QTLSL+NIL+K+F S+   QTWLMASFPLVSGSFIL+SG++GDIYGLK +L+ G +  
Sbjct: 86  IPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFF 145

Query: 131 IIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIG 190
           IIW+LI G T+YT S  FFI+SR+FQGLG+AFILPN+MG VGNIY   T RKN+VISLIG
Sbjct: 146 IIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIG 205

Query: 191 ACAPIGATMGVLFSGLIGTLS-ERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSM 249
           ACAP+GA MG  F+GLIGT + + W W+FYA  I + + +  +++ IPN IPTNV G SM
Sbjct: 206 ACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSM 265

Query: 250 DWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETKYANDPLIP 309
           DW             NFVWNQGPI GW                  FF+YE  YA  PL+P
Sbjct: 266 DWIGSGLAVVGLILLNFVWNQGPIDGWGKAYIIVLLIVSVFVLTLFFIYEVHYAASPLLP 325

Query: 310 RPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAA 369
           R    N  ++M L+A+F GWGSFGI++FYYF F+LNLR Y+ +WAGG+YFMF IWG++A+
Sbjct: 326 RVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVAS 385

Query: 370 ISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPA 429
           + VG +I++I  S+ILF SM+AFD G IMLSVTPV QTYFRM LG MIILSFGMD+SFPA
Sbjct: 386 VVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPA 445

Query: 430 SSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALYL 489
           ++IILSD LP + QGMAGSL +TM+NYSMS+CLG+  TVE QIN+NG DLLKGYRAA YL
Sbjct: 446 AAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYL 505

Query: 490 GIGLASLGVFISALFMLENYLRMRRRNVKE 519
           GIG+ASL V +S ++M E     R+  ++ 
Sbjct: 506 GIGIASLAVILSLIYMCERLWIDRKERMES 535

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/513 (55%), Positives = 362/513 (70%), Gaps = 7/513 (1%)

Query: 10  VSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQA 69
           VSS+ +++ T    A +  S    +D  W   QDPTYFS+  +E +FI   M++QLLNQA
Sbjct: 32  VSSEDEDVTT---VASSNKSTQVSNDSPW---QDPTYFSSFGRELMFIVTCMLAQLLNQA 85

Query: 70  GTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVV 129
           G T  L+++N+LSK+F+S + +Q WLMASFPLV+GSFIL+SG++GDIYGLKK L++GYV 
Sbjct: 86  GQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVT 145

Query: 130 TIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLI 189
            I+WSLICGL+ Y+++  FFI  RAFQGLGIAFILPN+MG+VG++Y  G+TRKN+VIS I
Sbjct: 146 IIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFI 205

Query: 190 GACAP-IGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSS 248
           GACAP  G   G+    ++   SE+W W FYA+ I   +NM L+ + IPN IPTNV G S
Sbjct: 206 GACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFS 265

Query: 249 MDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETKYANDPLI 308
           MDW            FNFVWNQ P  GW T                FF+YE KYA  PL+
Sbjct: 266 MDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLL 325

Query: 309 PRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIA 368
           P     N  ++M LLAVF GWGSFGIWTFYY  F LNLR Y+P+W GG+YF+F+I+G IA
Sbjct: 326 PHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIA 385

Query: 369 AISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFP 428
           A  V  +IKR+ P+ +L  +++AFD G IM SV PV Q+++++  GM  IL FGMDLSFP
Sbjct: 386 AFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFP 445

Query: 429 ASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALY 488
           ASSIILSD LPME QGMAGSLV+T+INYS S+CLG+  TVEHQINKNG DLLKGYR A+Y
Sbjct: 446 ASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGAIY 505

Query: 489 LGIGLASLGVFISALFMLENYLRMRRRNVKEEV 521
           LG+GLASLGV IS  +MLE +   RR   K+ V
Sbjct: 506 LGVGLASLGVLISFTYMLETFWNNRRDRQKDSV 538

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/515 (55%), Positives = 371/515 (72%), Gaps = 9/515 (1%)

Query: 7   NESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLL 66
             ++S + K L T+      + + V V++ + P  QDP YF   W E LF+ + MM QLL
Sbjct: 24  ERNLSREDKMLTTE------KEAPVFVEEPESP-WQDPNYFKGKWDEVLFVLSCMMGQLL 76

Query: 67  NQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVG 126
           NQAG+T TLS + +L +  DSS+++ +WLMASFPLVSGSFIL+SG++GDIYGLKK LL+G
Sbjct: 77  NQAGSTMTLSTMKVLERELDSSSAKSSWLMASFPLVSGSFILISGRLGDIYGLKKMLLLG 136

Query: 127 YVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVI 186
           Y+   IWSLICGL+S++ +  FFI SRAFQGLGI+F+LPN++GIVGNIY  GT RKN+VI
Sbjct: 137 YIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVI 196

Query: 187 SLIGACAPIGATMGVLFSGLIGTLSER-WAWTFYAYTITAAINMGLSIWVIPNTIPTNVR 245
           SLIG CAPIGAT G LF+G++    +  W W FYAYTI A +   +S +VIPN+IP NV 
Sbjct: 197 SLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVN 256

Query: 246 GSSMDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETKYAND 305
             +MDW            FNFVWNQ  +VGW T                FF++E KYA  
Sbjct: 257 KFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYIIALLIVSIFLIALFFIFEIKYAKV 316

Query: 306 PLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWG 365
           PL+P+    +  ++M L ++  GWGSFGIW FYYF FVL LR Y+P+WAGG++FM  I G
Sbjct: 317 PLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVG 376

Query: 366 IIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDL 425
            IAA++VG++IKR+ P+++LF SM+AF CG I+LSVTPV +TYFR  LG M+ILSFGMDL
Sbjct: 377 CIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDL 436

Query: 426 SFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRA 485
           SFPA+SIILSDEL M+ QGMAGSLV+T++NYSMS+ LGI GT+E QINK+GD LL+G+RA
Sbjct: 437 SFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRA 496

Query: 486 ALYLGIGLASLGVFISALFMLENYLRMRRRNVKEE 520
           ALY  IG+ SLG+ IS +F+L+  L MR ++ KE 
Sbjct: 497 ALYFAIGVGSLGILISGVFVLQKEL-MRSKSRKEN 530

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/516 (54%), Positives = 363/516 (70%), Gaps = 6/516 (1%)

Query: 3   FKRSNESVSSQSKELGTQSATAFTEHSD-VQVDDKKWPSIQDPTYFSAPWKEYLFIFASM 61
           F  S  S  ++ K +       ++  +D V  DD  W   Q+P YFS+ +KEY FIF  M
Sbjct: 14  FSSSTVSFPNEDKNISHNEKEVYSNSTDSVLDDDSPW---QNPNYFSSKYKEYFFIFTCM 70

Query: 62  MSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKK 121
           ++ LLNQAG TQ LS +N++S++F S + +QTWLMASFPLVSGSFIL+SG+IGDIYGLKK
Sbjct: 71  VANLLNQAGQTQVLSTMNVISESFHSDSGKQTWLMASFPLVSGSFILISGRIGDIYGLKK 130

Query: 122 TLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTR 181
           T++ GY+  IIWSL+CG   +T +  FFI+ RAFQGLGI+FILPN+MG++GNIY  GT R
Sbjct: 131 TMIGGYIFMIIWSLLCGFADFTHNDTFFIVCRAFQGLGISFILPNVMGLIGNIYKVGTLR 190

Query: 182 KNMVISLIGACAPIGATMGVLFSGLIGTL-SERWAWTFYAYTITAAINMGLSIWVIPNTI 240
           KN+VIS+IG  AP GA MG L+ GLI T  +++W W FYAY +T  +N+ ++++ +PN I
Sbjct: 191 KNIVISMIGLTAPTGACMGALWGGLIVTENAKQWPWIFYAYALTGLVNLIMALYSVPNCI 250

Query: 241 PTNVRGSSMDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYET 300
           PTNV   +MDW            FNFVWNQGP+ GWD                 F +YE 
Sbjct: 251 PTNVHNFAMDWIGSIIGVVGLILFNFVWNQGPVAGWDKAYIIVLLIISVLFLVAFVVYEL 310

Query: 301 KYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFM 360
           KY   PL+P     N ++L  L  +F GWG+FGIWTFYYF F LNLR+Y+P+W GG+YFM
Sbjct: 311 KYPISPLLPVEVTKNGQILTILSILFLGWGAFGIWTFYYFAFQLNLRDYSPVWVGGTYFM 370

Query: 361 FLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILS 420
           F+IWG IAA+ V +TIK++ P+++LF S L F  G +MLSVTP+ Q Y+RM LGM IIL 
Sbjct: 371 FIIWGTIAALIVAFTIKKVGPAILLFFSALGFTMGSLMLSVTPIHQMYWRMNLGMQIILC 430

Query: 421 FGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLL 480
           FGMDLSFPASSIILSD LPM+ QGMAGSLV+T+INY+ S+CLG+  TVE QINK+G+DLL
Sbjct: 431 FGMDLSFPASSIILSDHLPMQYQGMAGSLVNTVINYATSLCLGMGTTVERQINKSGEDLL 490

Query: 481 KGYRAALYLGIGLASLGVFISALFMLENYLRMRRRN 516
           KGYR+ALYL +GL  LG  I A   L   L M+RR+
Sbjct: 491 KGYRSALYLAVGLGGLGSCI-AFINLCYTLWMKRRD 525

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/515 (56%), Positives = 366/515 (71%), Gaps = 4/515 (0%)

Query: 6   SNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQL 65
           S++   S S +L   S        D   +D  +   Q+P YF   +KE +FI + M++QL
Sbjct: 41  SSDECQSNSDQLSVTSKGCICSVDDCHENDSPF---QNPEYFETGFKEVMFIISCMVAQL 97

Query: 66  LNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLV 125
           LNQAG TQ+LS +N+L+  F S++S+Q WLMASFPLVSGSFIL+SG++GDIYGLKK L V
Sbjct: 98  LNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSV 157

Query: 126 GYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMV 185
           GY++  +WS+ICGL  YT+S  FFI+ R+FQGLGIAFILPNIMG+VGNIY  GT RKN+V
Sbjct: 158 GYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIV 217

Query: 186 ISLIGACAPIGATMGVLFSGLIGTL-SERWAWTFYAYTITAAINMGLSIWVIPNTIPTNV 244
           IS IG  AP GA +G LF GLI T  +E+W W FYA+ I + +NM L+++ IPN +PTN+
Sbjct: 218 ISCIGCMAPAGAALGALFGGLIVTEDAEQWPWVFYAFGIASFVNMLLALYSIPNNVPTNL 277

Query: 245 RGSSMDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETKYAN 304
              +MDW             N VWNQ PIVGW                  F +YE KYA 
Sbjct: 278 NNLNMDWIGSLLGVSGLLLLNIVWNQAPIVGWGEAYIIVLLIISIILLLIFVVYEIKYAT 337

Query: 305 DPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIW 364
            PL+P   + N ++LM L A+FFGWGSFGIWT+YY+ F LNLR+YTPLWAGG++FMF+IW
Sbjct: 338 SPLLPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIW 397

Query: 365 GIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMD 424
           G +AA  V  TIK++ P+++L  SM+AFDCG IMLSVTPV QTY+RM +GM IILSFGMD
Sbjct: 398 GTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMD 457

Query: 425 LSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYR 484
           LSFPASSIILSD LPM+ QGMAGSLV+T++NYS S+CLG+  TVE Q N +G DLLKGYR
Sbjct: 458 LSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYR 517

Query: 485 AALYLGIGLASLGVFISALFMLENYLRMRRRNVKE 519
           +ALYL IGLAS GV +S +F++ + +  R R   E
Sbjct: 518 SALYLAIGLASAGVCVSLVFLVTDIIAKRHRKRIE 552

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/519 (55%), Positives = 369/519 (71%), Gaps = 3/519 (0%)

Query: 3   FKRSNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMM 62
            K+ N  VSS   E   +S  +        ++ K   S+++P YF++  +EY FIF+ M+
Sbjct: 5   LKKKNIEVSSYIAEETIRSDCSDANDESPSMELKN-SSLRNPDYFNSTTQEYAFIFSCML 63

Query: 63  SQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKT 122
           SQLLN AGTTQTLS++N+L++   SS S + WL+ASFPLVSGSFILVSG++GDIYGLKK 
Sbjct: 64  SQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKM 123

Query: 123 LLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRK 182
           L++GYV+ +IWSLI GL+ Y+ S  FFII+RAFQGLGI+ +LPN++G++G IY  GT +K
Sbjct: 124 LILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKK 183

Query: 183 NMVISLIGACAPIGATMGVLFSGLIGTLSE-RWAWTFYAYTITAAINMGLSIWVIPNTIP 241
           NMVIS++GA +PIGAT+G LFSGL+ T SE  W W FYAYT+ A IN  +S + IPN IP
Sbjct: 184 NMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIP 243

Query: 242 TNVRGSSMDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETK 301
           TNV   SMDW            FNFVWNQ P  GW++                F +YE +
Sbjct: 244 TNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNSAYLIVLLVISVIALIAFGIYELR 303

Query: 302 YANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMF 361
           YA +PL+P   + N +L+M L A+ FGWGSFGIWTFYYF FVLNLR Y+PLWAGGSYF+F
Sbjct: 304 YAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIF 363

Query: 362 LIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSF 421
           +I G I AIS G+ +K+I P+++L  SM+ F+ GCI+ SVTPV QTYFR ILG MIIL  
Sbjct: 364 VISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPL 423

Query: 422 GMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLK 481
           GMDLSFPASSIILSD LP ++QGMAGSLV+T+INYS S+ LGIAGTVE   NKNG DLL+
Sbjct: 424 GMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLR 483

Query: 482 GYRAALYLGIGLASLGVFISALFMLEN-YLRMRRRNVKE 519
           GYR ALY GI  + + V I+ L+M+E  +   + R  K+
Sbjct: 484 GYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKEKD 522

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/508 (56%), Positives = 370/508 (72%), Gaps = 7/508 (1%)

Query: 10  VSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQA 69
           VS++ +E+ T  ++  T+ + V  +D  W   QDPTYFS+  KE +FI   M++QLLNQA
Sbjct: 32  VSTEDEEVTTIVSS--TKSTQV-TNDSPW---QDPTYFSSFGKELMFIATCMLAQLLNQA 85

Query: 70  GTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVV 129
           G T  L ++N+LSK+F+S  + Q WLMASFPL +GSFIL+SG++GDIYGLKK L+VGYV+
Sbjct: 86  GQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVI 145

Query: 130 TIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLI 189
            I+WS+I GL+ Y++S  FFI SRAFQG+GIAFILPNIMG+VG++Y  G+ RKN+VIS I
Sbjct: 146 VIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFI 205

Query: 190 GACAPIGATMGVLFSGLIGTLS-ERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSS 248
           GACAP G   G LF GLI T    +W W FYA+ I   +++ ++ + IPN +PTN+ G S
Sbjct: 206 GACAPTGGMFGGLFGGLIVTEDPNQWPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLS 265

Query: 249 MDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETKYANDPLI 308
           MDW            FNFVWNQ PIVGWD                 FF+YE+KYA  PL+
Sbjct: 266 MDWTGSALAIIGLILFNFVWNQAPIVGWDKPYIIVLLIISVIFLVAFFVYESKYAEVPLL 325

Query: 309 PRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIA 368
           PR    N  ++M LLAVF GWGSFGIWTFYY  F LNLR Y+P+W GG+YF+F+I+G +A
Sbjct: 326 PRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMA 385

Query: 369 AISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFP 428
           A  V ++IKR+ P+L+L  S++AFD G IM SV PV+Q+Y+++   M  IL FGMDLSFP
Sbjct: 386 AFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFP 445

Query: 429 ASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALY 488
           ASSIILSD LPM+ QGMAGSLV+T+INYS S+CLG+ GTVEHQINK+G+DLLKGYRAA+Y
Sbjct: 446 ASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVY 505

Query: 489 LGIGLASLGVFISALFMLENYLRMRRRN 516
           LG+GLASLGV IS  +MLEN     R++
Sbjct: 506 LGVGLASLGVVISVTYMLENLWNRHRKS 533

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/509 (54%), Positives = 352/509 (69%), Gaps = 5/509 (0%)

Query: 13  QSKELGTQSATAFTEHSDVQVDDKK-WPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGT 71
           ++KE    S+   T   D  +++   W   Q+  YF +  KEY FIF  M + LLNQAG 
Sbjct: 2   ENKEPIVSSSQKKTLSCDSLLENSTPW---QNEQYFQSHLKEYFFIFTCMFANLLNQAGQ 58

Query: 72  TQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTI 131
           TQ LS +N++S++F S    QTWLMASFPLVSGSFIL+SG+IGDIYGLKKT++ GY+  I
Sbjct: 59  TQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMI 118

Query: 132 IWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGA 191
           IW+L+CG   YT S  FFI+ RAFQGLGI+FILPNIMG+VGNIY  GT RKN+VISLIG 
Sbjct: 119 IWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGI 178

Query: 192 CAPIGATMGVLFSGLIGTLSER-WAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSMD 250
            AP GA MG L+ GLI T S R W W FYAY + A +N+ ++I+ +P  +PTNV   +MD
Sbjct: 179 TAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMD 238

Query: 251 WXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETKYANDPLIPR 310
           W            FNFVWNQGP+ GW                  F +YE K+   PL+PR
Sbjct: 239 WMGAIIGVVGLILFNFVWNQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLPR 298

Query: 311 PAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAI 370
               N ++L  L  +F GWGSFGIWTFYY+ F LNLR Y+PLWAG ++FMF+IWG IAA 
Sbjct: 299 EVTKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAF 358

Query: 371 SVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPAS 430
            VG+TI R+ P+++LF S L F  G +MLSVTP+ QTY+RM +GM IILSFGMDLSFPAS
Sbjct: 359 IVGFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPAS 418

Query: 431 SIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALYLG 490
           SIILSD LPM+ QGMAGSLV+T+INYS S+CLG+  TVE QINK G++LL+GYR+ALYL 
Sbjct: 419 SIILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSALYLA 478

Query: 491 IGLASLGVFISALFMLENYLRMRRRNVKE 519
           +GL  LG  ++ L +  +  R R+  + +
Sbjct: 479 VGLGGLGACVAFLNLCYDLWRKRKSRLDD 507

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/519 (53%), Positives = 365/519 (70%), Gaps = 7/519 (1%)

Query: 4   KRSNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMS 63
           K  ++ + S  +E+ T    A +  S+   +D  W   QDPTYFS+  KE +FI   M++
Sbjct: 25  KEEDKVIVSTDEEVTT---VASSSKSNQISNDSPW---QDPTYFSSFGKELMFIGTCMLA 78

Query: 64  QLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTL 123
           QLLNQAG T  L ++N+LSK+F S ++ Q WLMASFPL +GSFIL+SG++GDIYGLKK L
Sbjct: 79  QLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKML 138

Query: 124 LVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKN 183
           ++GYV+ I+WS+I GL+ Y+++  FFI  RAFQG+GIAFILPNIMG+VG++Y  G+ RKN
Sbjct: 139 MIGYVIIIVWSIISGLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKN 198

Query: 184 MVISLIGACAPIGATMGVLFSGLIGTLS-ERWAWTFYAYTITAAINMGLSIWVIPNTIPT 242
           +VIS+IGAC P GA  G +F GLI T    +W W FYA+ I   I+M ++ + IPN +PT
Sbjct: 199 LVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVPT 258

Query: 243 NVRGSSMDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETKY 302
           NV G SMDW            FNFVWN+ PI GWD                 FF+YE KY
Sbjct: 259 NVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIVLLVVSVFFLVAFFVYEIKY 318

Query: 303 ANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFL 362
           A  PL+P     N  ++M LLAVF GWGSFGIWTFYY  F LNLR Y+P+W GG+YF+F 
Sbjct: 319 AEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFA 378

Query: 363 IWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFG 422
           I+G IAA  V ++IKR+ P+L+L  +++AFD G IM SV PV+Q+Y+++   M  +L FG
Sbjct: 379 IFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCFG 438

Query: 423 MDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKG 482
           MDLSFPASSIILSD LPM+ QGMAGSLV+T+INYS S+CLG+  TVEHQINK+G ++L+G
Sbjct: 439 MDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVLEG 498

Query: 483 YRAALYLGIGLASLGVFISALFMLENYLRMRRRNVKEEV 521
           YRAA+YLGIGLASLGV IS  +MLE     R++  ++ +
Sbjct: 499 YRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQRKSL 537

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  548 bits (1411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/513 (54%), Positives = 367/513 (71%), Gaps = 7/513 (1%)

Query: 10  VSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQA 69
           +S++ +E+ T +++     S+   +D  W   QDP YFS+  KE +FI   M++QLLNQA
Sbjct: 32  ISTEDEEVTTVTSS---NESNQVTNDSPW---QDPIYFSSFGKELMFIATCMLAQLLNQA 85

Query: 70  GTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVV 129
           G T  L ++N+LSK+F+S ++ Q WLMASFPL +GSFIL+SG++GDIYGLKK LL+GYV+
Sbjct: 86  GQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLLIGYVI 145

Query: 130 TIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLI 189
            IIWS+I GL+ Y++S  FFI  RAFQGLGIAFILPNIMG+VG++Y  G+ RKN+VIS+I
Sbjct: 146 IIIWSIISGLSKYSNSDAFFITCRAFQGLGIAFILPNIMGLVGHVYKVGSLRKNLVISVI 205

Query: 190 GACAPIGATMGVLFSGLIGTLS-ERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSS 248
           GACAP G   G +F GLI T   E+W W FYA++I   I++ ++ + IPN +PTNV G S
Sbjct: 206 GACAPAGGMFGGVFGGLIVTEDPEQWPWVFYAFSIATFISLLMAWYSIPNNVPTNVHGLS 265

Query: 249 MDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETKYANDPLI 308
           MDW            FNFVWNQ PI GW                  FF+YE KYA  PL+
Sbjct: 266 MDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYIIVLLILSVFFLIAFFVYEIKYAEVPLL 325

Query: 309 PRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIA 368
           P     N  ++M LLAVF GWGSFGIWTFYY  F LNLR Y+P+W GG+YF+F+I+G IA
Sbjct: 326 PHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIA 385

Query: 369 AISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFP 428
           A  V ++IKR+ P+++L  +++AFD G IM SV PV+Q+Y+++   M  IL FGMDLSFP
Sbjct: 386 AFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFP 445

Query: 429 ASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALY 488
           ASSIILSD LPM+ QGMAGSLV+T+INYS S+CLG+  TVE QINK+G +LLKGYRAA+Y
Sbjct: 446 ASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGVTVERQINKSGQNLLKGYRAAIY 505

Query: 489 LGIGLASLGVFISALFMLENYLRMRRRNVKEEV 521
           LGIGLASLG+ IS  +MLEN+    + + K+ +
Sbjct: 506 LGIGLASLGLLISVTYMLENFWNKHKESEKKRL 538

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/517 (53%), Positives = 364/517 (70%), Gaps = 8/517 (1%)

Query: 4   KRSNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMS 63
                ++  Q  E+G+ S T     S +Q ++  W   Q+P YFS+ +KEY+F+   M++
Sbjct: 31  SERKTAIKEQDDEIGSDSTTT--SSSSLQENNSSW---QNPDYFSSSFKEYIFVATCMIA 85

Query: 64  QLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTL 123
            LLNQAG +Q LS +N++S +F SST  QTWLMASFPLVSGSFIL+SG++GDIYGLK+ +
Sbjct: 86  NLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRMM 145

Query: 124 LVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKN 183
           + G++  IIWSLICG T+Y  S  FFI++RAFQGLGI+FILPN+MG+VGNIY  GT RKN
Sbjct: 146 IGGFIFMIIWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRKN 205

Query: 184 MVISLIGACAPIGATMGVLFSGLIGTLS-ERWAWTFYAYTITAAINMGLSIWVIPNTIPT 242
           +VISLIG  AP G+  G L+ GLI T + ++W W FYAY + AA+ + +  + +P+ IPT
Sbjct: 206 VVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFYAYAVAAAVCLVMGYYTVPDNIPT 265

Query: 243 NVRGSSMDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETKY 302
           NV G +MDW            FNFVWNQGPIVGW+                 FF+YE KY
Sbjct: 266 NVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYIIVLLIVSVIFLIAFFVYEIKY 325

Query: 303 ANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFL 362
           A  PL+P+    N  +L  L  +F GWGSFGIWTFYYF F LNLREY+P+W+GG++F+F+
Sbjct: 326 AKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSGGTFFVFI 385

Query: 363 IWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFG 422
           I+G +AA +V  TIK++ P+++LF S + F CG I++SVTPV QTY+R   GM IIL FG
Sbjct: 386 IFGTVAATTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGMQIILVFG 445

Query: 423 MDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKG 482
           MDL FPASSIILSD LPM+ QGMA SLV+T++NYS S+CLG+  TVE QINK+GDDLLKG
Sbjct: 446 MDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQINKSGDDLLKG 505

Query: 483 YRAALYLGIGLASLGVFISALFMLENYLRMRRRNVKE 519
           YRAALY G+G+A LG  I+ L +  +     +RN K+
Sbjct: 506 YRAALYFGVGIAGLGACIAFLNVCHDI--WSKRNAKD 540

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/515 (51%), Positives = 350/515 (67%), Gaps = 4/515 (0%)

Query: 5   RSNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQ 64
            S++ + S  + + T S   F   + V+  +    S Q P YFS+   E+ FIF  +M Q
Sbjct: 32  NSSQKIDSSEQVVPTDSEKYF---ATVRSSESLSVSSQKPQYFSSKLHEWAFIFTCLMGQ 88

Query: 65  LLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLL 124
           LLNQAGTTQ++S++NI++++F S TS+Q WL ASFPLVSGSFILV G+ GDIYGLKK LL
Sbjct: 89  LLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLL 148

Query: 125 VGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNM 184
           +GY +  IWS+ICGLT YT S +FFI+++AFQGLG++FILPNI+G+VG IY  G+ +KN+
Sbjct: 149 LGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNI 208

Query: 185 VISLIGACAPIGATMGVLFSGLIGTLSER-WAWTFYAYTITAAINMGLSIWVIPNTIPTN 243
            IS IGA AP+GAT G LFSG++    ++ W WTFYA+ I + +      + +P+ +PTN
Sbjct: 209 TISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFVPDNVPTN 268

Query: 244 VRGSSMDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETKYA 303
                MDW            F+FVWNQ P+ GWD                 FF+YE  YA
Sbjct: 269 TNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAYIIVLLVISVILIIAFFIYEINYA 328

Query: 304 NDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLI 363
             PL+P+    N  ++M LLA+F GWG+FGIW+FYYF F LNLR ++P+W GG+YF F++
Sbjct: 329 EVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYFSFSLNLRHFSPVWTGGAYFAFIL 388

Query: 364 WGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGM 423
            G   A  VG+ IK I PS+IL +S+  F  G ++ +VTP DQTY+R   GMM++L  GM
Sbjct: 389 SGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFAVTPADQTYWRNTFGMMLLLPLGM 448

Query: 424 DLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGY 483
           DLSFPASSIILSD+LP E QGMAGSLV+TM+NYS S CLG+A TVE QIN +GDDLLKGY
Sbjct: 449 DLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSFCLGVATTVEKQINSSGDDLLKGY 508

Query: 484 RAALYLGIGLASLGVFISALFMLENYLRMRRRNVK 518
           RAA Y G+G+ +LG+ I++L+M E +    +   K
Sbjct: 509 RAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTK 543

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/488 (53%), Positives = 344/488 (70%), Gaps = 1/488 (0%)

Query: 34  DDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQT 93
           D+ +  S Q+P YF   ++E+ FIF+ M+ QLL+QAG TQTLS++N+L+K  DS++S+Q 
Sbjct: 55  DNDESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQA 114

Query: 94  WLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISR 153
           WLM+SFPL  GSFILVSG++GDIYGLKK LL GY++T +WS+ICGL+SY  +  FFI +R
Sbjct: 115 WLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITAR 174

Query: 154 AFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGL-IGTLSE 212
           AFQGLG+AF LPN++G++G IY  G  RKNM+IS+IGA +P GAT+G LF+GL +     
Sbjct: 175 AFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPTGATLGGLFAGLTVKYDKS 234

Query: 213 RWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSMDWXXXXXXXXXXXXFNFVWNQGP 272
            W W+FYA+ + + +N+ +S + IPN+IPTN+ G  MDW             NFV+NQ P
Sbjct: 235 NWPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAP 294

Query: 273 IVGWDTXXXXXXXXXXXXXXXXFFLYETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSF 332
           IVGW +                F +YE KYA  PLIP+    N  +LM L ++F GWGSF
Sbjct: 295 IVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSF 354

Query: 333 GIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAF 392
           GIWTFYYF F LNLR Y+PLWAG SYF+F+I G   AI  G TIK+I PS++   SM+ F
Sbjct: 355 GIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGF 414

Query: 393 DCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSLVST 452
             G I+ + TPV+QT+FR +LG M +L  GMD SFPASSIILSD LPM+ QGMAGSLV+T
Sbjct: 415 LGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNT 474

Query: 453 MINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALYLGIGLASLGVFISALFMLENYLRM 512
           +INYS S+CLG+AGTVE + N +G DLL GYRAA+Y  IGLA L V +S  +M+E   + 
Sbjct: 475 VINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKD 534

Query: 513 RRRNVKEE 520
           R  +++E 
Sbjct: 535 RVLSLEEN 542

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  518 bits (1333), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 264/465 (56%), Positives = 332/465 (71%), Gaps = 5/465 (1%)

Query: 26  TEHSDVQVDDK-KWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKN 84
            E  +V V +K KW   QDP YF   ++EYLF+ + M +QLLNQA T QTLS++N+LS +
Sbjct: 24  NEKCEVIVREKSKW---QDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVLSDS 80

Query: 85  FDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTS 144
           F+SS S QTWL+ASFPLV+GSFIL+SG+IGDIYGLKKTL+ GY+  IIWSLICG T Y+ 
Sbjct: 81  FNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSK 140

Query: 145 SVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFS 204
           S  F II+RAFQGLGIAF LPN++G +GNIY  G+ RKNMVISLI A AP+GA +G  F+
Sbjct: 141 SDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVGAAIGGAFA 200

Query: 205 GLIGTLS-ERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSMDWXXXXXXXXXXXX 263
           GLI T S  +W W+FYA+ I  + N+ +SI+ IP+ IPTNV G  MDW            
Sbjct: 201 GLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWIGSALIVTGLIL 260

Query: 264 FNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETKYANDPLIPRPAMHNHRLLMTLL 323
           FNF WNQGPIVGWD                 F  YE  +A  PLI R   H+  +++T+ 
Sbjct: 261 FNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFAPSPLIAREITHSRNMIITIF 320

Query: 324 AVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSL 383
            +F GWGS+GIW+FYYF FVLNLR Y+P+WAGGSYF+F I+G++A+  VG +IK+I   +
Sbjct: 321 TLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVGISIKKITAPV 380

Query: 384 ILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQ 443
           IL  SM+ F  G  +LSV PVDQ+YF++ L  M IL  G+D SFPA++IILSD LPME Q
Sbjct: 381 ILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATIILSDGLPMEYQ 440

Query: 444 GMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALY 488
           GMAGSL  TM+NYSMS+CLG+  TVE QINK+G D+LKGYR+A Y
Sbjct: 441 GMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEY 485

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  516 bits (1329), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 254/516 (49%), Positives = 354/516 (68%), Gaps = 4/516 (0%)

Query: 3   FKRSNESVSSQSKELGTQSATAFTEHSDVQVDD-KKWPSIQDPTYFSAPWKEYLFIFASM 61
           + + +++ +S ++ +G  S ++ +  SD+  ++ +    +  P YF     EYLFI + M
Sbjct: 49  YSQDSQTNTSMNEVIG--SISSVSNDSDINSENLQSENKVLSPKYFKNRTHEYLFIISCM 106

Query: 62  MSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKK 121
           +SQ ++QAG TQ LS++NIL++  ++  S+Q WLMASF L  GSFILVSG++GDIYGLKK
Sbjct: 107 VSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKK 166

Query: 122 TLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTR 181
            LL GY +  IWSLICG +SY+ +  FFI SRAFQGLG+AF+LPN +G++G IY  G+ +
Sbjct: 167 VLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMK 226

Query: 182 KNMVISLIGACAPIGATMGVLFSGLIGTLS-ERWAWTFYAYTITAAINMGLSIWVIPNTI 240
           KNM+I  +GA +PIGAT+G LF+G+IGT   ++W W+FY++ I +  NM LS + IPN I
Sbjct: 227 KNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNI 286

Query: 241 PTNVRGSSMDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYET 300
           PTN+   SMDW             NFV+NQ PIVGW +                F +YE 
Sbjct: 287 PTNIYNLSMDWIGAILGIFGLLILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEV 346

Query: 301 KYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFM 360
           KYA  PLIP+    N  +LM L A+F GWG+FG WTFYYF FVLN+R YT  WAGGSYF+
Sbjct: 347 KYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFI 406

Query: 361 FLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILS 420
           F++ G   A   G+ +K++PPS+IL++SM+ F  GC+ML+VTP+ Q+YF+ ILG+M +L 
Sbjct: 407 FIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLP 466

Query: 421 FGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLL 480
            G+DLSFPA+SIILSD LP++ QGMAGSLV T+ NYS S+CLG+AG+VE   N NG ++L
Sbjct: 467 IGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNIL 526

Query: 481 KGYRAALYLGIGLASLGVFISALFMLENYLRMRRRN 516
           KGYR A+     LA LG+ +S ++M+ N + +R  +
Sbjct: 527 KGYRNAMIFADALAGLGIIVSGIYMVINLITIRENS 562

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  514 bits (1325), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 253/491 (51%), Positives = 335/491 (68%), Gaps = 7/491 (1%)

Query: 34  DDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQT 93
           ++ KW   QDPTYF + W+EY FI   M++ LLNQAG TQTLS +N+L+ + +S  + +T
Sbjct: 57  NNSKW---QDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKT 113

Query: 94  WLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISR 153
           WLMASF L SGSFILVSG+IGDIYGLK T + G ++  IWS++CG++ YT +V FFII R
Sbjct: 114 WLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICR 173

Query: 154 AFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLI-GTLSE 212
           AFQGLG+AF+LPN+MG+VGNIY  G+ RKN+VIS IG  AP+G T G ++ GLI  +  +
Sbjct: 174 AFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKD 233

Query: 213 RWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSMDWXXXXXXXXXXXXFNFVWNQGP 272
           +W W F+A  I   IN+ + I+ IPN +PTN+    MDW             NFVWNQ P
Sbjct: 234 QWPWIFFATAIAVFINLIMGIYSIPNHVPTNIYNLKMDWIGSLLGVIGLILMNFVWNQAP 293

Query: 273 IVGWDTXXXXXXXXXXXXXXXXFFLYETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSF 332
           I GW                  FF+YE K A  PL+P     N  ++  ++++F GWG+F
Sbjct: 294 ISGWSKAYIIVILIVAVFFLVAFFIYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAF 353

Query: 333 GIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAF 392
           GIWTFYY+ F LNLR ++PLWAG ++F+F+I+G + AI+V +TI ++ PS++  LS + F
Sbjct: 354 GIWTFYYYAFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGF 413

Query: 393 DCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSLVST 452
            CG I+ SVT  DQTY+R  LGM IIL+ GMDLSFP SSIILSD LPM+ QGM+GSLV+T
Sbjct: 414 TCGNIIFSVTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNT 473

Query: 453 MINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALYLGIGLASLGVFISALFMLEN---Y 509
           + NY+ S+CLG+  T E Q N  G D+LKGYRAALY+ IGL +LG   S  +M E+    
Sbjct: 474 ITNYATSLCLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIR 533

Query: 510 LRMRRRNVKEE 520
            R RR+N K+E
Sbjct: 534 YRKRRQNEKKE 544

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  421 bits (1081), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 210/482 (43%), Positives = 303/482 (62%), Gaps = 1/482 (0%)

Query: 40  SIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASF 99
           +++ P  F   ++E+ F+   ++ Q L+Q G TQ LS +NIL++   ++  +Q WLMA+F
Sbjct: 109 NLRRPDIFKNRFQEFGFVLVGVIGQFLSQVGLTQVLSTMNILAEELHTTKMRQPWLMAAF 168

Query: 100 PLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLG 159
           PL  G  IL+SG++GDI+GLKK LL+GY++T IW+LICG +SY  S + FI+SR FQGLG
Sbjct: 169 PLGLGCTILISGRLGDIFGLKKVLLLGYIITTIWTLICGFSSYAHSDDLFIVSRTFQGLG 228

Query: 160 IAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGL-IGTLSERWAWTF 218
           +A  LPN+  ++G IY     +KNM+  +IGA +PIGAT+G +F+GL +    + W W+F
Sbjct: 229 LACALPNMFELIGIIYKPHCFKKNMIFCIIGAMSPIGATLGGIFAGLSVKYNIKNWPWSF 288

Query: 219 YAYTITAAINMGLSIWVIPNTIPTNVRGSSMDWXXXXXXXXXXXXFNFVWNQGPIVGWDT 278
           Y++ I A +N  ++ + IPN I  N +G  MDW             NFV+NQ PI GW +
Sbjct: 289 YSFAIVAFLNGIIAWFCIPNDIEKNPQGLKMDWIGSALGLFGLVVLNFVFNQTPIDGWSS 348

Query: 279 XXXXXXXXXXXXXXXXFFLYETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFY 338
                           F +YE   AN PLIP+    N+RL++ LL +F GWG F IWTFY
Sbjct: 349 AYLIVLLVVSVVALILFVIYELTMANFPLIPKGIHSNYRLILILLTLFCGWGGFAIWTFY 408

Query: 339 YFCFVLNLREYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIM 398
           YF F LNLR Y+PLWA  S F+ +I G I  I     ++R+ P ++LF SML F  G I+
Sbjct: 409 YFAFQLNLRHYSPLWASSSNFVLIISGTIYTIICCLAVQRMKPPILLFFSMLGFLGGNIL 468

Query: 399 LSVTPVDQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSM 458
            +VTP+ QT+FR + G M +   GM  SFP++S++ ++ LP   + MAGSLV+  INY+ 
Sbjct: 469 FAVTPIHQTFFRNMFGSMFLFPLGMVFSFPSASMMTAETLPTHYKSMAGSLVNVAINYAT 528

Query: 459 SMCLGIAGTVEHQINKNGDDLLKGYRAALYLGIGLASLGVFISALFMLENYLRMRRRNVK 518
           S+C+G+AG+     N +G DLL G+RAA YL IGL+   VF+S L+M+ +    R + +K
Sbjct: 529 SICVGMAGSANVNHNNHGQDLLHGFRAASYLAIGLSGFSVFLSGLYMIGSIWTDRNQKMK 588

Query: 519 EE 520
           E 
Sbjct: 589 EN 590

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  338 bits (868), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 190/513 (37%), Positives = 300/513 (58%), Gaps = 17/513 (3%)

Query: 15  KELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQT 74
           K+  T + T   +  +V +D+     IQD T  S  W E  F+     +QL+ QAG  Q+
Sbjct: 10  KDFDTNTGT-LKKDDEVVLDEFD---IQDETPGSLLW-ETAFVGVLCSAQLMTQAGLGQS 64

Query: 75  LSLINILSKNFDSSTSQQ-TWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIW 133
           L+ ++I+ K+F ++   Q +W  +++ L  G+FIL++G++GDI+G KK  ++G+    +W
Sbjct: 65  LAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALW 124

Query: 134 SLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACA 193
           SL+ G + Y++ + FF   RAFQG+G AF+LPN + I+G  Y +G  RKNMV SL GACA
Sbjct: 125 SLLAGFSVYSNKI-FFDCCRAFQGMGPAFLLPNAIAILGRTYKSGK-RKNMVFSLFGACA 182

Query: 194 PIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSS----- 248
           P G  +G +FS L+G L+  W W ++   I          ++IP+T   +   SS     
Sbjct: 183 PGGFVLGAVFSSLLGQLA-WWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLE 241

Query: 249 -MDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETKYANDPL 307
            +D+            FNF WNQGP+VGW T                F   E++ A  PL
Sbjct: 242 RVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESR-AAFPL 300

Query: 308 IPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGII 367
           +P  A+ +    + L  +  GW SFGIW FY + F+ + R  TPL +   +    + G  
Sbjct: 301 LPFAALSSDTAFV-LSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFC 359

Query: 368 AAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSF 427
           AA++ GY + R PPS ++  +M AF  G I+++  PV QTY+      +I++ +GMD+SF
Sbjct: 360 AALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSF 419

Query: 428 PASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAAL 487
           PA++I+LSD +P E+QG+A SLV+T++NYS+S+ LGIAGT+E  +N  G   LKGYR + 
Sbjct: 420 PAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSW 479

Query: 488 YLGIGLASLGVFISALFMLENYLRMRRRNVKEE 520
           Y+GIGL+ LG+F++A++    + + ++R  +++
Sbjct: 480 YMGIGLSGLGIFVAAIYAWSTFKKSKKRTSEKQ 512

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  325 bits (834), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 189/522 (36%), Positives = 298/522 (57%), Gaps = 20/522 (3%)

Query: 7   NESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLL 66
           + S S   K L T +     E   +   D     IQD    S  W E  F+     +QL+
Sbjct: 2   STSSSVTQKNLDTNAEALKKEDKVLSEFD-----IQDERPKSLLW-ESAFVGVLCSAQLM 55

Query: 67  NQAGTTQTLSLINILSKNFDSSTSQQ-TWLMASFPLVSGSFILVSGKIGDIYGLKKTLLV 125
            QAG  Q+L+ ++I+  +F ++ + Q +W  +++ L  G+FIL++G++GDI+G KK  ++
Sbjct: 56  TQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVL 115

Query: 126 GYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMV 185
           G+    +WSL+ G + Y++ + FF   RAFQG+G AF+LPN + I+G  Y  G  RKNMV
Sbjct: 116 GFFWYALWSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMV 173

Query: 186 ISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVR 245
            SL GA AP G  +G +FS ++G L+  W W ++   I   +      +VIP+T P   R
Sbjct: 174 FSLFGASAPGGFFLGAVFSSMLGQLA-WWPWAYWIMGIACFVLAVAGYFVIPHT-PMPSR 231

Query: 246 GSS-------MDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLY 298
            +S       +D+            FNF WNQGP+VGW T                F   
Sbjct: 232 DASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYI 291

Query: 299 ETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSY 358
           E++ A  PL+P  A+ +    + L  +  GW SFGIW FY + F+ + R  TPL +   +
Sbjct: 292 ESR-AAFPLLPFAALSSDTAFV-LSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQF 349

Query: 359 FMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMII 418
               I G  AA++ G+ +   PPS ++  +M AF  G I+++  PV QTY+      +I+
Sbjct: 350 SPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIV 409

Query: 419 LSFGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDD 478
           + +GMD+SFPA++I+LSD +P E+QG+A SLV+T++NYS+S+ LGIAGT+E ++N  G  
Sbjct: 410 MPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAK 469

Query: 479 LLKGYRAALYLGIGLASLGVFISALFMLENYLRMRRRNVKEE 520
            LKGYR + Y+GIGL+ LG+F++A +    +++ ++R  +++
Sbjct: 470 PLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSKKRISEKQ 511

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  324 bits (830), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 176/475 (37%), Positives = 282/475 (59%), Gaps = 12/475 (2%)

Query: 53  EYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQ-TWLMASFPLVSGSFILVSG 111
           E  F+     +QL+ QAG  Q+L+ ++I+  +F ++   Q +W  +++ L  G+FIL++G
Sbjct: 43  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAG 102

Query: 112 KIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIV 171
           ++GDI+G KK  ++G+    +WSL+ G + Y++ + FF   RAFQG+G AF+LPN + I+
Sbjct: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQI-FFDCCRAFQGMGPAFLLPNAIAIL 161

Query: 172 GNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGL 231
           G  Y  G  RKNMV SL GA AP G  +G +FS ++G L+  W W ++   I   +    
Sbjct: 162 GRTYKPGR-RKNMVFSLFGASAPGGFVLGAVFSSMLGQLA-WWPWAYWLMGIACFLLAVA 219

Query: 232 SIWVIPNTIPTNVRGSS------MDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXX 285
             ++IP+T   N   +S      +D+            FNF WNQGP+VGW T       
Sbjct: 220 GYYLIPHTPMPNRDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALL 279

Query: 286 XXXXXXXXXFFLYETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLN 345
                    F   E++ A  PL+P  A+ +    + L  +  GW SFGIW FY + F+ +
Sbjct: 280 IVGTVFLIIFAFIESR-AAFPLLPFAALSSDTAFV-LSCIAAGWASFGIWIFYTWQFMED 337

Query: 346 LREYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVD 405
            R  TPL +   +    I G  AA+  G+ +   PPS ++F +M AF  G I+++  PV 
Sbjct: 338 SRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVH 397

Query: 406 QTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIA 465
           QTY+      +I++ +GMD+SFPA++I+LSD +P E+QG+A SLV+T++NYS+S+ LGIA
Sbjct: 398 QTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIA 457

Query: 466 GTVEHQINKNGDDLLKGYRAALYLGIGLASLGVFISALFMLENYLRMRRRNVKEE 520
           GT+E  +N  G ++LKGYR + YLGIGL+  G+F++A + +  +++ ++R  +++
Sbjct: 458 GTIESNVNDGGANVLKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSKKRVSEKQ 512

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  322 bits (825), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 181/505 (35%), Positives = 298/505 (59%), Gaps = 14/505 (2%)

Query: 23  TAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILS 82
           +A T  +D +V   ++  +QD T  S  W E  F+     +QL+ QAG  Q+++ ++I+ 
Sbjct: 15  SAETTKTDDEVLLNQF-ELQDETPGSLVW-EAAFVGVLCSAQLMTQAGLGQSIAPLHIIG 72

Query: 83  KNFDSSTSQQ-TWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTS 141
            +F ++   Q +W  +S+ L  G+FIL++G++GDI+G +K  ++G+    +WSL+ G + 
Sbjct: 73  DSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFWYALWSLLAGFSV 132

Query: 142 YTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGV 201
           Y++ + FF   RAFQG+G AF+LPN + I+G  Y  G  RKNMV SL GA AP G  +G 
Sbjct: 133 YSNKI-FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGK-RKNMVFSLFGASAPGGFVLGA 190

Query: 202 LFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNT-IPTNVRGS-----SMDWXXXX 255
           +FS ++G L+  W W ++   I   +      +VIP+  +P+    S      +D+    
Sbjct: 191 VFSSMLGQLA-WWPWAYWIMGIACFLLAVAGYFVIPHVQMPSRDSPSFNMLERVDFAGSV 249

Query: 256 XXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETKYANDPLIPRPAMHN 315
                   FNF WNQGP+VGW+T                F   E++ A  PL+P  A+ +
Sbjct: 250 TGVIGLILFNFAWNQGPVVGWETPYTYVLLIVGTVFLGVFVFIESR-AAYPLLPFAALSS 308

Query: 316 HRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAISVGYT 375
               + L  +  GW SFGIW FY + F+   R+ +PL +   +    I G  AA++ G+ 
Sbjct: 309 DAAFV-LGCIAAGWSSFGIWIFYTWQFMEESRKQSPLLSSAQFAPVAISGFCAAVTTGFL 367

Query: 376 IKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASSIILS 435
           +   P S ++  +M AF  G I+++  PV QTY+      +I++ +GMD+SFPA++I+LS
Sbjct: 368 LSHTPASTVMLFAMTAFTVGIILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLS 427

Query: 436 DELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALYLGIGLAS 495
           + +P E+QG+A SLV+T++NYS+S+ LGIAGT+E Q+N  G + LKGYR + Y+GIGL+ 
Sbjct: 428 NSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESQVNDGGANALKGYRCSWYMGIGLSG 487

Query: 496 LGVFISALFMLENYLRMRRRNVKEE 520
           LG+F++A++    +L+ +++  +++
Sbjct: 488 LGIFVAAVYASSTFLKSKKKASEKQ 512

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  313 bits (803), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 183/520 (35%), Positives = 287/520 (55%), Gaps = 18/520 (3%)

Query: 7   NESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLL 66
            +   +Q K+ G    +  T     ++       IQ P        E  F+     +QL+
Sbjct: 4   TDKEENQKKDDGLTRES--THDQGQELSQPHHNGIQKPESLLG---EAAFVGVICGAQLM 58

Query: 67  NQAGTTQTLSLINILSKNFDSSTSQQ-TWLMASFPLVSGSFILVSGKIGDIYGLKKTLLV 125
            QAG  Q+++ ++I+  +F +    Q +W  A++ L  G+FIL++G++GD+YG KK  ++
Sbjct: 59  TQAGLGQSIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFII 118

Query: 126 GYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMV 185
           G+    +WSL+ G + Y++ + FF   RAFQG+G A +LPN + I+G  YV G  RK M+
Sbjct: 119 GFFWYALWSLLAGFSVYSNQI-FFDCCRAFQGIGPALLLPNAIAILGRTYVPGR-RKAMI 176

Query: 186 ISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPN----TIP 241
           +SL GA AP G  +G +FS + G L+  W W ++A  I         I VIP      + 
Sbjct: 177 LSLFGATAPAGFVLGAVFSSIFGQLT-WWPWAYWAMGIVCFFLAVAGILVIPRMPLPELD 235

Query: 242 TNVRG-SSMDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYET 300
           T+V     +D              NF WNQGP+VGW T                F   E+
Sbjct: 236 TSVSTYQRLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLLIVSAVFLCVFAFIES 295

Query: 301 KYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFM 360
           + A  PL+P  A+ +    + L  V  GW SFGIW +Y++ F+  LR ++PL     +  
Sbjct: 296 R-APHPLLPLSALSSDAAFV-LGCVGAGWSSFGIWIYYFWLFLEELRGHSPLLTSAQFAP 353

Query: 361 FLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILS 420
             I G+ AA++ G+ I R+  SL++  +M AF  G I+++  PV Q Y+      +I++ 
Sbjct: 354 VAISGLCAALTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVKQVYWAQAFVSIIVMP 413

Query: 421 FGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLL 480
           +GMD+SFPA++I+LSD +P E+QG+A SLV+ ++NYS+S+ LG+AGTVE ++N  G +LL
Sbjct: 414 WGMDMSFPAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLAGTVEGRVNNGGANLL 473

Query: 481 KGYRAALYLGIGLASLGVFISALFMLENYLRMRRRNVKEE 520
           KGYR A Y+GIGL+  G+ I+  FM E +   + + +  E
Sbjct: 474 KGYRGAWYMGIGLSGFGILIA--FMYEYHTFKKSKKMPSE 511

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  313 bits (801), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/505 (34%), Positives = 293/505 (58%), Gaps = 17/505 (3%)

Query: 27  EHSDVQVDDKKWPSIQ-DPTYFSAPW---KEYLFIFASMMSQLLNQAGTTQTLSLINILS 82
           E   V++ +++  S+Q   ++   P    +E LF+     +QL+ QAG  Q+++ + I+ 
Sbjct: 9   EAQFVELKNEEGESLQLVQSHVEKPQSLMREALFVGILSCAQLMTQAGLAQSIAPVRIIG 68

Query: 83  KNFD-SSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTS 141
            +F  S+  Q +W  A++ L  G+FIL++G++GD++G KK  +VG++   +WSL+ G + 
Sbjct: 69  NSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSV 128

Query: 142 YTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGV 201
           Y++ + FF   RA QG+G AF+LPN + I+G  Y  G  RK MV S+ GA AP G  +G 
Sbjct: 129 YSNQI-FFDCCRALQGIGPAFLLPNSIAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGS 186

Query: 202 LFSGLIGTLSERWAWTFYAYTITAAINMGLS-IWVIPNTIPTNVRGSS-----MDWXXXX 255
           +FS +   L+  W W ++A   TA + +G++ I VIP   P  +  S+     +D     
Sbjct: 187 VFSSIFSQLA-WWPWAYWAMG-TACLVLGVAGIIVIPQAPPPKIDISAGILERIDAAGAT 244

Query: 256 XXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETKYANDPLIPRPAMHN 315
                    NF WNQGP+VGW T                F L E++ A  PL+P  A+  
Sbjct: 245 TGILGLALVNFAWNQGPVVGWQTPYTYALLIVGFVFLLVFSLIESR-ARFPLLPFAALST 303

Query: 316 HRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAISVGYT 375
             L   L  +  GW SFGIW FY++ F+ + R  +PL     +    I G+ AA++ GY 
Sbjct: 304 D-LAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYI 362

Query: 376 IKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASSIILS 435
           +  +P   ++ ++M+AF  G ++++  P++QTY+      +II+ +GMD+SFPA++I++S
Sbjct: 363 LSHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMIS 422

Query: 436 DELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALYLGIGLAS 495
           + +P E+QG+A SLV+T++NYS+S+ LG AGT+E ++N  G + L+GYR A Y+GIGL+ 
Sbjct: 423 NAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSG 482

Query: 496 LGVFISALFMLENYLRMRRRNVKEE 520
           LGV ++ ++      + +   + E+
Sbjct: 483 LGVLVAIVYAWSTLKKFKEEQLSEK 507

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  295 bits (755), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 176/488 (36%), Positives = 279/488 (57%), Gaps = 13/488 (2%)

Query: 41  IQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFD-SSTSQQTWLMASF 99
           +Q+   +++  KE   I     +QL+ QAG  Q++  + I+  +F   +  Q +W  ++F
Sbjct: 17  LQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAF 76

Query: 100 PLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLG 159
            L  G+FIL++G++GD +G KK  ++G++   +WS++ G + Y++ + FF   RAFQG+G
Sbjct: 77  SLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQI-FFDCCRAFQGIG 135

Query: 160 IAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFY 219
            AF LPN + I+   Y  G  ++NM+ SL GACAP G  +G +FS L+   +  W W ++
Sbjct: 136 PAFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLLSEFA-WWPWAYW 193

Query: 220 AYTITAAINMGLSIWVIPNTIPTNVRGSS-----MDWXXXXXXXXXXXXFNFVWNQGPIV 274
              IT  +       VIP+  P +          +D             FNF WNQGP+V
Sbjct: 194 IMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVV 253

Query: 275 GWDTXXXXXXXXXXXXXXXXFFLYETKYANDPLIP-RPAMHNHRLLMTLLAVFFGWGSFG 333
           GW+T                F   E++ A  PL+P R    +   +M  +A   GW SFG
Sbjct: 254 GWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKLSSDTIFVMGCIAA--GWSSFG 310

Query: 334 IWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFD 393
           IW +Y +  + NLR+  PL +   +    I G+ AA+S  + + R  PS ++ ++M+AF 
Sbjct: 311 IWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFT 370

Query: 394 CGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTM 453
            G I+++  PV QTY+      +I++ +GMD+SFPA++IILS  +P  +QG+A SLV+T+
Sbjct: 371 VGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTI 430

Query: 454 INYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALYLGIGLASLGVFISALFMLENYLRMR 513
           INYS+S+ LG AGT+E QI+   DDLLKGYR A Y+GIGLA LG+ ++  + + +Y R++
Sbjct: 431 INYSISIGLGFAGTIESQISDGEDDLLKGYRGAYYMGIGLAGLGLGVAISYAIFHYSRLK 490

Query: 514 RRNVKEEV 521
           R   ++ V
Sbjct: 491 RSLSEKYV 498

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  292 bits (747), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 175/491 (35%), Positives = 267/491 (54%), Gaps = 13/491 (2%)

Query: 16  ELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTL 75
           E   +S +   E S    D   W    +   F    KEY F+F  +M+Q  NQAG T  L
Sbjct: 16  ECTERSISCNQESSKEAYDRCSWLKSSN---FHFLCKEYAFVFTGVMAQAFNQAGGTMIL 72

Query: 76  SLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSL 135
            L+N+LS +F        +L+ S+P+V GSF+L+ G++G+++G K+TLL GY++ I+ SL
Sbjct: 73  PLVNVLSDSF-----HGKFLLNSYPMVCGSFMLIGGRLGEVHGYKETLLGGYIILILSSL 127

Query: 136 ICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYV--AGTTRKNMVISLIGACA 193
           + GL+ Y+ S  F++I RAFQG+G+A ILPN        Y   A   RK ++ ++IG  A
Sbjct: 128 LGGLSRYSKSSIFYVICRAFQGVGMALILPNFSAAYDYRYQSQAKAHRKTILSTIIGCGA 187

Query: 194 PIGATMGVLFSGLIGTLSE-RWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSMDWX 252
             GA +G   SG+  T SE  W+W +Y YTI A + + LS + +P+ I    +       
Sbjct: 188 STGAFLGTFLSGICVTRSESNWSWAYYTYTIAATLTLALSYYSVPDNITKKNKPCLNGLG 247

Query: 253 XXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETKYANDPLIPRPA 312
                       N   N   +   +                 F ++E K++ DP+  +  
Sbjct: 248 WFSNRSCGLLMLNVACNLAAVASSNWSHIIVLLVVFVCLLLLFLVFELKFSEDPVFSKEL 307

Query: 313 MHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAISV 372
             N  + + L ++FFGWG++GIW+ Y+F F+LNLR Y+PL AG +Y   +I G +A I +
Sbjct: 308 FTNASVSLVLASIFFGWGTYGIWSGYFFRFLLNLRNYSPLAAGSTYLTLVIGGYVAEIGI 367

Query: 373 GYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASSI 432
              +KR  P L L  S L F C  I+LSVTP+ Q+YFR  LG MI L+ G+D SFP+S+I
Sbjct: 368 SMLVKRTGPKLFLLFSSLGFTCSIIILSVTPIHQSYFRSTLGSMIFLALGLDFSFPSSAI 427

Query: 433 ILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALYLGIG 492
           IL +ELP +   M   L + + NY++S   GI  +    ++    +L+K YR   Y  IG
Sbjct: 428 ILQNELPSKYHEMTAVLTNGIFNYAISFWPGICNSALRSLSS--IELIKYYRYVYYFAIG 485

Query: 493 LASLGVFISAL 503
           L+++G+F + +
Sbjct: 486 LSAIGLFAAGI 496

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  216 bits (550), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 131/189 (69%), Gaps = 33/189 (17%)

Query: 61  MMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLK 120
           MMSQLLNQ GTTQTL LIN+LS+ F+SST++QT L+AS PLVSGSFILVSGK+GDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 121 KTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTT 180
            TLL GY   I+WS ICGLT Y  SV+FF+I+RAFQGLG+AF+LPN+MG V N+Y+AG+ 
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 181 RKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNTI 240
           RKNMV                                 YAYT+  ++NM L +W +P  I
Sbjct: 121 RKNMV---------------------------------YAYTVAVSLNMALCVWALPWNI 147

Query: 241 PTNVRGSSM 249
           PTNVRG +M
Sbjct: 148 PTNVRGQAM 156

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 28/44 (63%), Gaps = 6/44 (13%)

Query: 437 ELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLL 480
            +P   +G A      M+ YSM MCLGIAGTVEH+++K G D L
Sbjct: 146 NIPTNVRGQA------MLGYSMPMCLGIAGTVEHRVHKGGADRL 183

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  203 bits (516), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 147/542 (27%), Positives = 251/542 (46%), Gaps = 28/542 (5%)

Query: 3   FKRSNESVSSQSKEL---GTQSATAFTEHSDVQVDD----KKWPSIQDP-------TYFS 48
           F+  N+ V+     +   G   ++     SD  V D       P   DP       T   
Sbjct: 14  FRLENKEVNGTYDSINFNGGDDSSKTRRDSDDNVSDINKSAPAPEEHDPPCTGEEATLNM 73

Query: 49  APWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFD-SSTSQQTWLMASFPLVSGSFI 107
           +   E +F+     SQ+L  AG  Q +  ++++ + F  +  S   W    +    GSF+
Sbjct: 74  SLLHEIIFVLLVSSSQVLGLAGAVQGIPQMDVIVEWFKLTHPSDSGWCNGGYATTYGSFV 133

Query: 108 LVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNI 167
           L++GK+GD+ G K   L+GY    +WSL+ G + Y  S  FF   RA QG+G AF   + 
Sbjct: 134 LIAGKMGDMNGHKSMFLIGYAWLALWSLLTGFSRYCPSSHFFFFCRAAQGIGAAFTFTSA 193

Query: 168 MGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAI 227
           + I+G  Y     RKN + S  GAC   G  +G++FS L   L+  W+W +++  I   +
Sbjct: 194 LSILGKSY-PPCKRKNFIFSFFGACGSFGVVLGMVFSALFTQLA-HWSWAYWSMAIACVV 251

Query: 228 NMGLSIWVIPNTIPTNVRGSSM---DWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXX 284
            + LSI+ IP  +      S++   D+            F+  WNQ P  G+        
Sbjct: 252 IIILSIFFIPGDVVEKHETSNVFYFDYLGAFLFVTGLVLFSVAWNQAPTYGFGRTYVYVL 311

Query: 285 XXXXXXXXXXFFLYETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVL 344
                         ETK  +DPL+P   + +   L  LLA+FF + SF +W  Y F F L
Sbjct: 312 LIVSVVILALAMYVETK-VDDPLLPWTHI-SANTLKVLLAIFFAYASFTMWAAYTFRFNL 369

Query: 345 NLREYTPLWAGGSYFMFLIWGIIAAISVGYTIK-RIPPSLILFLSMLAFDCGCIMLSVTP 403
             +  T L A        + G+ AA+     +   +   + + +S+LAF    I+++   
Sbjct: 370 MAKGDTLLLAAAKMTPMAVSGVFAALFSALLLNIHVQVQIRMLISLLAFLVPPILMATMG 429

Query: 404 VDQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLG 463
             QTY+  +    I++SFG+D+SFP+++++LS+ +P + +G+  SLV  ++NY+ ++   
Sbjct: 430 AGQTYWGEVFVTTIVISFGLDISFPSATLLLSNRIPDKFKGLGASLVGAVLNYATALGPP 489

Query: 464 IAGTV-EHQ----INKNGDDLLKGYRAALYLGIGLASLGVFISALFMLENYLRMRRRNVK 518
            A +V  +Q    +   G+   K      Y+GIG A LG  ++   ++  Y ++  +  +
Sbjct: 490 TAASVLRYQCPDCMAHKGNAFTKTINIIGYVGIGTAGLGTLVAIFGVITEYPKVAGKKGE 549

Query: 519 EE 520
           + 
Sbjct: 550 DR 551

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  179 bits (454), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 143/536 (26%), Positives = 252/536 (47%), Gaps = 28/536 (5%)

Query: 1   MWFKRSNESVSS---QSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFI 57
           M F  S E+++S   Q  E  T        H+++     + P        +  +KE + +
Sbjct: 1   MSFHESEETLTSSKLQPHE-PTSPVKVVPSHNEILSKTDEHP-------LNMQFKEIIIV 52

Query: 58  FASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQT---WLMASFPLVSGSFILVSGKIG 114
                 Q ++  G  Q +  +  ++  F     Q     W  A++   + +F++++GK+G
Sbjct: 53  LLISSGQFISLLGAVQGIPQMASIASTFSLRPDQNLELGWCNAAYATTATTFVIIAGKLG 112

Query: 115 DIYGLKKTLLVGYVVTIIWSLICGLTSYT-SSVEFFIISRAFQGLGIAFILPNIMGIVGN 173
           DI G K   + GY    +WSL+ G + Y  ++  FF   R  QG+G AF+ P  + ++G 
Sbjct: 113 DINGHKNMFIFGYAWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPTGLALLGK 172

Query: 174 IYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSI 233
            Y     RKN V S  GAC P G   G +FS L   L+  WAWT+++  +T  I   LS 
Sbjct: 173 HY-PPCKRKNYVFSFYGACGPFGIVAGSVFSALFTQLTT-WAWTYWSMAVTCLIITILSY 230

Query: 234 WVIP-NTIPTNVRGS--SMDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXX 290
             IP +  P   R +  S D+            F+ VWNQ P+  +              
Sbjct: 231 IFIPKDNTPKRERSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVYSLLIVSVV 290

Query: 291 XXXXFFLYETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYT 350
                 + +++   DPLIP  +M ++ ++  L+ VFFG+  F IW FY + F L  +  +
Sbjct: 291 FMTMALIIDSR-VKDPLIPWKSMCSN-VIKALIVVFFGFLGFTIWLFYSWRFYLVAKNDS 348

Query: 351 PLWAGGSYFMFLIWGIIAAI-SVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYF 409
            L A   +    I GI AA  SV    K++P  L L  ++ AF    I++S   + +TY+
Sbjct: 349 LLLAAAKFIPLGISGIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILISTMTLQETYW 408

Query: 410 RMILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTV- 468
                  +I++ G+D++FP+++++LS+ +  E QG+A +L +T +NY  ++  G+A  + 
Sbjct: 409 GNAFVATVIIAIGLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTALGPGVATLII 468

Query: 469 ----EHQINKNGDDLLKGYRAALYLGIGLASLGVFISALFMLENYLRMRRRNVKEE 520
               +  + ++    +     A Y+ IG A + V ++    +  Y + R  +++E+
Sbjct: 469 TYQCDDCLARSDGRFVHAVHIAGYVAIGTAGIAVVVAIFGSITEYYKERMDDLREK 524

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  153 bits (387), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 134/521 (25%), Positives = 236/521 (45%), Gaps = 39/521 (7%)

Query: 6   SNESVSS-QSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQ 64
           SN + SS  S+    Q +      +  Q++    P    P+      +E +FI     SQ
Sbjct: 29  SNSTASSLHSQRTKEQCSNLQPAQAQDQLESMNPPP--GPSRL----RECMFIVIIASSQ 82

Query: 65  LLNQAGTTQTLSLINILSKNFD---SSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKK 121
            ++ A  +Q +  ++ ++  F      + +  W  A+F +  G+FI+ +GK+ D+ G K 
Sbjct: 83  FISLAAASQAILQMDAITAWFQLPADRSLEAGWANAAFAITCGTFIIPAGKLCDLIGSKT 142

Query: 122 TLLVGYVVTIIWSLICGLTSYTSS--VEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGT 179
             + GY    +WSL+ G++ Y       FF   R  QG+G A + P+ + ++G  Y   +
Sbjct: 143 VFIFGYAWYTLWSLLVGISRYAPKGQATFFFFGRGCQGIGAAALFPSSLALLGK-YYPPS 201

Query: 180 TRKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNT 239
            +KN+V SL G C P+G  +G +FS +   L+  W+W +++  I +A    +S + IP  
Sbjct: 202 CKKNIVFSLYGFCVPLGVVVGGVFSAIFTQLAH-WSWNYWSMAIVSAFFTLISCFYIP-- 258

Query: 240 IPTNVRGSS-------------MDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXX 286
            P  +  S               D+            F   WNQ     + +        
Sbjct: 259 -PDEIIKSEEQKKKRAWFHLPKFDYLGTFLYVASLLLFAVCWNQATGFKFKSVQVYVTLI 317

Query: 287 XXXXXXXXFFLYETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNL 346
                     + E  Y +DP+IP   +H  + +  LL VFF + SF IW FY + +   +
Sbjct: 318 VSLVCFVAMVIVEF-YVDDPIIPARKIHP-QTIKALLVVFFSYLSFTIWLFYLWKYFTVV 375

Query: 347 REYTPLWAGGSYFMFLIWGIIAAI-SVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVD 405
           R  T L     +    I G IAA+ S+      +P  + L     +F    I+       
Sbjct: 376 RNDTVLLGAAKFVPLSIAGFIAALFSILLISTAVPVQIRLLAGACSFLLAHILFITLSRT 435

Query: 406 QTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIA 465
           ++Y+      +II+S G+D+SFP+++++LS+ +P E +G++ +LV T +NY   +   IA
Sbjct: 436 ESYWARPFLTIIIISIGLDISFPSATLLLSNGVPQELRGISAALVGTALNYGTGIGPPIA 495

Query: 466 GT-VEHQINK-----NGDDLLKGYRAALYLGIGLASLGVFI 500
            T + +Q +K     + D  +K    A  +GIG + + V +
Sbjct: 496 QTIIGYQCDKCMASGDMDQFVKAIHIAAAVGIGASGIAVVV 536

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  152 bits (385), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 136/559 (24%), Positives = 246/559 (44%), Gaps = 77/559 (13%)

Query: 9   SVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQ 68
           ++ + ++ +  Q +   T  S +++       +Q PT  ++   + +FIF    SQ +  
Sbjct: 34  NIPTVTETVQDQQSHKVTHSSLIRLQK-----LQSPT--NSYLNDIIFIFLICSSQFITL 86

Query: 69  AGTTQTLSLINILSKNFD---SSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLV 125
           A  +Q +  ++ LS  F    +ST Q  W+ ASF +  G+FI+++GK+ DI   +   + 
Sbjct: 87  ASASQAILQMDSLSVWFKIPPTSTLQLGWVNASFAMTCGAFIILAGKLCDILNPRIIFIS 146

Query: 126 GYVVTIIWSLICGLTSYT-SSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAG------ 178
           GYV   +W+LI G  SY   ++ F  I R  QG+G A + P+ + ++   Y         
Sbjct: 147 GYVWFSLWTLITGFASYVPKNMIFLYICRGCQGIGGALLFPSALILLNQYYTVPEPSPSQ 206

Query: 179 ----------------------------------------TTRKNMVISLIGACAPIGAT 198
                                                    T K++  SL GACAP+G  
Sbjct: 207 SQSKSPTTSAPSPSHDIEKNLSSDDDNDGDSSIADDSDIICTSKSIAFSLYGACAPLGIV 266

Query: 199 MGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSS---------M 249
           +G +FS +   L+  W W +++ +I   +   LS + +   IP     S+          
Sbjct: 267 IGGIFSAIFTQLAT-WPWNYWSMSIVTTLLSILSYFYVVVPIPVEKLDSNPNSLKNWKNF 325

Query: 250 DWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETKYANDPLIP 309
           D+            F   W+Q  +  + T                  ++E  Y N+P+IP
Sbjct: 326 DFLGVILGISALILFGVSWDQATMYKFKTIHVYLTLLFSLVSFIAMIIWE-YYFNNPIIP 384

Query: 310 RPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAA 369
              +H   +   LL VFF + SF  W FY +     +++ +P+     +    + GII+A
Sbjct: 385 IRQIHPGTI-KALLVVFFSYISFTQWLFYTWKLFTEVKDNSPILGSVKFIPLSVAGIISA 443

Query: 370 -ISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFP 428
             S+   +KR+P  + L     +F    I+L    +D +Y+      +I +S G+D+SFP
Sbjct: 444 TFSILLIVKRVPVQIRLLAGASSFLLSHILLLTCKLDSSYWTYQFFSIISISIGLDISFP 503

Query: 429 ASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGT-VEHQINKNGDD------LLK 481
           +++++L++ +P E QG+  +LV +++NY  ++   IA T +++Q      D       LK
Sbjct: 504 SATLLLTNGIPPEIQGICAALVGSVLNYGTAIGPPIAQTIIQYQCESCMSDPHDKKAFLK 563

Query: 482 GYRAALYLGIGLASLGVFI 500
           G   A  +G+G + + V I
Sbjct: 564 GIHIAGAVGVGCSGIAVLI 582

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  145 bits (366), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 117/479 (24%), Positives = 217/479 (45%), Gaps = 18/479 (3%)

Query: 52  KEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQT---WLMASFPLVSGSFIL 108
           +E   +   + SQL+   G  Q + +   L + +    ++     W  AS+ L S   +L
Sbjct: 37  REIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGGLVGWANASYMLGSAVMVL 96

Query: 109 VSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVE-FFIISRAFQGLGIAFILPNI 167
           ++GK+GD+ G K+ ++ G++   IWSLI G + Y    + F+  +RA QG+G  FI+PN 
Sbjct: 97  IAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTARALQGIGSGFIVPNS 156

Query: 168 MGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAI 227
           + I+G  Y     +K ++ S+ G     G  +G  FS L   L+ +WAW ++A      +
Sbjct: 157 LAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLFAQLT-KWAWNYWALACVCVL 215

Query: 228 -NMGLSIWVIPNTIPTNVRGSSM----DWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXX 282
             +G  +++ P+ I        +    D+            F+  + Q   +GW      
Sbjct: 216 YTVGAILFIPPDNIVHKPNSKPLYKRFDYLGAITGVSGLVLFDVAFTQASALGWSPPHTY 275

Query: 283 XXXXXXXXXXXXFFLYETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCF 342
                           + +  +DPL+P   +    +++ L+ V+FG+ SF IW  +++ F
Sbjct: 276 ITLIIGVILILIAMFVDWR-VDDPLVPLQHLRAD-VVVILICVYFGFLSFVIWANWFWQF 333

Query: 343 VLNLREYTPLWAGGSYFMFLIWGIIAAI-SVGYTIKRIPPSLILFLSMLAFDCGCIMLSV 401
              +   +PL          I  I AAI +V      I    ++ +SM+ F    I+++ 
Sbjct: 334 YELVHNDSPLRIAAKLVPLAIGSIPAAIFTVTCLQLNIKAPTMMVISMVCFLVPNILMAT 393

Query: 402 TPVDQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMC 461
              + TY+       II  F +D++ P ++++ SD +  E+QG+A SL+ T+I+Y++S+ 
Sbjct: 394 VTPNTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAASLIITVISYAISIG 453

Query: 462 LGIAGTVEHQINKNGDDLLKG-----YRAALYLGIGLASLGVFISALFMLENYLRMRRR 515
                 V   +   G+D   G       +    GI L+ +G+  + +  L +Y   R  
Sbjct: 454 PSYTAMVMWYVAPLGNDSTPGGFTHSLHSNFICGIVLSGIGLVTAVIAGLIDYKITRTH 512

>Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON}
           (63222..64943) [1722 nt, 574 aa]
          Length = 573

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 102/236 (43%), Gaps = 21/236 (8%)

Query: 19  TQSATAFTEHSDVQ-VDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLS- 76
           +++ T   E SD++  DD K  +I+D   + AP+  + +    +M  LL   G   +L  
Sbjct: 62  SRTQTREVEESDLESADDVK--TIKDSQEYVAPYTLFSYSQKWIMVGLLTMCGFWSSLGS 119

Query: 77  -----LINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTI 131
                 +  L K FD   +     +  + L  G    V G + DIYG +  +L G +V I
Sbjct: 120 PIYYPALRQLEKQFDIDENLVNVTVVVYLLFQGISPTVCGGLADIYGRRPVILFGMLVYI 179

Query: 132 IWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGA 191
           + S+     +  +S    I  R  Q  GI+ I+    G VG+      T K    + +GA
Sbjct: 180 VASIA---LACANSYGVIIFLRCLQSCGISPIIAISSGCVGDF-----TMKAERGTFVGA 231

Query: 192 CAPIGATMGVLFSGLIG-TLSERWAWT--FYAYTITAAINMGLSIWVIPNTIPTNV 244
            + +   +G  F  LIG  L+  W W   F+   I A   + + I V+P T  T V
Sbjct: 232 VSGL-VLLGQAFGSLIGAALAAAWDWRAIFWFLAIGAGCCLFVGILVLPETKRTIV 286

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 77/164 (46%), Gaps = 5/164 (3%)

Query: 66  LNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLV 125
           L+ A     + L+  +   F+ S +Q  W + S+ +    FI   G++GDI G    + V
Sbjct: 34  LDLASVGAMIVLVTDIETRFNVSHTQSGWALTSYVITFAGFIAFFGRVGDIVGNGIMMCV 93

Query: 126 GYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRK--N 183
             V+  I+SL+C +     +   F + RAFQG+  A I+P    +V  ++     ++  +
Sbjct: 94  FSVIFGIFSLLCAVVPNFIA---FTVFRAFQGMAGAGIVPCAYALVNKMFQGPNLQRYFS 150

Query: 184 MVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAI 227
           ++ S+I A A +G  +G  F          + + F A   TAA+
Sbjct: 151 ILSSVISAMAGVGFIIGGAFGETALGYKSFFYFLFAASLATAAV 194

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 56/103 (54%), Gaps = 4/103 (3%)

Query: 57  IFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDI 116
           +F+  +   L+   +T   +++N ++++F  S+ +Q W+  SF L + +F  + GK+ DI
Sbjct: 39  LFSLWLGSFLSSLDSTIVANIMNRVAEDFSESSRKQ-WIATSFLLTNTAFQPLYGKLSDI 97

Query: 117 YGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLG 159
            G K  LL+       + L C LT +  +V  F I+RA  G+G
Sbjct: 98  TGRKSALLIA---QFFFGLGCLLTCFARNVTEFSIARAICGIG 137

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 97/224 (43%), Gaps = 14/224 (6%)

Query: 3   FKRSNESVSSQSKELGTQSATAFT-----EHSDVQVDDKKWP--SIQDPTYFSAPWKEYL 55
           +  SN S+ S+  +   +    F       H+  + D+   P  +++     S     Y+
Sbjct: 3   YAMSNPSLHSKEAKQQHEQKRQFAVDQKFAHTSSEHDETSIPEDNVKKNVELSKGSILYV 62

Query: 56  FIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGD 115
            + A  +S  L         ++I  ++K    S S+  WL   + L +   +L+ G+I  
Sbjct: 63  SLVAVALSLFLAALDVMIVSTIIEEVAKQL-GSYSEIGWLFTGYSLPNALLVLIWGRIAT 121

Query: 116 IYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIY 175
             G K T+L   V+  I SLI  L    SS+   I  R   G+G   I  ++  ++G+  
Sbjct: 122 PIGFKATMLFAIVIFEIGSLISAL---ASSMNMLIGGRVIAGIGGCGI-QSLSFVIGSTL 177

Query: 176 VAGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFY 219
           V   +++ M+I+++ +   I + +G    G+  T S  W W FY
Sbjct: 178 VE-ESKRGMLIAILSSSFAIASVVGPFLGGVF-TSSVTWRWCFY 219

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 54/103 (52%), Gaps = 4/103 (3%)

Query: 57  IFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDI 116
           +F+  +   L+   +T   +++N +++ F  S+ +Q W+  SF L + +F  + GK+ DI
Sbjct: 39  LFSLWLGSFLSSLDSTIVANIMNRVAEEFSESSKKQ-WIATSFLLTNTAFQPLYGKLSDI 97

Query: 117 YGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLG 159
            G K  LL        + L C LT +  +V  F I+RA  G+G
Sbjct: 98  TGRKSALLTA---QFFFGLGCLLTCFARNVTEFSIARAICGIG 137

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 3/87 (3%)

Query: 75  LSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWS 134
           +SLI+ LS  +  S +  +W + S+ +    FI   G++GDI G  +   V      I S
Sbjct: 49  ISLIDELSTKYSISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCFAILS 108

Query: 135 LICGLTSYTSSVEFFIISRAFQGLGIA 161
           L+CGL     + E F + RA QG+  A
Sbjct: 109 LLCGL---MPNFEAFAVMRALQGIAAA 132

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 86/209 (41%), Gaps = 23/209 (11%)

Query: 57  IFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDI 116
           IF      LLN AG    +S+I  L + +    +  +W + S+ +    FI   G++GDI
Sbjct: 33  IFFGCTFDLLNVAGV---ISVIEDLGETYKLGYTGASWALTSYAITFAGFIAFMGRLGDI 89

Query: 117 YGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYV 176
            G      +   +  ++SL+C +     +   F + RA QG+  A I+P    ++  +  
Sbjct: 90  VGNSVLFTISCFLFTLFSLLCAVVRDFPT---FAVFRALQGISAAGIVPCGYALIPLLAE 146

Query: 177 AGTTRKNMVISLIGACAPIGATM--------------GVLFSGLIGTLSERWAWTFYAYT 222
               +K   I   G  + IG  +              G+ +    G L    A +FY Y 
Sbjct: 147 PQDIQKFFSIVSCGFSSTIGIGLIVGGAFALTKVGYAGIFYLSFAGMLVVSIAASFYTYR 206

Query: 223 ITAAINMGLSIWVIPNTIPTNVRGSSMDW 251
           I     + + +  IP+  P   + +S+D+
Sbjct: 207 IEERKFLEVKVEDIPHDHP---KVASLDF 232

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 63/129 (48%), Gaps = 4/129 (3%)

Query: 31  VQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTS 90
           V  + +  P  Q    ++    ++  +F+  +   L+    T   +++N +++ F  S+ 
Sbjct: 13  VPEEVETLPLEQKFHEYNLALPKFPILFSLWLGSFLSSLDGTIVANIMNRVAEEFSESSR 72

Query: 91  QQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFI 150
           +Q W+  SF L + +F  + GK+ DI G K  LL  +     + + C LT +  +V  F 
Sbjct: 73  KQ-WIATSFLLTNTAFQPLYGKLSDITGRKSALLTAH---FFFGIGCLLTCFARNVTEFS 128

Query: 151 ISRAFQGLG 159
           I+RA  G+G
Sbjct: 129 IARAICGIG 137

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 70/163 (42%), Gaps = 8/163 (4%)

Query: 57  IFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDI 116
           IF      LLN A     +SLI+ L++ +D S +  +W + S+ +    FI   G++GDI
Sbjct: 34  IFLGCTFDLLNVA---SMISLIDDLAQKYDISYTTASWSLTSYAVTFAGFIAFMGRLGDI 90

Query: 117 YGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYV 176
            G      V      I SL+C +     +   F + RA QG+  A ++P    ++  +  
Sbjct: 91  VGNSILFTVSCFFFAILSLLCAV---MPNFPAFAVFRAIQGISAAGLVPCAYALIPMLAP 147

Query: 177 AGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFY 219
               +K   I   G  + IG  +G++  G        +   FY
Sbjct: 148 EEEVQKYFSIVSCGFSSTIG--LGLIIGGAFAATKIGYKGIFY 188

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 60/121 (49%), Gaps = 4/121 (3%)

Query: 39  PSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMAS 98
           P  Q    ++    ++  +F+  +   L+   +T   +++N +++ F  S+ +Q W+  S
Sbjct: 21  PLEQKYHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEEFSESSKKQ-WIATS 79

Query: 99  FPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGL 158
           F L + +F  + GK+ DI G +  LL        + L C +T +  +V  F I+RA  G+
Sbjct: 80  FLLTNTAFQPLYGKLSDIIGRRPALLTA---QFFFGLGCLMTCFARNVTEFSIARAVCGI 136

Query: 159 G 159
           G
Sbjct: 137 G 137

>TDEL0D03800 Chr4 (695403..697325) [1923 bp, 640 aa] {ON} Anc_3.245
           YBR043C
          Length = 640

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 93/205 (45%), Gaps = 13/205 (6%)

Query: 39  PSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMAS 98
           P  +DP  + A  K+ L +     S L+    T+     IN ++++ D++T      +  
Sbjct: 75  PEFKDPRDYPASIKK-LIVLIIAFSSLMGPMATSIVFPAINPITESLDTTTFMVNISVGV 133

Query: 99  FPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGL 158
           + L  G F L      +++G +   +V +++   + +   L+   SS   FII R   G 
Sbjct: 134 YSLSLGIFPLWWSSFSEMHGRRSVYVVSFIMLFGFCIGAALSPNISS---FIILRVLCGA 190

Query: 159 GIAFILPNIMGIVGNIYVAGTTRKNMVISLIGAC-APIGATMGVLFSGLIGTLSERWAW- 216
             A +     G V ++Y+     +N+ I  +G   AP+ A   ++ SGL+     RW+W 
Sbjct: 191 ASASVQSVGAGTVSDLYIPEDRGRNLGIYYMGPLMAPLIAP--IIASGLV----TRWSWR 244

Query: 217 -TFYAYTITAAINMGLSIWVIPNTI 240
            T +   I A  ++ L ++ +P T+
Sbjct: 245 STQWFMVILAGFDVLLLVFFLPETL 269

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 71/163 (43%), Gaps = 8/163 (4%)

Query: 57  IFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDI 116
           IF      LLN A     +SLI+ L+K ++ S +  +W + S+ +    FI   G++GDI
Sbjct: 34  IFLGCTFDLLNVA---SMISLIDDLAKTYNISYTTASWSLTSYAVTFAGFIACMGRLGDI 90

Query: 117 YGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYV 176
            G      +      + SL+C +     +   F + RA QG+  A ++P    ++  +  
Sbjct: 91  IGNSVLFTISCSCFAVLSLLCAV---MPNFPAFAVFRAIQGICAAGLVPCAYALIPILAP 147

Query: 177 AGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFY 219
               +K   I   G  + IG  +G++  G   T    +   FY
Sbjct: 148 KEKVQKYFSIVSCGFSSTIG--LGLIIGGAFATTKIGYRGIFY 188

>KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 630

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 103/219 (47%), Gaps = 15/219 (6%)

Query: 4   KRSNESVSSQSKELGTQSATAFTEHSDVQVDDKK-WPSIQDPTYFS--APWKEYLFIFAS 60
           KR +E VS + ++       A  +  DV VD K  + S  + T  S  A  + Y+ +FA 
Sbjct: 27  KRESEPVSKKYED-----KKAGEDAEDVPVDLKNVFTSDNEKTQSSIMAGMRLYVCLFAL 81

Query: 61  MMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLK 120
           +++QL+         ++I+++SKN     ++  WL+  + L +    L+ G+   + G +
Sbjct: 82  VLAQLIVALDVFIVNTVIDVVSKNL-GGYAKSGWLITGYSLPNSLLSLIWGRATSLLGFQ 140

Query: 121 KTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTT 180
            ++L+   +  + S++   ++  +S+   ++ R   G+G +  L  +  I+G   V    
Sbjct: 141 SSMLISIFIFEVGSIV---SATATSMNNLVVGRVVAGIGGSG-LQTVSMIIGCSLVEERN 196

Query: 181 RKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFY 219
           R  +VI++I +   + + +G    G   T    W W F+
Sbjct: 197 R-TIVIAVIMSAFAVSSLIGPFIGGAF-TTHATWRWCFW 233

>SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 667

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 97/209 (46%), Gaps = 21/209 (10%)

Query: 39  PSIQDPTYFSAPWKEY---LFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWL 95
           P  +DP  + +  K++   L  +ASMM  +    GT+     I +++ ++++ST      
Sbjct: 85  PEYKDPRDYPSILKKFIVLLIAYASMMGPM----GTSIVFPAIGLITSDYNTSTIMVNVS 140

Query: 96  MASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAF 155
           +  + +  G F L    I ++ G +   LV +  T++++   G T+ + +++ FII R  
Sbjct: 141 VGIYLISLGVFPLWWSSISELKGRRTVYLVSF--TLLFAFCIG-TAVSPNIQAFIILRVL 197

Query: 156 QGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGA-CAPIGATMGVLFSGLIGT-LSER 213
            G   A +     G + ++Y      KN+    +GA  AP       L S +IG+ L   
Sbjct: 198 CGASSASVQSVGAGTIADLYAPEERGKNLGYFYLGALTAP-------LLSPIIGSLLVNH 250

Query: 214 WAW--TFYAYTITAAINMGLSIWVIPNTI 240
           W+W  T +   I A  N+ L +  +P T+
Sbjct: 251 WSWRSTQWFMVILAGANVILIVLFLPETL 279

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 52/98 (53%), Gaps = 4/98 (4%)

Query: 62  MSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKK 121
           +   L+   +T   +++N +++ F+ S  +Q W+  SF L + +F  + GK+ DI G K 
Sbjct: 48  LGSFLSSLDSTIVANIMNKVAEEFEESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRKF 106

Query: 122 TLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLG 159
            +L  +     + L C LT +  ++  F I+RA  G+G
Sbjct: 107 AVLTSH---FFFGLGCFLTCFAQNITQFSIARAICGIG 141

>YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, confers resistance to short-chain
           monocarboxylic acids and quinidine; involved in the
           excretion of excess amino acids
          Length = 586

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 93/226 (41%), Gaps = 18/226 (7%)

Query: 26  TEHSDVQVDDKKWPSIQDPTYFSAPW------KEYLFIFASMMSQLLNQAGTTQTLSLIN 79
           +E S    DDK  P+ Q      AP+      +++  +    M    +  G+      + 
Sbjct: 66  SETSSHSSDDKVDPTQQITAETKAPYTLLSYGQKWGMVAILTMCGFWSSLGSPIYYPALR 125

Query: 80  ILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGL 139
            L K F+   +     +  + L  G    VSG + D +G +  +L G ++ +I S+  GL
Sbjct: 126 QLEKQFNVDENMVNVTVVVYLLFQGISPTVSGGLADCFGRRPIILAGMLIYVIASI--GL 183

Query: 140 TSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATM 199
                S    I  R  Q +GI+  +    G+VG+      T K+   + +GA +     +
Sbjct: 184 AC-APSYGVIIFLRCIQSIGISPTIAISSGVVGDF-----TLKHERGTFVGATSGF-VLL 236

Query: 200 GVLFSGLIGT-LSERWAWT--FYAYTITAAINMGLSIWVIPNTIPT 242
           G  F  LIG  L+ RW W   F+  TI       ++  ++P T  T
Sbjct: 237 GQCFGSLIGAVLTARWDWRAIFWFLTIGCGSCFLIAFLILPETKRT 282

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 57/110 (51%), Gaps = 2/110 (1%)

Query: 50  PWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILV 109
           P K  + + A +M   L+   TT   +L+  ++ + D+S SQ +W+  ++ L   +F  +
Sbjct: 37  PTKVRITVLALLMGSFLSALDTTIVATLLPTIASDLDAS-SQMSWIATAYLLSCSAFQPL 95

Query: 110 SGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLG 159
            GK+ DI+G K  L++  +   +   ICG + +T++V      R   G+G
Sbjct: 96  YGKLSDIFGRKILLILSNLTFALGCAICG-SPWTNNVWVLSTGRFVAGIG 144

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 62/133 (46%), Gaps = 15/133 (11%)

Query: 33  VDDKKWPSI----QDPTYFSAPWKEY------LFIFASM-MSQLLNQAGTTQTLSLINIL 81
           +DD   P I    +D     A +  Y      L I  S+ +   +     T   +++N +
Sbjct: 1   MDDDTAPLIPPESRDEESLEAEYHRYNLSLPKLPILTSLWLGSFIGSLDGTIVANIMNRV 60

Query: 82  SKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTS 141
           ++ F+ S  +Q W+  SF L + +F  + GK+ DI G +  LL  +     + L C LT 
Sbjct: 61  AEEFEESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRRFALLTAH---FFFGLGCLLTC 116

Query: 142 YTSSVEFFIISRA 154
           +  SVE F ++RA
Sbjct: 117 FAQSVEQFALARA 129

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 69/143 (48%), Gaps = 12/143 (8%)

Query: 71  TTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVT 130
           +T   +++N +++ F  S  +Q W+  SF L + +F  + GK+ DI G K  +L  +   
Sbjct: 60  STIVANIMNRVAEEFAESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRKFAVLTAH--- 115

Query: 131 IIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVIS--- 187
             + L C LT +  +V  F I+RA  G+G   I  N M  +    +  TTR+  +     
Sbjct: 116 FFFGLGCLLTCFAQNVTQFSIARAICGMGAGGI--NAMSSITTSDIC-TTRERGIFQGYA 172

Query: 188 --LIGACAPIGATMGVLFSGLIG 208
             + G    +GA +G LF   IG
Sbjct: 173 NIVFGMGQVLGAPLGGLFLDHIG 195

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 53/98 (54%), Gaps = 4/98 (4%)

Query: 62  MSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKK 121
           M   L    +T   +++N +++ F+ S  +Q W++ SF L + +F  + GK+ D+ G K 
Sbjct: 48  MGSFLGSLDSTIVANIMNKVAEEFEESDKKQ-WIVTSFLLTNTAFQPLYGKLSDLAGRKT 106

Query: 122 TLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLG 159
            L+V +   ++    C  T+ + ++  F I+RA  G+G
Sbjct: 107 ALMVAHSFFLVG---CLFTALSRNLVEFSIARAVCGMG 141

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 70/163 (42%), Gaps = 8/163 (4%)

Query: 57  IFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDI 116
           IF      LLN A     +SLI+ L+K ++ S +  +W + S+ +    FI   G++GDI
Sbjct: 34  IFLGCTFDLLNVA---SMISLIDDLAKKYNISYTTASWSLTSYAVTFAGFIACMGRLGDI 90

Query: 117 YGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYV 176
            G      +      I SL+C +     +   F + RA QG+  A ++P    ++  +  
Sbjct: 91  VGNSVLFTISCSCFAILSLLCAVMPNFPA---FAVFRAIQGICAAGLVPCAYALIPILAP 147

Query: 177 AGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFY 219
               +K   I   G  + IG  +G++  G        +   FY
Sbjct: 148 KEKVQKYFSIVSCGFSSTIG--LGLIIGGAFAATKIGYRGIFY 188

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 29/165 (17%), Positives = 72/165 (43%), Gaps = 8/165 (4%)

Query: 347 REYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSM-LAFDCGCIMLSVTPV- 404
            + +PL AG      +I  ++      +   ++ P + + L   LA     I++ +  + 
Sbjct: 343 EKDSPLLAGVKLVPLIICMVVGNALCAFESTKLKPRVGVALGFSLALAGSIILIQLHLIK 402

Query: 405 DQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGI 464
           D  ++++      ++ FG+ + +P +  I     P +++G+A  +  T     + +   +
Sbjct: 403 DNVFWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDQSKGIASGVAQTFGQLGIEITFSV 462

Query: 465 AGTVEHQIN--KNGDDLLKGYRAAL----YLGIGLASLGVFISAL 503
             +V   IN  K  +D ++ +R       Y  + + +LG  ++A+
Sbjct: 463 MASVLGDINEMKGKEDAIQNFRTGFQNCSYFTVAVGALGFLVTAI 507

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 50/98 (51%), Gaps = 4/98 (4%)

Query: 57  IFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDI 116
           +F+  M   L     T   +++N +++ F  S  +Q W+  SF L + +F  + GK+ DI
Sbjct: 54  VFSLWMGSFLGALDGTIVANIMNRVAEEFQESDKKQ-WIATSFLLTNTAFQPLYGKLSDI 112

Query: 117 YGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRA 154
            G K  LLV +     + L C LT +  +V  F I+RA
Sbjct: 113 TGRKFALLVAHT---FFCLGCLLTCFARNVTEFSIARA 147

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 75/166 (45%), Gaps = 12/166 (7%)

Query: 81  LSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLT 140
           L K F+   ++    +  + L  G    VSG + D++G +  +L G V+ ++ S+     
Sbjct: 128 LEKEFNMDENKVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVVASIGLACA 187

Query: 141 SYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMG 200
                + F    R  Q +GI+  +    G+VG+      T K+   + +GA + +   +G
Sbjct: 188 PSYGVICFL---RCIQSIGISPTIAISSGVVGDF-----TLKHERGTFVGATSGL-VLLG 238

Query: 201 VLFSGLIGT-LSERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVR 245
             F  LIG  L+ RW W    + +  AI  G+++ V   T+P   R
Sbjct: 239 QCFGSLIGAVLTARWDWRAIFWFL--AIGSGVALIVAAFTLPETKR 282

>Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 92/226 (40%), Gaps = 18/226 (7%)

Query: 26  TEHSDVQVDDKKWPSIQDPTYFSAPW------KEYLFIFASMMSQLLNQAGTTQTLSLIN 79
           +E S    DDK  P  Q      AP+      +++  +    M    +  G+      + 
Sbjct: 66  SETSSHSGDDKIDPQQQITAETGAPYTLLSYGQKWGMVAILTMCGFWSSLGSPIYYPALR 125

Query: 80  ILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGL 139
            L K F+   +     +  + L  G    +SG + D +G +  +L G ++ ++ S+  GL
Sbjct: 126 QLEKQFNVDENMINITVVVYLLFQGVSPTISGGLADCFGRRPIILAGMLIYVVASI--GL 183

Query: 140 TSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATM 199
                S    I  R  Q +GI+  +    G+VG+      T K+   + +GA +     +
Sbjct: 184 AC-APSYGVIIFLRCIQSIGISPTIAISSGVVGDF-----TLKHERGTFVGATSGF-VLL 236

Query: 200 GVLFSGLIGT-LSERWAWT--FYAYTITAAINMGLSIWVIPNTIPT 242
           G  F  LIG  L+ RW W   F+  TI       ++  V+P T  T
Sbjct: 237 GQCFGSLIGAVLTARWDWRSIFWFLTIGCGSCFLIAFLVLPETKRT 282

>SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {ON}
           similar to uniprot|P36035 Saccharomyces cerevisiae
           YKL217W JEN1 Lactate transporter, required for uptake of
           lactate and pyruvate; expression is derepressed by
           transcriptional activator Cat8p under nonfermentative
           growth conditions, and repressed in the presence of
           glucose, fructose, and mannose
          Length = 531

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 74/145 (51%), Gaps = 12/145 (8%)

Query: 23  TAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSL-INIL 81
           T+F E S    D    P+++  +Y     K++LFI ++  S    +A    T++L +  +
Sbjct: 51  TSFAEFSK---DVNPIPALKLISY-----KQWLFILSAFAS-FTWEAFDFFTVTLNVKKI 101

Query: 82  SKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTS 141
           S +FD +T Q TW +    ++     ++ G IGD YG K + ++     ++  +I G   
Sbjct: 102 SHDFDVTTKQVTWGITLVLMLRVVGAVLFGYIGDRYGRKVSFIINLFFMMVLEIITGFIK 161

Query: 142 YTSSVEFFIISRAFQGLGIAFILPN 166
           +  + ++F+I+RAF G+ +  I  N
Sbjct: 162 H--NFKYFLIARAFFGVVLGGIFGN 184

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 66/129 (51%), Gaps = 5/129 (3%)

Query: 27  EHSDVQVDDKKWPSIQDP-TYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNF 85
           E + +  D++   ++ +  T ++    ++  + +  +   L+   +T   +++N +++ F
Sbjct: 6   ESTRLLPDEQHCDALDEEYTKYNLSLPKFPILVSLWLGSFLSSIDSTIVANIMNKVAEEF 65

Query: 86  DSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSS 145
             S  +Q W+  SF L + +F  + GK+ DI G K  LL        + L C LTS +++
Sbjct: 66  QESQEKQ-WIATSFLLTNTAFQPLYGKLSDITGRKFALLTALS---FFGLGCFLTSLSTN 121

Query: 146 VEFFIISRA 154
           ++ F I+RA
Sbjct: 122 IKQFAIARA 130

>Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {ON}
           YNR055C (HOL1) - Putative ion transporter similar to the
           major facilitator superfamily of transporters [contig
           55] FULL
          Length = 612

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 50/230 (21%), Positives = 94/230 (40%), Gaps = 13/230 (5%)

Query: 13  QSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTT 72
           Q +     S T  T    + ++ +   S++DP  +   W+  + +        +    T+
Sbjct: 38  QDRTAAVDSGTMQTTKKGIILNPQPSESMRDPLNWPV-WRRDIALLVVGWHCFVGGGQTS 96

Query: 73  QTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTII 132
              +    L++ F+ S S  ++L+    L      +++     ++G +   L+G +V   
Sbjct: 97  ILAAGSRSLAEEFNRSLSDISYLVGGMMLALAFGSIIASPSAVLFGKRILYLIGIIVFFF 156

Query: 133 WSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNM---VISLI 189
            S+ C   S + S E  + SR   GLG+A I       V  IY A      +    + L+
Sbjct: 157 GSIGC---SVSHSYESLLASRIVSGLGVATIESLPSATVAEIYFAHERAYRLGVYTLLLL 213

Query: 190 GACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNT 239
           G     G  +  L + L+    +R+ W F+  TI   IN  L ++ +P T
Sbjct: 214 G-----GKNLVPLLASLVFQSLDRY-WLFWIVTIIVGINFVLHLFFVPET 257

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 47/84 (55%), Gaps = 4/84 (4%)

Query: 76  SLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSL 135
           +++N +++ F  S  +Q W+  S+ L + +F  + GK+ D+ G K  +L  +     + L
Sbjct: 59  NIMNRVAEEFQESDKKQ-WIATSYLLTNTAFQPLYGKLSDLTGRKFAVLTAH---FFFGL 114

Query: 136 ICGLTSYTSSVEFFIISRAFQGLG 159
            C LT + +SV  F I+RA  G+G
Sbjct: 115 GCLLTCFANSVTQFAIARAICGVG 138

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 69/144 (47%), Gaps = 7/144 (4%)

Query: 76  SLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSL 135
           ++I  ++K F  + S+  W+ A + L +    L+ G+I  I G K  +L   ++  I SL
Sbjct: 100 TIIEDVAKKF-GAYSKTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIFEIGSL 158

Query: 136 ICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPI 195
           I G+    +S+   I  R   G+G + I  ++  ++G+  V    R+ ++I+ + +   +
Sbjct: 159 ISGV---ANSMNMLIGGRVIAGVGGSGI-QSLAFVIGSNLV-DERRRGLIIACMSSAFAV 213

Query: 196 GATMGVLFSGLIGTLSERWAWTFY 219
            + +G    G   T    W W FY
Sbjct: 214 ASVIGPFLGGAF-TTHATWRWCFY 236

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 75/167 (44%), Gaps = 12/167 (7%)

Query: 81  LSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLT 140
           L K F+ S       +  + +  G    +SG + D+YG +  +L+G ++ +  S+  GL 
Sbjct: 113 LEKKFNVSEEMVNITVVVYLIFQGIAPTISGGLADVYGRRPVILMGMLIYVCASI--GL- 169

Query: 141 SYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMG 200
           + + S    +  R  Q  GI+ I+    G+VG+      T K+   + +GA +     MG
Sbjct: 170 ACSQSYGVIVFLRCLQSAGISPIIAINSGVVGDF-----TLKHERGTFVGAVSGF-TLMG 223

Query: 201 VLFSGLIG---TLSERWAWTFYAYTITAAINMGLSIWVIPNTIPTNV 244
             F  LIG   T +  W   F+  TI     M ++  ++P T  T V
Sbjct: 224 QAFGSLIGAALTAAFDWRAIFWFLTIGCGTCMIINFLILPETKRTLV 270

>KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 575

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 78/176 (44%), Gaps = 12/176 (6%)

Query: 80  ILSKNFDSSTSQQTWLMASF--PLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLIC 137
           IL   F++ST+     +A+F      G F+     +   +G +K L   Y+ +++ +LI 
Sbjct: 137 ILQSEFNTSTTAINGTVAAFMGVFAVGPFLWA---VHADFGGRKFL---YIFSLMIALIA 190

Query: 138 G--LTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPI 195
              L +    +    I R FQ +G + ++P  +G V ++       K +   ++G    +
Sbjct: 191 NVLLAAVPKHLAALYILRVFQAIGTSAVIPLGVGTVSDLISPMNRAKGVSYFMLGP--NM 248

Query: 196 GATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSMDW 251
           G  +G +F GLI     +W W F   +IT  + + L +  +P T+   V      W
Sbjct: 249 GPILGPIFGGLILMNGNQWRWLFGFTSITTGVGLILIVTFLPETLRCIVGNGDPRW 304

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 61/141 (43%), Gaps = 19/141 (13%)

Query: 14  SKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASM-MSQLLNQAGTT 72
           S E GT S    TE    Q  ++  P         AP      I  S+ +   L     +
Sbjct: 17  SLEYGTNSDKTLTETQRCQEHNRSLPK--------AP------ILTSLWLGSFLASIDAS 62

Query: 73  QTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTII 132
              +++N +++ F  S  +Q W+  SF L + +F  + G+  DI G K  LL+     ++
Sbjct: 63  IVANIMNKIAEEFHESDKKQ-WMATSFLLTNAAFQPLYGRCSDIVGRKCALLIAQSFFLL 121

Query: 133 WSLICGLTSYTSSVEFFIISR 153
            +L   LT +  +V  F I+R
Sbjct: 122 GTL---LTCFARNVTEFAIAR 139

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 93/473 (19%), Positives = 177/473 (37%), Gaps = 58/473 (12%)

Query: 10  VSSQSKELGTQSATAFTEHSDVQVDDKK---------WPSIQDPTYFSAPWKEYLFIFAS 60
           V+++ ++    S T    +    VDD+          +P  + P +  +  +  + + + 
Sbjct: 29  VANEVEQQDYNSRTGHDSYGATAVDDRTATSARCDLTFPPSETPEFALSSSRIRIIMISM 88

Query: 61  MMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLK 120
            +   L     T   +L+  +   F+S   + +W+  S+ L S +   + GK+ D  G K
Sbjct: 89  FLGIFLAALDGTIVSTLLTRIGSEFNS-LDKVSWIATSYLLSSSTCQPLYGKLSDQLGRK 147

Query: 121 KTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTT 180
             L+   VV  I  LICG+   ++S+ + ++ R   G+G   +      ++ ++      
Sbjct: 148 PLLVFSNVVFSIGCLICGM---STSIWWVVVGRFVSGIGGCGLTCLASMVISDLV---PL 201

Query: 181 RKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVI---- 236
           R+  V    G C  I   +G    GL+G   + W     A+TI   I++     ++    
Sbjct: 202 RERAVYQ--GLCNFIFG-LGTASGGLVGAAFQDWR---MAFTIQCPISLASCALIVSYLE 255

Query: 237 --PNTIPTNVRG-----SSMDWXXXXXXXXXXXXFNFVWN-QGPIVGWDTXXXXXXXXXX 288
             P       R        +DW            F  V +  G  + +D+          
Sbjct: 256 LPPRHEDDKDRHWTSKLRDLDWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTT 315

Query: 289 XXXXXXFFLYETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFY---YFCFVLN 345
                 F   E   A DP++P   +    +L + LA +F   S     +Y   Y+  VLN
Sbjct: 316 LVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLN 375

Query: 346 LREYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGC--------- 396
           ++   P   G             ++  G  +KR       +  +LAF CG          
Sbjct: 376 MK---PTDIGKRSIPSFFSVAFGSLGAGIYMKRTGK---YYWFLLAF-CGIGILGQLKIN 428

Query: 397 IMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSL 449
           ++   TPV Q Y      ++++ SFG+ +    + + +   +P E+     S+
Sbjct: 429 LLTPATPVWQQYL-----LLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSI 476

>TBLA0A10350 Chr1 (2550231..2551796) [1566 bp, 521 aa] {ON}
           Anc_5.284 YHR048W
          Length = 521

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 50/241 (20%), Positives = 100/241 (41%), Gaps = 23/241 (9%)

Query: 5   RSNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQ 64
            S+ S +SQS +    +     E SD+ +D      +   +     +   L I ++M+  
Sbjct: 35  ESDLSTTSQSTQNNISAGKYKVEFSDIALDKDPEDIVSRLSSLHKWYIALLVILSAMVIT 94

Query: 65  LLNQAGTTQTLSLINILSKNFDSST---SQQTWLMASFPLVSGSFILVSGKIGDIYGLKK 121
           +++   T  +  +        + S    S   W +A  PL           I ++YG + 
Sbjct: 95  IISSCWTFLSPQISEKFHLKHEVSVLGISCYVWGLAFGPLFLS-------PISEMYGRRI 147

Query: 122 TLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTR 181
           T +    ++I+W     LT++ S++E  +  R   G   +  L    G + +++      
Sbjct: 148 TFIFSLSMSIVWQC---LTTWASNIEGMLFGRFLAGFFGSAFLSVAGGTISDLF-----N 199

Query: 182 KNMV---ISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPN 238
           KN V   ++L      +G ++G L SG +  ++  + WTF    IT+ + + L +  +P 
Sbjct: 200 KNEVGVPMALFTTAGFLGPSIGPLLSGAMYHIN--YKWTFIVLLITSGVCLILVVLTVPE 257

Query: 239 T 239
           T
Sbjct: 258 T 258

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 66/137 (48%), Gaps = 12/137 (8%)

Query: 109 VSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIM 168
           +SG + D+YG +  +L G ++ ++ S+  GL   ++S    +  R  Q  GI+ ++    
Sbjct: 152 ISGGLADVYGRRPIILAGMLIYVVASI--GLAC-SNSYGVIVFLRCVQSAGISPLIAISS 208

Query: 169 GIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIG---TLSERWAWTFYAYTITA 225
           G+VG+      T K+   S +GA +   A MG  F  LIG   T +  W   F+  TI  
Sbjct: 209 GVVGDF-----TTKSERGSFVGAVSGF-ALMGQAFGSLIGAGLTAAYDWRAIFWFLTIGC 262

Query: 226 AINMGLSIWVIPNTIPT 242
                ++ +++P T  T
Sbjct: 263 GTCFVINFFLLPETKRT 279

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 69/144 (47%), Gaps = 7/144 (4%)

Query: 76  SLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSL 135
           ++I  ++K F  S S+  WL   + L +    L+ G+I    G K+T+L   V+  I SL
Sbjct: 89  TIIEEVAKQF-GSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIFEIGSL 147

Query: 136 ICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPI 195
           I  L    +S+   I  R   G+G   I  ++  ++G+  V  + R  ++I+++     I
Sbjct: 148 ISAL---ANSMSMLIGGRVIAGVGGCGI-QSLSFVIGSTLVEESQR-GILIAVLSCSFAI 202

Query: 196 GATMGVLFSGLIGTLSERWAWTFY 219
            + +G    G+  T S  W W FY
Sbjct: 203 ASVVGPFLGGVF-TSSVTWRWCFY 225

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 71/145 (48%), Gaps = 7/145 (4%)

Query: 75  LSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWS 134
           ++++N ++  F++  S+  WL+  + L +  F L+ G+   I+G K TL+V  ++  I S
Sbjct: 41  VTILNTIADKFNA-YSKIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGS 99

Query: 135 LICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAP 194
           L+  +   ++S++  I  R   G G + I   +  I  ++    T  +  +++L+     
Sbjct: 100 LVIAV---SNSMDMIIGGRVIAGCGASGIQTLVFAIATSLVDEHT--RGTIVTLLSLSYA 154

Query: 195 IGATMGVLFSGLIGTLSERWAWTFY 219
           + + +G    G + T    W W FY
Sbjct: 155 VASALGPYIGGAL-TEYVTWRWCFY 178

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 51/106 (48%), Gaps = 11/106 (10%)

Query: 54  YLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKI 113
           YL IF + +   +    +    S  N LSK         +W+  S+ L S +F  + GK+
Sbjct: 118 YLGIFLAAIDNTIVSTTSAHVASEFNQLSK--------VSWIATSYLLSSATFQPLYGKV 169

Query: 114 GDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLG 159
            DI+G K  L+   V  +I  L+CGL   + S  + +I+R   G+G
Sbjct: 170 SDIFGRKCLLVFTNVAFLIGCLMCGL---SKSFWWLVIARFVAGVG 212

>Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065W
           (REAL)
          Length = 561

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 72/165 (43%), Gaps = 12/165 (7%)

Query: 81  LSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLT 140
           L K F+   +     +  + L  G    VSG + D +G +  +L G ++ ++ S+  GL 
Sbjct: 126 LEKQFNVDENMVNVTVVVYLLFQGISPTVSGGLADCFGRRPIILAGMLIYVVASI--GLA 183

Query: 141 SYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMG 200
               S    I  R  Q +GI+  +    G+VG+      T K+   + +GA +     +G
Sbjct: 184 C-APSYGVIIFLRCIQSIGISPTIAISSGVVGDF-----TLKHERGTFVGATSGF-VLLG 236

Query: 201 VLFSGLIGT-LSERWAWT--FYAYTITAAINMGLSIWVIPNTIPT 242
             F  LIG  L+ RW W   F+  TI       ++  ++P T  T
Sbjct: 237 QCFGSLIGAVLTARWDWRSIFWFLTIGCGSCFLIAFLILPETKRT 281

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 71/162 (43%), Gaps = 12/162 (7%)

Query: 81  LSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLT 140
           L K F  S       +  + +  G    +SG + D+YG +  +L+G ++ +  S+  GL 
Sbjct: 113 LEKQFSVSEELVNITVVVYLIFQGVAPTISGGLADVYGRRPVILIGMLIYVCASI--GLA 170

Query: 141 SYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMG 200
             ++S    +  R  Q  GI+ I+    G+VG+  V     K    + +GA +     MG
Sbjct: 171 C-SNSYGVIVFLRCLQSAGISPIIAINSGVVGDFTV-----KQERGTFVGAVSGF-TLMG 223

Query: 201 VLFSGLIG---TLSERWAWTFYAYTITAAINMGLSIWVIPNT 239
             F  LIG   T +  W   F+  TI     M ++  ++P T
Sbjct: 224 QAFGSLIGAALTAAFDWRAIFWFLTIGCGTCMLVNFLLLPET 265

>CAGL0J00363g Chr10 (27627..29123) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P38776 Saccharomyces cerevisiae
           YHR048w
          Length = 498

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 48/234 (20%), Positives = 101/234 (43%), Gaps = 19/234 (8%)

Query: 8   ESVSSQSKELGTQSATAFTEHSDVQVDD--KKWPSIQDPTYFSAPWKEYLFIFASMMSQL 65
           ES S+ S    T+   +F+E  D   ++  +  P ++         K Y+    ++ S +
Sbjct: 19  ESKSALSANEQTEFEVSFSEDGDPDPENIARHLPLVR---------KYYISSLITLTSTV 69

Query: 66  LNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLV 125
           +    +  +L+  NI+ K+F  S    T  +  +    G   L    I ++YG + T + 
Sbjct: 70  ITIISSCWSLASPNIM-KHFHISHEVSTLGITLYIFGLGFGPLFLSPISELYGRRITFVS 128

Query: 126 GYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMV 185
              ++IIW     LT+++ ++E  +  R   G   +  L    G + +I+     +  + 
Sbjct: 129 SLFLSIIWQC---LTTWSKTIEGVLFGRFLSGFFGSVFLSVAGGAISDIF--SKKQIGIP 183

Query: 186 ISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNT 239
           +++    A +G ++G + SG +      + WTF    I + + + L +  +P T
Sbjct: 184 MAIYTTAAFLGPSLGPIISGAL--YHANYKWTFVTLLIASGVCLTLIVISVPET 235

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 61/131 (46%), Gaps = 16/131 (12%)

Query: 94  WLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISR 153
           WL+  + L +  F L+ G++  I GLK +L    V+  I SLI  +   ++S+   I  R
Sbjct: 46  WLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIVAV---SNSMGMIIGGR 102

Query: 154 AFQGLGIAFILPNIMGIVGNIYVAGTT-----RKNMVISLIGACAPIGATMGVLFSGLIG 208
              G G +       GI   ++V GT+      + MVI+++G    +   +G +  G   
Sbjct: 103 VVAGCGGS-------GIQSLVFVVGTSLVEERNRGMVITVLGLAFAVAFAVGPVIGGAF- 154

Query: 209 TLSERWAWTFY 219
           T +  W W FY
Sbjct: 155 TENVSWRWCFY 165

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 50/109 (45%), Gaps = 6/109 (5%)

Query: 57  IFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDI 116
           IF      LLN AG    +S+I  L + +    +  +W + S+ +     I   G++GDI
Sbjct: 37  IFLGCTFDLLNVAGV---ISVIEDLGETYGLEYTTASWALTSYAITFAGLIAFMGRLGDI 93

Query: 117 YGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILP 165
            G    L    +    +SL C L +  ++   F + RA QG+  A ++P
Sbjct: 94  IG-NSVLFT--ISGFFFSLFCLLCAVVTNFPAFAVLRALQGIAAAGLVP 139

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 32/165 (19%), Positives = 74/165 (44%), Gaps = 10/165 (6%)

Query: 350 TPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIML-SVTPVDQT- 407
           +PL AG      +I  +I          ++ P + + L  L+  CG I+L  +  V++  
Sbjct: 353 SPLLAGVKLVPLIITMVIGNTICASKSVKLRPRIGVALGFLSMVCGSIILIQLHLVEENL 412

Query: 408 YFRMILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTM----INYSMSMCLG 463
           Y++++    I++ FG  + +P +  ++  + P   +G+A  +  T     I  + S+ + 
Sbjct: 413 YWKIMFCSQILVGFGAAIFYPYALKLVVGDAPSGAKGIASGVTQTFAQLGIEMTFSVMVS 472

Query: 464 IAGTVEHQINKNGDDLLK---GYRAALYLGIGLASLGVFISALFM 505
           + G +  Q+    D   +   G++   Y  +   + G+ ++  F+
Sbjct: 473 VLGNIT-QVKSRPDSFERFRDGFQKCTYFTLASGAFGLVLTTFFV 516

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 60/121 (49%), Gaps = 4/121 (3%)

Query: 21  SATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINI 80
           +  A TEH  ++ +D+    +Q      A  + ++ I +  +   L     T   +L++ 
Sbjct: 31  AEVAETEHL-LESEDEAREGLQVSEMSRA--RLHIIISSMCLGSFLAALDNTIVTTLLSH 87

Query: 81  LSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLT 140
           ++  F+   S  +W+  ++ L S +F  + GKI DI+G +  +++  +  I+  LICGL+
Sbjct: 88  IASEFNE-LSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLS 146

Query: 141 S 141
            
Sbjct: 147 K 147

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 49/98 (50%), Gaps = 4/98 (4%)

Query: 62  MSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKK 121
           M+  L     T   +++N +++ F  S   Q W+  SF L S  F  + GK+ D+ G + 
Sbjct: 55  MANFLASMDRTIIANIMNSVTEEFKESHRIQ-WVATSFLLTSTVFQPIYGKLSDVTGRRF 113

Query: 122 TLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLG 159
            L++ Y + +   L C +T+Y  ++  F   RA  G+G
Sbjct: 114 VLVLAYSLFL---LGCLVTAYARNIWEFAFGRAICGIG 148

>KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 57/248 (22%), Positives = 102/248 (41%), Gaps = 17/248 (6%)

Query: 12  SQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFS-APW------KEYLFIFASMMSQ 64
           +++KE+G+ S       S ++ D  +      P   S AP+      +++  +    M  
Sbjct: 64  TRTKEIGSDSGDESGSPSGIKQDGHESEDEGQPEEVSTAPYTLLSYSQKWGMVAVLTMCG 123

Query: 65  LLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLL 124
             +  G+      +  L K F  + SQ    +  + L  G     SG + D YG +  +L
Sbjct: 124 FWSSLGSPIYYPALRQLEKEFHLNESQVNVTVVVYLLFQGIAPTFSGGLADRYGRRPIIL 183

Query: 125 VGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNM 184
            G +V ++ S+  GL +   S    +  R  Q +GI+  +    G+V + Y     R   
Sbjct: 184 GGMLVYVVASI--GL-ARAPSYGVIVFLRIVQSIGISPTIAISSGVVSD-YTLKRERGTF 239

Query: 185 VISLIGACAPIGATMGVLFSGLIGTLSERWAWT--FYAYTITAAINMGLSIWVIPNTIPT 242
           V +  G    IG  +G L   +I     RW W   F+   I    +M ++ +++P T  T
Sbjct: 240 VGATSGFVL-IGQGIGPLLGAVIAA---RWDWRAIFWFLVIGCGTSMLIAFFLLPETKRT 295

Query: 243 NVRGSSMD 250
            V   S++
Sbjct: 296 IVGNLSIE 303

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 43/79 (54%), Gaps = 4/79 (5%)

Query: 76  SLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSL 135
           +++N +++ F  S  +Q W+  SF L + +F  + GK+ D+ G K  LL+ Y   +I   
Sbjct: 57  NIMNRVAEEFSESDKKQ-WIATSFLLTNTAFQPLYGKLSDVTGRKFALLMAYFFLVIG-- 113

Query: 136 ICGLTSYTSSVEFFIISRA 154
            C LT    +V  F ++RA
Sbjct: 114 -CLLTCLARNVTEFAVARA 131

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 89/208 (42%), Gaps = 13/208 (6%)

Query: 12  SQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGT 71
           + SKEL TQ+ ++ +E     V+  K    QD       +  Y  + +  ++  L+    
Sbjct: 7   NSSKELCTQAESSTSE----VVEQNKKVVSQDQVV--KGFALYACLGSLTLALFLSALDI 60

Query: 72  TQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTI 131
               ++I  +S++F+   S+  WL+  + L +    LV G+   I G K ++L+  ++  
Sbjct: 61  LIVSTIIETVSRDFNE-YSKSGWLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFE 119

Query: 132 IWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGA 191
           + SL+  L    +S+   I  R   G+G + +      I+  +       + M IS++  
Sbjct: 120 VGSLVSAL---ANSMNMLIGGRVISGVGGSGLQTLCFLIISTL--VNERSRGMAISVLSC 174

Query: 192 CAPIGATMGVLFSGLIGTLSERWAWTFY 219
              + + +G    G   T    W W FY
Sbjct: 175 SFAVASIVGPFLGGAF-TTHVTWRWCFY 201

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 45/87 (51%), Gaps = 1/87 (1%)

Query: 52  KEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSG 111
           K  + + A  +   L+   TT   +L+  ++ + D+S SQ +W+  S+ L   +F  + G
Sbjct: 39  KTRIIVIALFLGSFLSALDTTIVSTLLPTIASDLDAS-SQMSWIATSYLLSCSAFQPLYG 97

Query: 112 KIGDIYGLKKTLLVGYVVTIIWSLICG 138
           K+ DI+G K  L+   +V  I   +CG
Sbjct: 98  KLSDIFGRKILLVWSNLVFAIGCALCG 124

>TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {ON}
           Anc_2.241 YIL121W
          Length = 562

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 58/249 (23%), Positives = 102/249 (40%), Gaps = 20/249 (8%)

Query: 7   NESVSSQSKEL-GTQSATAFTEHS-DVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQ 64
           N+SV+    +L GT S T   E S    ++ ++   I        P   + +    MM  
Sbjct: 36  NDSVTHSKADLHGTLSHTRTRELSCSSDLESQQSHDINSENSNKVPHSLFTYNQKWMMVG 95

Query: 65  LLNQAGTTQTLS------LINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYG 118
           +L   G   +L        +  L K FD   +     +  + +  G      G + D++G
Sbjct: 96  VLTMCGFWSSLGSPIYYPALKQLEKQFDVDENMVNVTVVVYLIFQGLSPTFCGGLADLFG 155

Query: 119 LKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAG 178
            +  +L G ++  + S+  GL   ++S    +  R  Q  GI+  +    G VG+  V  
Sbjct: 156 RRPVILTGMLIYTVASI--GLAC-SNSYGVIVFLRCLQSAGISPTISISSGAVGDFTV-- 210

Query: 179 TTRKNMVISLIGACAPIGATMGVLFSGLIG---TLSERWAWTFYAYTITAAINMGLSIWV 235
              K+   + +GA + +   +G  F  LIG     S  W   F+  TI   ++M ++ +V
Sbjct: 211 ---KSERGTFVGAVSGL-VLLGQAFGSLIGAALAASFNWRAIFWFLTIGCGVSMMVAFFV 266

Query: 236 IPNTIPTNV 244
           +P T  T V
Sbjct: 267 LPETKRTIV 275

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 60/130 (46%), Gaps = 6/130 (4%)

Query: 90  SQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFF 149
           S+  W+ A + L S    L+ G+I  + G K ++L   ++  + SL+  L    +S++  
Sbjct: 90  SKTGWIYAGYSLPSALLTLIWGRIAAVCGFKSSMLTAIIIFEVGSLVAAL---ANSMDML 146

Query: 150 IISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGT 209
           I  R   GLG + I      I+  +     +++ ++I+ +G+   I + +G    G   T
Sbjct: 147 IGGRVIAGLGGSGIQTLCFVIISTL--VEESKRGLLIACMGSAFGIASVVGPFLGGAF-T 203

Query: 210 LSERWAWTFY 219
               W W F+
Sbjct: 204 THVTWRWCFW 213

>Skud_8.107 Chr8 (179754..181322) [1569 bp, 522 aa] {ON} YHR048W
           (REAL)
          Length = 522

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 104/242 (42%), Gaps = 23/242 (9%)

Query: 5   RSNE------SVSSQSKELGTQS-ATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFI 57
            SNE       ++++ K+ G QS   AF++      D     S+    Y S+     L  
Sbjct: 33  HSNEVAKLGSELTNERKDDGRQSYEVAFSDDFADPEDIASHMSMGHRYYISS-----LIT 87

Query: 58  FASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIY 117
           F SM+  +++ + T  +  +I     + + ST   T  +  F L  G   L    + ++Y
Sbjct: 88  FTSMVITMISSSWTLPSTHIIEHFHISHEVSTVGIT--LYVFGLGIGPLFL--SPLSELY 143

Query: 118 GLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVA 177
           G + T L   +++IIW     LT ++ ++   +  R   G   +  L    G + +I+  
Sbjct: 144 GRRITFLYALMLSIIWQC---LTIWSGTIAGVMFGRFLSGFFGSAFLSVAGGAIADIF-- 198

Query: 178 GTTRKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIP 237
              +  + +++    A +G ++G +  G +    E + WTF    IT+   + L I+ IP
Sbjct: 199 DKDQIGIPMAIYTTSAFLGPSLGPIIGGAL--YHESYKWTFITLLITSGCCLVLIIFTIP 256

Query: 238 NT 239
            T
Sbjct: 257 ET 258

>ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR043C
          Length = 631

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 42/208 (20%), Positives = 91/208 (43%), Gaps = 13/208 (6%)

Query: 39  PSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMAS 98
           P  +D   +    K+ + +  +    +L   GT+     I  + ++F +S    +  + +
Sbjct: 81  PEFRDARLYPPRVKKLILVIVAFAC-ILGPMGTSIIYPAIGTIMQDFGTSRFLVSVSVGT 139

Query: 99  FPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGL 158
           +    G F +    + D  G +   ++ + + +++S+    T+++ ++E FII R   G 
Sbjct: 140 YLAALGIFPIWWSSLADKNGRRTVYVLSFALLVVFSVG---TAFSRNIETFIILRILCGA 196

Query: 159 GIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGT-LSERWAW- 216
             A +     G + ++YV     +N+    +G        M  L S ++ + L  RW+W 
Sbjct: 197 ASASVQSVGAGTIADLYVPEERGRNLGYYYLGPL------MAPLLSPIVSSLLVNRWSWR 250

Query: 217 -TFYAYTITAAINMGLSIWVIPNTIPTN 243
            T +   I AA+   L ++ +P T+ T 
Sbjct: 251 STQWFMVILAALTFLLLVFALPETLRTQ 278

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 76/167 (45%), Gaps = 12/167 (7%)

Query: 81  LSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLT 140
           L K F    ++    +  + L  G    +SG + D++G +  +L+G ++ ++ S+  GL 
Sbjct: 117 LEKQFGLDENKVNVTVVVYLLFQGIAPTISGGLADVFGRRPVILIGMLIYVVASI--GLA 174

Query: 141 SYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMG 200
               S    +  R  Q +GI+  +    G+VG+      T K+   + +GA + +   +G
Sbjct: 175 C-APSYGVIVFLRIIQSIGISPTIAISSGVVGDF-----TLKHERGTFVGATSGL-VLLG 227

Query: 201 VLFSGLIGT-LSERWAWT--FYAYTITAAINMGLSIWVIPNTIPTNV 244
             F  LIG  L+  W W   F+  TI    +  ++  ++P T  T V
Sbjct: 228 QCFGSLIGAVLAAAWNWRAIFWFLTIGCGTSFIIAFLLLPETKRTLV 274

>NCAS0A06580 Chr1 (1303456..1305042) [1587 bp, 528 aa] {ON}
           Anc_5.284
          Length = 528

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 56/127 (44%), Gaps = 7/127 (5%)

Query: 113 IGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVG 172
           I + YG + T +    V+IIW     LT+++ ++E  +  R   G   +  L    G + 
Sbjct: 146 ISEFYGRRPTFIFSLTVSIIWQC---LTTWSRTIEGMMFGRFLSGFFGSTFLSVAGGSIS 202

Query: 173 NIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLS 232
           +I+   +    M I    A   +G  +G + SG +  +   + WTF    I + + + L 
Sbjct: 203 DIFDKDSITVPMAIYTTSAM--LGPELGPIISGALYKVD--YKWTFVTLLIASGVCLALI 258

Query: 233 IWVIPNT 239
           I  +P T
Sbjct: 259 IVTVPET 265

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 45/82 (54%), Gaps = 4/82 (4%)

Query: 78  INILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLIC 137
           +N ++  F  + S  TW+  ++ L + +   + GKI DI G +K LL G V+  +  L+C
Sbjct: 84  VNDIASQFQQA-SMVTWVATAYLLTTTAVQPLYGKISDIIGRRKCLLFGEVIFALGVLLC 142

Query: 138 GLTSYTSSVEFFIISRAFQGLG 159
              ++ +++    I+RA  G+G
Sbjct: 143 ---NFANTIPQLAIARAICGIG 161

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 38.1 bits (87), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 57/130 (43%), Gaps = 11/130 (8%)

Query: 30  DVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSST 89
           D    DK    ++D  +          +FA  +   L    TT   +L+  ++   D+S 
Sbjct: 17  DQAAHDKNVEPLRDVNWI---------VFALFVGSYLAALDTTIVTTLLPTIASELDAS- 66

Query: 90  SQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFF 149
           +Q +W+  S+ L   +F  + GK+ D++G K  L+   +      ++CG   +T S+   
Sbjct: 67  NQMSWIATSYLLSCSAFQPLYGKLSDVFGRKPLLIWSNLCFGFGCILCG-APFTKSLWML 125

Query: 150 IISRAFQGLG 159
            I R   G+G
Sbjct: 126 CIGRFIAGVG 135

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 38.1 bits (87), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 53/108 (49%), Gaps = 6/108 (5%)

Query: 34  DDKKWPSIQDPTYFSAPWKEYLFIFASM-MSQLLNQAGTTQTLSLINILSKNFDSSTSQQ 92
           DD +      P     P  + L I  SM +   L  A  T   +++  ++  F+    + 
Sbjct: 62  DDSRDGVASSPV----PPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNE-LPRI 116

Query: 93  TWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLT 140
           +W+  ++ L S +F  + GK+ DI+G K  L++  +V ++  L+CGLT
Sbjct: 117 SWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLT 164

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 55/122 (45%), Gaps = 12/122 (9%)

Query: 384 ILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQ 443
           +L L+ + F  GC+M  +TP     F  ++G   I   G        SI +SD +P+ ++
Sbjct: 146 LLMLNNIVFLVGCLMCGLTP----SFWGLVGARFISGIGGGGVTSMCSITISDIVPLRDR 201

Query: 444 GMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALYLGIGLASLGVFISAL 503
               +L   M N+   +     G V    + +G     G+R A  + + L++L   + A+
Sbjct: 202 ----ALYQGMCNFFFGLGTACGGVVGGWFSDHGG----GWRMAFLIQVPLSALSSLLIAV 253

Query: 504 FM 505
           FM
Sbjct: 254 FM 255

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 38.1 bits (87), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 76/161 (47%), Gaps = 8/161 (4%)

Query: 76  SLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIG-DIYGLKKTLLVGYVVTIIWS 134
           ++IN +  +FD+  ++  W++A + L +    L+ G+I     G K  +L   V+  I S
Sbjct: 80  TIINDVGAHFDA-YAKTGWIIAGYSLPNALMSLLWGRIAFSFLGFKTAMLSAIVIFEIGS 138

Query: 135 LICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAP 194
           LIC L    +S++  I  R   G+G + I  ++  ++G+  V+   R   +I+ + A   
Sbjct: 139 LICAL---ANSMDMLIGGRVIAGIGGSGI-QSLSFVIGSTLVSPRGR-GFIIAFMSASFG 193

Query: 195 IGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWV 235
           I + +G    G   T    W W F+      A+ + +  WV
Sbjct: 194 IASVIGPFIGGAF-TSHVTWRWCFWINLPVGAVALVIFTWV 233

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 37.7 bits (86), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 68/144 (47%), Gaps = 7/144 (4%)

Query: 76  SLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSL 135
           ++I  ++K F  S S+  WL   + L +    L+ G+I    G K+T+L   V+  + SL
Sbjct: 98  TIIEEVAKQF-GSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIFEVGSL 156

Query: 136 ICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPI 195
           I  L    +S+   I  R   G+G   I  ++  ++G+  V  + R  ++I+++     I
Sbjct: 157 ISAL---ANSMNVLIGGRVIAGVGGCGI-QSLSFVIGSNLVEESNR-GVLIAILSCSFAI 211

Query: 196 GATMGVLFSGLIGTLSERWAWTFY 219
            + +G    G+  T    W W FY
Sbjct: 212 ASVVGPFLGGVF-TSRVTWRWCFY 234

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score = 37.7 bits (86), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 71/155 (45%), Gaps = 19/155 (12%)

Query: 6   SNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASM-MSQ 64
            N+S  S  +  G        E  D+++D      ++DP       K + ++  S+  + 
Sbjct: 67  ENDSYKSGREHSGALEGNKEDEE-DLEID------LRDP-------KTFKWVLTSLWTNS 112

Query: 65  LLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLL 124
            L+    T   + +N ++  F  + S  TW+  ++ L + +   + GKI DI G +K LL
Sbjct: 113 ALSALDGTIVSTTVNDVASRFQQA-SMVTWVATAYLLTTTAAQPLYGKISDIIGRRKCLL 171

Query: 125 VGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLG 159
            G    I++++  GL  ++ S+    I+R   G+G
Sbjct: 172 FG---EIVFAVGVGLCIFSKSIPQLAIARGICGIG 203

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 37.7 bits (86), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 70/147 (47%), Gaps = 11/147 (7%)

Query: 75  LSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWS 134
           ++L + + + F+   +   WLMA + L +  F+L+ G+I  + GLK +L+   V+    S
Sbjct: 28  ITLYDTIGQEFND-YANVGWLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEAGS 86

Query: 135 LICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAP 194
           L+ G     +S+   I +R   G G + I   + G VG   V    R   VI+++G    
Sbjct: 87  LMAG---AANSMGMLIGARVISGFGGSGIESLVYG-VGTSIVEEKHRAR-VITVLGIAYM 141

Query: 195 IGATMGVLFSGLIGTLSER--WAWTFY 219
           +    G  F G  G L+E   W W FY
Sbjct: 142 LAEGAGP-FVG--GGLAEHVSWRWCFY 165

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 37.7 bits (86), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 51/116 (43%), Gaps = 3/116 (2%)

Query: 51  WKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVS 110
           +  Y+ +   M+S   +    T  LS    +   +    +  +W + ++ +    FI   
Sbjct: 21  FHRYINLVLIMVSCAFDLINVTAVLSATRDIENTYQIEFTTASWALTAYAITFAGFIAFL 80

Query: 111 GKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPN 166
           G++GDI G     +    +  I SLIC + +   +   F + RA QG+  A I+P+
Sbjct: 81  GRVGDIIGNSVLFVSSCFLFSILSLICAVVNNFGT---FAVFRALQGIAAAGIVPS 133

 Score = 35.0 bits (79), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 43/212 (20%), Positives = 87/212 (41%), Gaps = 12/212 (5%)

Query: 307 LIPRPAMHNHRLLMTLLAVFFGWGSF--GIWTFYYFCFVLNLREYTPLWAGGSYFMFLIW 364
           LIP+  +     +   +AVF  +G     ++    +C    + + +PL A       ++ 
Sbjct: 303 LIPKDVLMMKNFIPITVAVFANYGCLFSNLYIVNQYC--QYVSKNSPLLAAVKLLPLVVS 360

Query: 365 GIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPV--DQTYFRMILGMMIILSFG 422
            +I  + +      I P   + L       G I+L    +  D  Y+++      +++FG
Sbjct: 361 MLIPNVVIAIKSDLISPRKAVVLGFFIMFIGSIILIQLHLITDNLYWKIFFCSQSLIAFG 420

Query: 423 MDLSFPASSIILSDELPMENQGMAGSLVSTM----INYSMSMCLGIAGTVEHQINKNGDD 478
             + FP S  IL    P E +G+A  ++ T     +  + S+   I G +     K+G  
Sbjct: 421 AAIFFPYSLNILIGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTSILGNINELSGKSGSA 480

Query: 479 LL--KGYRAALYLGIGLASLGVFISALFMLEN 508
            +    ++   Y  +  + +G+  +A F+ EN
Sbjct: 481 GIYKTRFQNCTYFTLASSVVGLISTAFFVKEN 512

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 56/287 (19%), Positives = 110/287 (38%), Gaps = 25/287 (8%)

Query: 76  SLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSL 135
           +L++ ++  F+    + +W+  ++ L S +F  + GK+ DI+G +  L+   +V  + +L
Sbjct: 162 TLLDHIASEFNE-LPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGAL 220

Query: 136 ICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPI 195
           ICG+   + ++   ++ R   G+G   +    M  +    +     + +   +      +
Sbjct: 221 ICGM---SKNLWVLVLGRFVAGIGGGGL--TSMCSITTTDIVPLRSRALYQGICNVFFGL 275

Query: 196 GATMGVLFSGLIGTLSERWAWTFYAYTI-----TAAINMGLSI--------WVIPNTIPT 242
           G   G L  GL    +  W   F          T AI + L++             +IP 
Sbjct: 276 GTACGGLVGGLFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPW 335

Query: 243 NVRGSSMDWXXXXXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXXFFLYETKY 302
             +   +DW            F  V +   + G D                 F  +E   
Sbjct: 336 TTKLRMVDWTGTVTLVVFLFCFTLVCS---LYGEDLPHLYLIFVVILLSGSYFIYHELYV 392

Query: 303 ANDPLIPRPAMHNHRLLMTLLAVFF---GWGSFGIWTFYYFCFVLNL 346
           A DP++P   + N  +L   L+ +F   G  + G +   Y+  VLN+
Sbjct: 393 ATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNM 439

>KNAG0B04900 Chr2 (940751..942301) [1551 bp, 516 aa] {ON} 
          Length = 516

 Score = 37.4 bits (85), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 85/189 (44%), Gaps = 10/189 (5%)

Query: 52  KEYLFIFASMMSQLLNQAGTTQTLSLINILSK-NFDSSTSQQTWLMASFPLVSGSFILVS 110
           K Y+ +  ++ S ++    +  T    +I+ K +     S    ++  F L  G   L  
Sbjct: 74  KYYIAVLITVTSMVITMISSCWTFVSPHIIEKFHVSREVSVLGIMLYVFGLAFGPLFL-- 131

Query: 111 GKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGI 170
             I ++YG + T +    ++I+W     LT+++ ++   +  R   G   +  L    G 
Sbjct: 132 SPISELYGRRATFIFSLTLSIVWQC---LTTWSRTLTGVMFGRFLSGFFGSSFLSVAGGA 188

Query: 171 VGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMG 230
           + +I++   ++  + +SL    A +G ++G + SG + T+  R  WTF  + I + + + 
Sbjct: 189 ISDIFL--KSQITVPMSLYTTAAMMGPSLGPIISGALYTVDFR--WTFVTFIIASGVCLV 244

Query: 231 LSIWVIPNT 239
             +  IP T
Sbjct: 245 AIVVTIPET 253

>SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180W DTR1
           Multidrug resistance dityrosine transporter of the major
           facilitator superfamily essential for spore wall
           synthesis facilitates the translocation of bisformyl
           dityrosine through the prospore membrane
          Length = 596

 Score = 37.4 bits (85), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 55/252 (21%), Positives = 105/252 (41%), Gaps = 12/252 (4%)

Query: 5   RSNESVSSQSKE---LGTQSATAF-TEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFAS 60
            S E +  +SKE   +  + ATA  TE + ++  ++   S + P Y +   K+ L IF  
Sbjct: 88  ESEEDIEKKSKEELKIEKRIATATSTEETSLKSANR---SKEPPPYTAFSKKQRLIIFLV 144

Query: 61  MM-SQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGL 119
           ++    L        +  + +L ++F+ S +     ++ F  V     L      D  G 
Sbjct: 145 IIYVGFLGPLSGNIYIPALPLLQESFNVSATTINATVSVFMAVFSVGPLFWALFADFGGR 204

Query: 120 KKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGT 179
           K   +V  ++TII +++           FF+  R  Q  G + ++   +G V +I    +
Sbjct: 205 KFLYIVSLLLTIIVNILLSAVPTNIGALFFL--RIAQAFGSSSVMSLGIGTVSDITPPKS 262

Query: 180 TRKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNT 239
             + +   ++G    +G  +  + +GLI   S  W W F    I + I + L + ++P T
Sbjct: 263 RGRAVSYFMLGPN--MGPILAPIIAGLILMSSNNWRWLFGFICIISGIALFLVVLLLPET 320

Query: 240 IPTNVRGSSMDW 251
           +   V      W
Sbjct: 321 LRCIVGNGDPHW 332

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 37.4 bits (85), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%)

Query: 93  TWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLT 140
           +W+  ++ L S +F  + GKI DI+G K  L+   +   + SLICGL+
Sbjct: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 37.4 bits (85), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 59/138 (42%), Gaps = 14/138 (10%)

Query: 109 VSGKIGDIYGLKKTLLVGYVVTIIWSL-ICGLTSYTSSVEFFIISRAFQGLGIAFILPNI 167
           VSG + DIYG +  +L G +V ++ S+ I    SY       I  R  Q  GI+ ++   
Sbjct: 153 VSGGLADIYGRRPVILFGMLVYVVASIGIAACNSYG----VIIFLRCLQSTGISPLIAIS 208

Query: 168 MGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIG---TLSERWAWTFYAYTIT 224
            G VG+  V          + +GA + +   MG  F  LIG     +  W   F+   I 
Sbjct: 209 SGAVGDFTVKAERG-----TFVGAVSGL-VLMGQAFGSLIGAALAAAYNWRAIFWFLAIG 262

Query: 225 AAINMGLSIWVIPNTIPT 242
               M ++  V+P T  T
Sbjct: 263 CGACMAIAGIVLPETKRT 280

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 62/132 (46%), Gaps = 18/132 (13%)

Query: 94  WLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISR 153
           WL+  + L S  F L+ G++  + GLK  L++  ++  I SLI  +   ++S+   I  R
Sbjct: 82  WLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIAAV---SNSMGMLIAGR 138

Query: 154 AFQGLGIAFILPNIMGIVGNIYVAGTT----RKNMVISLIGACAPIGATMGVLFSGLIGT 209
              G G +       GI   +Y+ GT+    R   ++ ++   A +G+  G    G  G 
Sbjct: 139 VVAGAGGS-------GIQSLVYIVGTSLVSERSRGMVIMVLTFAFVGSNAGGPILG--GA 189

Query: 210 LSER--WAWTFY 219
           L+E   W W F+
Sbjct: 190 LNEHASWRWCFF 201

>Skud_9.48 Chr9 (109346..111145) [1800 bp, 599 aa] {ON} YIL120W
           (REAL)
          Length = 599

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 100/245 (40%), Gaps = 22/245 (8%)

Query: 8   ESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTY--FSAPWKEYLFIFASMMSQL 65
           ES+ S +KE    +A   + H    V  K  P I  P +  FS  +K  L    +     
Sbjct: 42  ESIRSYNKE----TADKLSLHRTESV--KPEPEITAPPHSRFSRSFKTVLIAQCAFTGFF 95

Query: 66  LNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLV 125
              AG      +++++ + F+         +  + +  G    + G   D  G +  +L+
Sbjct: 96  STIAGAIY-YPVLSVIERKFNIDEQLVNVTVVVYFVFQGLAPTLMGGFADSLGRRPVVLI 154

Query: 126 GYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMV 185
                II+   C   + T +    I+ R  Q  GI+ ++    GI+G+I    TTR    
Sbjct: 155 A---IIIYFGACVGLACTQTYAQIIVLRCLQAAGISPVIAINSGIMGDI----TTRAERG 207

Query: 186 ISLIGACAPIGATMGVLFSGLIGT-LSERWAWT--FYAYTITAAINMGLSIWVIPNTIPT 242
              +G  A     +G  F  LIG  LS RW W   F+  TI + I    S+ ++P T   
Sbjct: 208 -GYVGYAAGF-QVLGSAFGALIGAGLSSRWGWRAIFWFLTIGSGICFLASLLILPET-KR 264

Query: 243 NVRGS 247
           N+ G+
Sbjct: 265 NISGN 269

>TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432
          Length = 649

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 15/95 (15%)

Query: 108 LVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFIL--- 164
           L+S  + D  G K +L   +V  I+W + CG+ S ++ V   ++ R   G+GI F +   
Sbjct: 83  LLSPSVSDALGRKCSL---HVSCILWCIGCGIQSGSTGVAMLVVGRVIAGVGIGFGVAAA 139

Query: 165 ---------PNIMGIVGNIYVAGTTRKNMVISLIG 190
                    P + G V  I+    T   +V+  IG
Sbjct: 140 PMYCVELAPPRVRGTVVGIFQLAVTAGILVLFFIG 174

>KAFR0J00480 Chr10 (84206..85708) [1503 bp, 500 aa] {ON} Anc_5.284
           YHR048W
          Length = 500

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 52/249 (20%), Positives = 109/249 (43%), Gaps = 27/249 (10%)

Query: 3   FKRSNESVSSQSKELGTQSATAF--TEHSDVQVDDKKWPSIQDPTYFS---APWKEY--- 54
           +++S E  +  + E+ ++       TE  + +V       I DP   S   + W++Y   
Sbjct: 4   YQKSEEESAETAMEVHSEIKLEVNETEKEEFEVTFDSIDDI-DPENVSLRMSTWRKYYIS 62

Query: 55  -LFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKI 113
            L  F +M+  +++   T  +  ++     + + S    T  +  F L  G   L    I
Sbjct: 63  LLITFTAMVITMISSCWTFVSPHIMAKYGISHEVSVLGIT--LYVFGLACGPLFL--SPI 118

Query: 114 GDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGN 173
            ++YG + T +   V+++I+     LT++++++E  +  R   G   +  L    G + +
Sbjct: 119 SELYGRRITFIFSLVLSMIFQC---LTTWSATIEGVMFGRFLSGFFGSSFLSVAGGTISD 175

Query: 174 IYVAGTTRKNMV---ISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMG 230
           ++      KN +   ++       +G ++G L SG + T+  RW  TF  + I++ +   
Sbjct: 176 LF-----DKNQITVPMTFFTTAGLLGPSLGPLISGAMYTVEYRW--TFVLFLISSGVCFV 228

Query: 231 LSIWVIPNT 239
           L I  +P T
Sbjct: 229 LIILTVPET 237

>KNAG0A03540 Chr1 (450487..452103) [1617 bp, 538 aa] {ON} Anc_8.570
           YBR180W
          Length = 538

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 52/251 (20%), Positives = 108/251 (43%), Gaps = 10/251 (3%)

Query: 5   RSNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQ---DPTYFSAPWKEYLFIFASM 61
           R  + V +  +  GT + +AF +  D++ +++   ++Q   + T F+      +F+  + 
Sbjct: 25  RLRQDVPATEQGNGTPNHSAFLDAIDLKENEESLANVQTQRNYTCFTNGQIFLIFVIITF 84

Query: 62  MSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKK 121
           +  L   +G     +L  +    F +STS     ++ F  V     L+ G   D+ G K 
Sbjct: 85  IGFLGPMSGNIYIPAL-PLFQTIFHTSTSTINATVSVFMAVFAVGPLLWGAYADVGGRKI 143

Query: 122 TLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTR 181
             L+   +  I +++  L S + ++    I R  Q    + ++    G V ++ V     
Sbjct: 144 LYLLSLALMFIVNVL--LASLSPNIVALFILRIAQAFASSSVIALGAGTVTDLIVPSARG 201

Query: 182 KNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWV-IPNTI 240
           K +   ++G    +G  +  + +GLI   ++RW W F    I + + + L +W+ +P T+
Sbjct: 202 KAIGYFMMGP--NMGPVIAPIVAGLILINTDRWRWLFGFCAIMSGVAL-LCVWIFLPETL 258

Query: 241 PTNVRGSSMDW 251
              V      W
Sbjct: 259 RCIVGNGDPSW 269

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 94/227 (41%), Gaps = 23/227 (10%)

Query: 4   KRSNESVSSQSKELGTQSATAFTEHSDVQV----DDKKWP--------SIQDPTYFSAPW 51
           K++ ++  S+S    T +     +  DV      D++ +P        S +D  Y    +
Sbjct: 19  KKNCDNTGSESSVFRTVTRELRDDTDDVVTHEIYDEESFPDGSKQEQLSEEDVPYTLLTY 78

Query: 52  KEYLFIFASMMSQ-LLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVS 110
           ++  F+ A + S    +  G+      +  L   FD +       +  + L  G    +S
Sbjct: 79  RQKWFMVALLTSAGFWSSLGSPIYYPALKELEAEFDVNEELINITVVVYLLFQGIAPTIS 138

Query: 111 GKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGI 170
           G + D+YG +  +L+G ++ +I S+    +    +V F    R  Q  GI+ I+    G+
Sbjct: 139 GGLADVYGRRPIILLGMLIYVIASIGLACSKSYGAVVFL---RCLQSAGISPIIAINSGV 195

Query: 171 VGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIG-TLSERWAW 216
            G+  V     K+   + +GA +     MG  F  LIG  L+  + W
Sbjct: 196 AGDFTV-----KSERGTFVGAVSGF-TLMGQAFGSLIGAALTAAYDW 236

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 67/149 (44%), Gaps = 17/149 (11%)

Query: 76  SLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSL 135
           ++I  +S+ F    S+  WL   + L +   +L+ G+I  + G K + L   V+  + SL
Sbjct: 65  TIIEEVSQKF-GDYSKVGWLFTGYSLPNALLVLIWGRIATLVGFKTSTLAAIVIFEVGSL 123

Query: 136 ICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTT-----RKNMVISLIG 190
           +  L    +S++  I  R   G+G +       G+   ++V  +T      + ++I+++ 
Sbjct: 124 VSAL---ANSMDMLIGGRVIAGIGGS-------GVQSLVFVISSTLVEERNRGLIIAVMS 173

Query: 191 ACAPIGATMGVLFSGLIGTLSERWAWTFY 219
           +   I + +G    G   T    W W FY
Sbjct: 174 SSFGIASVVGPFLGGAF-TTHVTWRWCFY 201

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 66/142 (46%), Gaps = 7/142 (4%)

Query: 78  INILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLIC 137
           I ++++ F    S+  W+++ + L      L+ G+   I G K +LLV  ++    SLI 
Sbjct: 142 IEVIAEQFKD-YSKSGWIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGSLIS 200

Query: 138 GLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGA 197
            +   ++S+   I  R   G+G + I  ++  ++ +      +R  ++IS++     + A
Sbjct: 201 AI---SNSMNMLIGGRVVAGIGGSGI-QSLCFVIASTLTPDRSRV-IIISVLSCSYAVAA 255

Query: 198 TMGVLFSGLIGTLSERWAWTFY 219
            +G    G + T    W W FY
Sbjct: 256 VVGPFLGGAL-TTHVTWRWCFY 276

>Smik_8.117 Chr8 (181800..183344) [1545 bp, 514 aa] {ON} YHR048W
           (REAL)
          Length = 514

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 51/236 (21%), Positives = 97/236 (41%), Gaps = 16/236 (6%)

Query: 4   KRSNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMS 63
           K   E  S ++ + G +    F E      D  +  S     Y S+     L  F SM+ 
Sbjct: 32  KLDLELSSERNDDGGKEHEVIFREDLADPEDIARHMSTVRRYYISS-----LITFTSMVI 86

Query: 64  QLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTL 123
            +++ + T  +  +I     + + ST   T  +  F L  G   L    + ++YG + T 
Sbjct: 87  TMISSSWTLPSAHIIKSFHISHEVSTLGIT--LYVFGLGIGPLFL--SPLSELYGRRITF 142

Query: 124 LVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKN 183
           L    ++IIW     LT ++ ++   +  R   G   +  L    G + +I+     +  
Sbjct: 143 LYALTLSIIWQC---LTIWSRTITGVMFGRFLSGFFGSAFLSVAGGAIADIF--DKDQIG 197

Query: 184 MVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNT 239
           + +++    A +G ++G +  G +    E + WTF    IT+   + L ++ IP T
Sbjct: 198 IPMAIYTTSAFLGPSLGPIIGGAL--YHESYKWTFITLLITSGCCLVLIMFTIPET 251

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%)

Query: 93  TWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLT 140
           +W+  ++ L S +F  + GKI DI+G K  L+   V+  +  LICGL+
Sbjct: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 44/83 (53%), Gaps = 4/83 (4%)

Query: 72  TQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTI 131
           T   +++N ++  F  S  +Q W+  S+ L + +F  + GK+ DI G K  ++  +    
Sbjct: 60  TVVANIMNSIAAEFAESDKKQ-WIATSYLLTNTAFQPLYGKLSDITGRKVAVITAH---F 115

Query: 132 IWSLICGLTSYTSSVEFFIISRA 154
            ++L C LT +  +V  F I+RA
Sbjct: 116 FFALGCLLTCFAQNVTQFSIARA 138

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 58/131 (44%), Gaps = 16/131 (12%)

Query: 94  WLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISR 153
           WL+  + L +  F+L+ G++ +I G K+ L++  +V  I SLI  L   ++S+   I  R
Sbjct: 47  WLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISAL---SNSMATLISGR 103

Query: 154 AFQGLGIAFILPNIMGIVGNIYVAGTT-----RKNMVISLIGACAPIGATMGVLFSGLIG 208
              G G +       GI    +V GT+      + ++I+ +     I   +G    G   
Sbjct: 104 VVAGFGGS-------GIESLAFVVGTSIVRENHRGIMITALAISYVIAEGVGPFIGGAFN 156

Query: 209 TLSERWAWTFY 219
                W W FY
Sbjct: 157 E-HLSWRWCFY 166

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 44/234 (18%), Positives = 91/234 (38%), Gaps = 8/234 (3%)

Query: 12  SQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGT 71
           + + ELG    ++   H + +           P       +++  +F   ++   +  G+
Sbjct: 48  TTTNELGDDDTSSECSHDEQEQQHIVEGEQNYPHTLLTYRQKWFMVFLMTITGFWSSLGS 107

Query: 72  TQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTI 131
                 +  L + F+   ++    +  + L  G    +SG + D+YG +  +L G ++ +
Sbjct: 108 PIYYPALKELEQKFNIDENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVILGGMLIFV 167

Query: 132 IWSL-ICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIG 190
           + S+ I    SY       +  R  Q +GI+  +    G+V +  V     +   +    
Sbjct: 168 VASIGIAKAPSYG----VIVFLRCIQSIGISPTIAISSGVVSDFTVK--RERGTFVGATS 221

Query: 191 ACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNTIPTNV 244
               IG  +G L   +I T +  W   F+  TI     M +  +++P T  T V
Sbjct: 222 GLVLIGQGIGPLLGAVI-TAALHWRAVFWFLTIGCGSCMIIGFFLLPETKRTIV 274

>YHR048W Chr8 (204607..206151) [1545 bp, 514 aa] {ON}  YHK8Presumed
           antiporter of the DHA1 family of multidrug resistance
           transporters; contains 12 predicted transmembrane spans;
           expression of gene is up-regulated in cells exhibiting
           reduced susceptibility to azoles
          Length = 514

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 97/232 (41%), Gaps = 17/232 (7%)

Query: 9   SVSSQSKELGTQS-ATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLN 67
            ++S+ K  G QS    F E      D  +  S     Y S+     L  F SM+  +++
Sbjct: 36  ELTSERKNDGKQSHEVTFNEDIADPEDIARHMSTARRYYISS-----LITFTSMVITMIS 90

Query: 68  QAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGY 127
            + T  +  +I     + + ST   T  +  F L  G   L    + ++YG + T L   
Sbjct: 91  SSWTLPSTHIIEHFHISHEVSTLGIT--LYVFGLGIGPLFL--SPLSELYGRRITFLYAL 146

Query: 128 VVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVIS 187
            ++IIW     LT ++ ++   +  R   G   +  L    G + +I+     +  + ++
Sbjct: 147 TLSIIWQC---LTIWSKTITGVMFGRFLSGFFGSAFLSVAGGAIADIF--DKDQIGIPMA 201

Query: 188 LIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNT 239
           +    A +G ++G +  G +    + + WTF    IT+   + + I+ IP T
Sbjct: 202 IYTTSAFLGPSLGPIIGGAL--YHQSYKWTFITLLITSGCCLVMIIFTIPET 251

>Skud_3.172 Chr3 complement(280981..282546) [1566 bp, 521 aa] {ON}
           YCR098C (REAL)
          Length = 521

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 34/167 (20%), Positives = 71/167 (42%), Gaps = 14/167 (8%)

Query: 10  VSSQSKELGTQSATAFTEHSDVQV--DDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLN 67
           + ++ K+  T     F E ++ ++   D +  + +  +     WK  + I AS  + L++
Sbjct: 2   MKTEEKDSSTIDEIEFNEKNNSRIIKYDAEGRATRTQSSKKDKWKNIITIIASGFA-LIS 60

Query: 68  QAGTTQTLSLINIL------SKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKK 121
                 ++S++N L      +KN+ S  S +    +   ++ G F +  G   D Y  K 
Sbjct: 61  DGYVNGSMSMLNKLFVMEYGAKNYSSKVSTRVSNASLVGIIFGQFFM--GIAADYYSRKS 118

Query: 122 TLLVGYVVTIIWSLICGLTSYTSSVEFF---IISRAFQGLGIAFILP 165
            +LV   + ++ S +C  +  T+    F    + R   G+G+    P
Sbjct: 119 CILVATTILVVGSALCAASHGTTVPGMFWMLTVMRGLVGIGVGAEYP 165

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 64/140 (45%), Gaps = 6/140 (4%)

Query: 115 DIYGLKKTLLVGYVVTIIWSLI--CGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVG 172
           D  G K TL++G+   I++ LI  C     +     FII  A   +       N++G++ 
Sbjct: 333 DRIGRKYTLMIGFSGYIVFGLIIGCAYDQLSKITPLFIIFYALMNMLGNAGPGNMLGVIS 392

Query: 173 NIYVAGTTRKNMVISLIGACAPIGATMGV-LFSGLIGTLSERWAWTFYAYTITAAINMGL 231
           +   A T  + +   +      IG+ +GV  F  +   L  R  WTF    I   + + +
Sbjct: 393 SESSA-TAVRGVFYGISAVTGKIGSVVGVECFQPIRDNLGAR--WTFIIAAICGLVGVVI 449

Query: 232 SIWVIPNTIPTNVRGSSMDW 251
           + +++P+++ +++    +D+
Sbjct: 450 TYFLVPHSLDSDLMKQDVDF 469

>Suva_8.358 Chr8 complement(630597..632165) [1569 bp, 522 aa] {ON}
           YOR306C (REAL)
          Length = 522

 Score = 35.0 bits (79), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 87/202 (43%), Gaps = 20/202 (9%)

Query: 4   KRSNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMS 63
           K++++ V+    +      T+ T  SD + +D +  +   P   +  W      F  +++
Sbjct: 61  KKADDKVTDIESQPNWGETTSRTHDSDNEKEDSEDEADSFPEGGAKAWIVTFGCFMGLVA 120

Query: 64  --QLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKK 121
              LLN  G  ++    N L+K    S S   WL + F  V  +  ++SG   D  G + 
Sbjct: 121 CFGLLNSTGVMESHLQDNQLAKE---SVSTIGWLFSLFLFVCFASCIISGTYFDRNGFRT 177

Query: 122 TLLVGYVVTIIWSLICGLTSYTSSVEF--FIISRAF-QGLGIAFILPNIMGIVGNIYVAG 178
            +++G V       + GL +  +S ++  FI+S A   G G   +L  ++ +  + +   
Sbjct: 178 IMIIGTVFH-----VAGLFATANSTKYWHFILSFAIVCGFGNGIVLSPLVSVPAHYFFK- 231

Query: 179 TTRKNMVISLIGACAPIGATMG 200
             R+   +    A A IG ++G
Sbjct: 232 --RRGTAL----AVATIGGSVG 247

>YCR098C Chr3 complement(297049..298605) [1557 bp, 518 aa] {ON}
           GIT1Plasma membrane permease, mediates uptake of
           glycerophosphoinositol and glycerophosphocholine as
           sources of the nutrients inositol and phosphate;
           expression and transport rate are regulated by phosphate
           and inositol availability
          Length = 518

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 34/164 (20%), Positives = 70/164 (42%), Gaps = 14/164 (8%)

Query: 13  QSKELGTQSATAFTEHSDVQV--DDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAG 70
           + K++ + +     E+++ ++   D +  + +  T     WK  + I AS  + L++   
Sbjct: 2   EDKDITSVNEKEVNENTNPRIIKYDAERRATRTETSKKDKWKNIVTIIASGFA-LISDGY 60

Query: 71  TTQTLSLINIL------SKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLL 124
              ++S++N +       KN+ S  S +    A   ++ G F +  G   D Y  K  +L
Sbjct: 61  VNGSMSMLNKVFVMEYGKKNYSSKVSTRVSNAALVGIIFGQFFM--GIAADYYSRKSCIL 118

Query: 125 VGYVVTIIWSLICGLTSYTSSVEFF---IISRAFQGLGIAFILP 165
           V   + +I S +C  +  T+    F    + R   G+G+    P
Sbjct: 119 VATAILVIGSALCAASHGTTVPGMFWMLTVMRGLVGIGVGAEYP 162

>CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121w
          Length = 583

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 55/247 (22%), Positives = 99/247 (40%), Gaps = 20/247 (8%)

Query: 11  SSQSKELGTQSATAFTEHSDVQVDDKKWPSIQD-PTY--FSAPWKEYLFIFASMMSQLLN 67
               K + T    A  E       ++  P I + P Y  F A +K  L +  +       
Sbjct: 36  EDNDKMIKTNEDEAVKEPIYRTRSNQTEPDIANAPPYSRFDAKYKMALVLQCAYTGLFST 95

Query: 68  QAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGY 127
            AG      +++++ K F  +       +  + +  G    + G + D  G +  +L  +
Sbjct: 96  MAGAIY-YPVLSVIEKQFHITEELVNITVVVYFIFQGIAPTLMGGLADSLGRRPVVL--F 152

Query: 128 VVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTR--KNMV 185
            VT+ +    GL    +  +  ++ R  Q  GI+ ++    GI+G++    TTR  +   
Sbjct: 153 AVTVYFGACIGLACAQTYAQIVVL-RCLQAAGISPVIAINSGIIGDV----TTRAERGGY 207

Query: 186 ISLIGACAPIGATMGVLFSGLIGT-LSERWAWT--FYAYTITAAINMGLSIWVIPNTIPT 242
           +  I     +G+  G     LIG  LS RW W   F+   I + + +  SI ++P T  T
Sbjct: 208 VGYISGFQVLGSAFG----ALIGAGLSSRWGWRSIFWFLAIGSGVCLVFSIIMLPETKRT 263

Query: 243 NVRGSSM 249
            V   S+
Sbjct: 264 IVGNGSV 270

>ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} similar
           to uniprot|P18851 YOR212W Saccharomyces cerevisiae STE4
           G protein beta subunit
          Length = 431

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 1/68 (1%)

Query: 172 GNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGL 231
           GN+ V+G    N  I  +   + +  ++  +F G  G +S+  A+T  A+ +TA+ +M  
Sbjct: 151 GNLAVSGGLNNNCTIYRVPRDSKVQQSVVSIFKGHTGYISDT-AFTDNAHVVTASGDMTC 209

Query: 232 SIWVIPNT 239
           + W IP T
Sbjct: 210 AYWDIPKT 217

>KLTH0C00462g Chr3 complement(49362..51074) [1713 bp, 570 aa] {ON}
           highly similar to uniprot|P23585 Saccharomyces
           cerevisiae YMR011W HXT2 High-affinity glucose
           transporter of the major facilitator superfamily
           expression is induced by low levels of glucose and
           repressed by high levels of glucose
          Length = 570

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 82/199 (41%), Gaps = 25/199 (12%)

Query: 4   KRSNE----SVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYL---- 55
            RSN     +++  S  L +QSAT   + SD   D K  P+ +       P  EY+    
Sbjct: 10  NRSNNNTDLAIAGTSTNLDSQSATPSNKMSDDAFDIKGSPAAEAHEIPQKPLSEYILVMC 69

Query: 56  ---------FIFA---SMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVS 103
                    F+F      +S  +N     +     N  ++ +  S  +   ++A F +  
Sbjct: 70  LCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGDYNTTTEEYYLSNVRTGLIVAIFNIGC 129

Query: 104 GSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGL---GI 160
               L  G++GD+ G +  L+   +V ++  ++  +++     ++F I R   GL   GI
Sbjct: 130 AVGGLTLGRLGDMQGRRLGLMAVILVYVV-GIVIQISASGKWYQYF-IGRIVSGLGVGGI 187

Query: 161 AFILPNIMGIVGNIYVAGT 179
           A + P ++      ++ GT
Sbjct: 188 AVLSPTLISETAPKHLRGT 206

>KLLA0B06798g Chr2 (596500..598491) [1992 bp, 663 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 663

 Score = 35.0 bits (79), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 44/205 (21%), Positives = 87/205 (42%), Gaps = 13/205 (6%)

Query: 39  PSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMAS 98
           P  +D   +    K ++ +  +    ++   GT+     I  L  +FD+ST      +  
Sbjct: 96  PEYKDSREYPRHLKSFIVLIIAY-GAVMGPMGTSIIFPAIGPLVADFDTSTIMVDVSVGI 154

Query: 99  FPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGL 158
           + L  G F +    + +I G +   ++ + +   +++   L+   S+   FI+ R  QG 
Sbjct: 155 YLLSLGIFPIWWSSLSEIEGRRTVYVLSFTLLTAFTIGSALSPNISA---FIVFRMLQGA 211

Query: 159 GIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGT-LSERWAW- 216
             A +     G + ++++     KN+    +G        M  L S +IG  L  RW+W 
Sbjct: 212 SSASVQSVGAGTISDLFIPEERGKNLGYYYLGTL------MAPLLSPIIGALLVNRWSWR 265

Query: 217 -TFYAYTITAAINMGLSIWVIPNTI 240
            T +   I A +N+ L   ++P T+
Sbjct: 266 STQWFMVILAVVNVLLFTLLLPETL 290

>TPHA0B03770 Chr2 (890983..892545) [1563 bp, 520 aa] {ON} 
          Length = 520

 Score = 34.3 bits (77), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 63/131 (48%), Gaps = 15/131 (11%)

Query: 113 IGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQG-LGIAFILPNIMGIV 171
           + ++YG +KT ++    +I+W     L  ++ ++E  +  R   G  G AF     + + 
Sbjct: 137 LSELYGRRKTFIISLFFSIVWQC---LVIWSKTIEGVMFGRFLSGFFGSAF-----LSVA 188

Query: 172 GNIYVAGTTRKNMVISL-IGACAP-IGATMGVLFSG-LIGTLSERWAWTFYAYTITAAIN 228
           G ++     +KN+ I + I   +P +G  +G + SG L GT    + WTF    + + ++
Sbjct: 189 GGLFTDIFEKKNIGIPITIYTTSPMLGPALGPIISGALHGT---NYKWTFITMLLASGLS 245

Query: 229 MGLSIWVIPNT 239
               I ++P T
Sbjct: 246 FICVILLVPET 256

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 34.3 bits (77), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 61/132 (46%), Gaps = 18/132 (13%)

Query: 94  WLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISR 153
           WL+  + L +  F+L+ G++ +I G  + L++  ++  + SLI  L   ++S+   I  R
Sbjct: 47  WLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIFEVGSLISAL---SNSMGTLISGR 103

Query: 154 AFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSG----LIGT 209
              G G + I  ++  +VG   V    R  M+ +L        AT  V+  G    + G 
Sbjct: 104 LIAGFGGSGI-ESLAFVVGTSIVQENHRGTMITAL--------ATSYVIAEGVGPFIGGA 154

Query: 210 LSER--WAWTFY 219
            +E   W W FY
Sbjct: 155 FNEHLSWRWCFY 166

>ZYRO0G16302g Chr7 complement(1336890..1338533) [1644 bp, 547 aa]
           {ON} similar to uniprot|P38776 Saccharomyces cerevisiae
           YHR048W Hypothetical ORF
          Length = 547

 Score = 34.3 bits (77), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 49/244 (20%), Positives = 100/244 (40%), Gaps = 28/244 (11%)

Query: 2   WFKRSNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPT----YFSAPWKEYLFI 57
           + KR   SVS  ++    Q   +F E S             DP     + S P K Y+  
Sbjct: 63  FLKRIETSVSQTNEGKNLQYEVSFEEGS------------MDPENIAMHLSWPRKYYVST 110

Query: 58  FASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIY 117
             +++S ++    +  +L   +++S +F  S       ++ +    G   L+   I ++Y
Sbjct: 111 LVTLISGIITMISSCWSLVAEDVMS-HFHISREVSVLGISLYIFGLGCGPLLLSPISELY 169

Query: 118 GLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVA 177
           G + T +     ++ W     L  ++ ++E  +  R   G   +  L    G + +I+  
Sbjct: 170 GRRITFIFSLSFSVAWQC---LVIWSPTIEGVLFGRFLSGFFGSSFLSVASGTISDIF-- 224

Query: 178 GTTRKNMVISL-IGACAPI-GATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWV 235
             T+  + I +   A AP  G ++G + SG      + + W F    I +++ +GL  + 
Sbjct: 225 --TKDQIGIPMTFYALAPFAGPSLGPVLSGAFN--KDGYKWPFIVMMIVSSVLLGLVTFT 280

Query: 236 IPNT 239
           +P +
Sbjct: 281 VPES 284

>Smik_4.46 Chr4 (89787..92432) [2646 bp, 881 aa] {ON} YDL194W (REAL)
          Length = 881

 Score = 34.3 bits (77), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 54/111 (48%), Gaps = 10/111 (9%)

Query: 81  LSKNFDSSTSQQTWLMASFPLVSGSFI--LVSGKIGDIYGLKKTLLVGYVVTIIWSLICG 138
           ++ N DS T+QQ  ++ SF L  G+F   L +  I D YG K T++  +   +I+S+   
Sbjct: 131 VAPNHDSFTAQQMSILVSF-LSLGTFFGALTAPFISDSYGRKPTII--FSTLVIFSIGNS 187

Query: 139 LTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLI 189
           L      +   I+ R   G+GI  I       V  +Y A  T K++  ++I
Sbjct: 188 LQVGAGGITLLIVGRVISGIGIGAI-----SAVVPLYQAEATHKSLRGAII 233

>TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 34.3 bits (77), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 54/102 (52%), Gaps = 16/102 (15%)

Query: 104 GSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEF---FIISRAFQGLGI 160
           GSF L  G++GDIYG +  L+V  V+ II ++I       +SV+    ++I R   GLG 
Sbjct: 134 GSFFL--GRLGDIYGRRIGLIVASVIFIIGTVI-----QIASVKAWYQYMIGRIIAGLGC 186

Query: 161 AFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVL 202
             I      I+  + ++  + KNM  +++ +C  +  T+G+ 
Sbjct: 187 GLI-----AILSPMLISEVSPKNMRGAMV-SCYQLMITLGIF 222

>Skud_2.155 Chr2 complement(291487..293553) [2067 bp, 688 aa] {ON}
           YBR043C (REAL)
          Length = 688

 Score = 34.3 bits (77), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 43/205 (20%), Positives = 86/205 (41%), Gaps = 13/205 (6%)

Query: 39  PSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMAS 98
           P  +D   +  P  + + +F    S ++   GT+     IN ++  F +S       +  
Sbjct: 93  PEFKDARDY-PPMMKKMIVFLIAFSSMMGPMGTSIIFPAINAITTEFKTSVIMVNVSIGV 151

Query: 99  FPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGL 158
           + L  G F L    + ++ G + T +  +   ++++   G +++   +  FI  R   G 
Sbjct: 152 YLLSLGVFPLWWSSMSELEGRRTTYITSFA--LLFAFNIG-SAFAPDINSFIALRMLCGA 208

Query: 159 GIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGT-LSERWAW- 216
             A +     G V ++Y++    KN+    +G        +  L S +IG+ L  RW W 
Sbjct: 209 ASASVQSVGAGTVADLYISEDRGKNLSYYYLGPL------LAPLLSPIIGSLLVNRWPWR 262

Query: 217 -TFYAYTITAAINMGLSIWVIPNTI 240
            T +   I +  N+ L   ++P T+
Sbjct: 263 STQWFMVILSGCNVILLTVLLPETL 287

>Kwal_56.22949 s56 complement(342503..344431) [1929 bp, 642 aa] {ON}
           YBR043C (AQR2) - YBR043C [contig 184] FULL
          Length = 642

 Score = 33.9 bits (76), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 74/167 (44%), Gaps = 20/167 (11%)

Query: 54  YLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKI 113
           +L  +A+MM  +    GT+     I  + K+FD++T      +  + L  G   L    +
Sbjct: 96  FLIAYAAMMGPM----GTSIIFPSITSIEKDFDTTTMMVNVSVGIYLLSLGVLPLWWSSL 151

Query: 114 GDIYGLKKTLLVGYVVTIIWSLICGL---TSYTSSVEFFIISRAFQGLGIAFILPNIMGI 170
            ++ G ++T+ V     + ++L+C     ++   ++E FI+ R   G   A +     G 
Sbjct: 152 SELRG-RRTVYV-----LSFTLLCAFCIGSALAPNIEAFIVFRMLCGASSASVQSVGAGT 205

Query: 171 VGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGT-LSERWAW 216
           V ++Y      K +    +GA       M  L S +IG+ L  RW+W
Sbjct: 206 VADLYKPEDRGKRLGYYYLGAL------MAPLLSPIIGSLLVNRWSW 246

>ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL065W (AQR1),
           YIL121W and YIL120W (QDR1); Tandem gene duplication in
           Saccharomyces cerevisiae
          Length = 534

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 78/188 (41%), Gaps = 18/188 (9%)

Query: 61  MMSQLLNQAG------TTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIG 114
           MM  LL  AG      +      +  L + F  S       +  + L  G    V   + 
Sbjct: 70  MMVALLTSAGFWSSLGSPAVYPALRNLQREFGVSEDLVNIAVVVYLLFQGVAPTVCSGLA 129

Query: 115 DIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNI 174
           D YG +  +L+G ++ I+ S+  G+ + ++S    I  R  Q  GI+ I+    G+VG+ 
Sbjct: 130 DTYGRRPVILMGMLIFIVSSI--GI-ACSNSFALVIALRCIQSSGISPIIAINSGVVGDF 186

Query: 175 YVAGTTRKNMVISLIGACAPIGATMGVLFSGLIG---TLSERWAWTFYAYTITAAINMGL 231
                T K+   + IGA + +   +G  F  LIG   T +  W   F+  TI   +    
Sbjct: 187 -----TLKSERGTFIGAVSGL-TLLGQAFGSLIGASLTAAYNWRAVFWFMTIGCGVCFLA 240

Query: 232 SIWVIPNT 239
           +   +P T
Sbjct: 241 NFLFLPET 248

>NDAI0D01680 Chr4 complement(395646..397196) [1551 bp, 516 aa] {ON}
           Anc_5.284
          Length = 516

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 55/127 (43%), Gaps = 7/127 (5%)

Query: 113 IGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVG 172
           I ++YG + T +    ++IIW     LT+++ +V   +  R   G   +  L    G + 
Sbjct: 134 ISELYGRRLTFIFSMTLSIIWQC---LTTWSHNVVGMMFGRFLSGFFGSAFLSIAGGSIS 190

Query: 173 NIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLS 232
           +I+   T    M  SL       G  +G + SG +    E + W F    I + + + L 
Sbjct: 191 DIFDKATITIPM--SLYTLSCFYGPVLGPIVSGAL--YRENYRWVFATLLIASGVCLVLI 246

Query: 233 IWVIPNT 239
           I+ IP T
Sbjct: 247 IFTIPET 253

>YDL194W Chr4 (111580..114234) [2655 bp, 884 aa] {ON}  SNF3Plasma
           membrane low glucose sensor that regulates glucose
           transport; contains 12 predicted transmembrane segments
           and a long C-terminal tail required for induction of
           hexose transporters; also senses fructose and mannose;
           similar to Rgt2p
          Length = 884

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 53/111 (47%), Gaps = 10/111 (9%)

Query: 81  LSKNFDSSTSQQTWLMASFPLVSGSFI--LVSGKIGDIYGLKKTLLVGYVVTIIWSLICG 138
           ++ N DS T+QQ  ++ SF L  G+F   L +  I D YG K T++  +    I+S+   
Sbjct: 131 VAPNHDSFTAQQMSILVSF-LSLGTFFGALTAPFISDSYGRKPTII--FSTIFIFSIGNS 187

Query: 139 LTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLI 189
           L      +   I+ R   G+GI  I       V  +Y A  T K++  ++I
Sbjct: 188 LQVGAGGITLLIVGRVISGIGIGAI-----SAVVPLYQAEATHKSLRGAII 233

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 56/130 (43%), Gaps = 6/130 (4%)

Query: 90  SQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFF 149
           S   WL+  + L +    L+ G+ G + G K ++L+  V+  + SLI    +  +S+   
Sbjct: 110 SMTGWLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIFEVGSLI---AAAATSMTML 166

Query: 150 IISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGT 209
           I  R   G+G + I   +  ++ +  V   TR    IS++     + +  G    G   T
Sbjct: 167 IGGRVISGIGGSGI-QTLCFVITSTLVTDRTR-GTAISILSCAFAVASVAGPFLGGAFAT 224

Query: 210 LSERWAWTFY 219
               W W FY
Sbjct: 225 -HVTWRWCFY 233

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 61/148 (41%), Gaps = 5/148 (3%)

Query: 12  SQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGT 71
            + +EL  +++ A  +H D            D    S P +  L + +  +   L+    
Sbjct: 54  EEREELYREASIASNQHHDYGSVANSIILDNDKNNLS-PTRLRLAMSSMYLGIFLSALDN 112

Query: 72  TQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTI 131
           T   +L+  +   F+    + +W+  ++ L S +F  + GKI DI+G K  L    V   
Sbjct: 113 TIVSTLLARIGSEFNE-LPRISWIATAYLLSSATFQPLYGKISDIFGRKIVLTFCNVNFF 171

Query: 132 IWSLICGLTSYTSSVEFFIISRAFQGLG 159
           I  LICG      S    +I R   G+G
Sbjct: 172 IGCLICGT---AKSFWVLVIGRFISGVG 196

>KAFR0G01110 Chr7 (252842..253486) [645 bp, 214 aa] {ON} Anc_7.437
           YBL102W
          Length = 214

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 4/81 (4%)

Query: 314 HNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGI----IAA 369
            + RLL+ +  +      F +  F +    +N R++  LW  GS    L +G+    +A 
Sbjct: 76  RSERLLLFICFILGSAACFTLCVFLFPVLAINPRKFALLWTMGSLLFVLAFGVMMGPVAY 135

Query: 370 ISVGYTIKRIPPSLILFLSML 390
           I    + +R+P +L  F S L
Sbjct: 136 IKHLTSKERVPFTLFFFFSCL 156

>KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {ON}
           Anc_2.241 YIL121W
          Length = 570

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 47/228 (20%), Positives = 88/228 (38%), Gaps = 13/228 (5%)

Query: 27  EHSDVQVDDKKWPSIQD---PTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSK 83
           E S+   DDK     +D   P     P  ++  +     +   +         ++ ++ K
Sbjct: 45  ESSEPFTDDKSNTEPEDVPVPYTRFGPRAKFGLVMQCAFTGFFSSIAGAIYYPVLTVIEK 104

Query: 84  NFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYT 143
            F  +  Q    +  + +  G    + G + D  G +  +L  + V I +    GL + +
Sbjct: 105 KFSITEEQVNITVVVYFIFQGLSPSLMGGLADSLGRRPVVL--WSVVIYFGACIGL-ALS 161

Query: 144 SSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLF 203
            +    II R  Q  GI+ ++    GI+G+  V     +   +  +     +G+ +G L 
Sbjct: 162 QNYTQIIILRCLQAAGISPVIAINSGIMGD--VTTKAERGGYVGYVAGFQILGSALGALI 219

Query: 204 SGLIGTLSERWAWT--FYAYTITAAINMGLSIWVIPNTIPTNVRGSSM 249
                 LS RW W   F+   I +     +S +V+P T  T V   S+
Sbjct: 220 G---AALSSRWDWRAIFWFLAIGSGACALVSFFVLPETKRTVVGNGSI 264

>KLTH0D06710g Chr4 complement(582430..584265) [1836 bp, 611 aa] {ON}
           weakly similar to uniprot|P53389 Saccharomyces
           cerevisiae YNR055C HOL1 Putative ion transporter similar
           to the major facilitator superfamily of transporters;
           mutations in membrane-spanning domains permit
           nonselective cation uptake
          Length = 611

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 85/217 (39%), Gaps = 24/217 (11%)

Query: 27  EHSDVQVDDKKWPS-IQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNF 85
           + S  + D   WP   +D   F   W  + F+     S L   A  ++ L+L       F
Sbjct: 65  QPSKSKRDPLNWPVWRRDTALFVVGW--HCFVGGGQTSIL---AAGSKGLAL------EF 113

Query: 86  DSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSS 145
             S S  ++L+    L      +++     I+G +   LVG ++    S+ C +   + +
Sbjct: 114 HRSLSDISYLVGGMMLALALGSIIASPCAVIFGKRIVYLVGIIIFFFGSIGCAV---SQN 170

Query: 146 VEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNM---VISLIGACAPIGATMGVL 202
            E  + SR   GLG++ I       V  IY A      +    + L+G     G  +  L
Sbjct: 171 YESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTLLLLG-----GKNLVPL 225

Query: 203 FSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNT 239
            +  +    +R  W F+  TI   +N  L +  +P T
Sbjct: 226 LASFVFEYLDR-HWLFWIVTIIVGVNFMLHVLFVPET 261

>Ecym_6024 Chr6 (43495..44964) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii AAR192C
          Length = 489

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 40/83 (48%), Gaps = 3/83 (3%)

Query: 78  INILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLIC 137
           +  LS +F+  T+  TW +    +      ++ G +GD YG K + LV   + +   +I 
Sbjct: 68  VKKLSGDFNVKTASITWGITLALMTRTIGAVIFGYVGDRYGQKTSFLVNLSIMMALQIII 127

Query: 138 GLTSYTSSVEFFIISRAFQGLGI 160
           G   + +S  +F+  RA  G+ +
Sbjct: 128 G---FATSFRYFLACRALFGIAL 147

>ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {ON}
           weakly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028W TPO1 Proton- motive-force-dependent
           multidrug transporter of the major facilitator
           superfamily able to transport eight different compounds
           including polyamines quinidine cycloheximide and
           nystatin involved in excess spermidine detoxification
          Length = 558

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 74/189 (39%), Gaps = 10/189 (5%)

Query: 51  WKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVS 110
           W     IF   +S   N +     LSLI   SK F  S+         F +  G    + 
Sbjct: 80  WSIVTVIFVCQLSMNFNGSVYPHALSLI---SKEFHVSSQAANTSQMIFKVAYGFGCELW 136

Query: 111 GKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGI 170
               + YG +  + +    T IW ++ G      ++   I++R   G+  A      +G+
Sbjct: 137 APWSEEYGRRNIMQLSLFFTNIWQILGGKAPNFGTI---IVARFLGGISQAG-GSVTLGV 192

Query: 171 VGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMG 230
           V +++          ++ +   + +GA +G +F GL+      W W F+   I   +   
Sbjct: 193 VADMWQP--QDHGYAVAYVVLASVLGAVIGPVFGGLMEE-HLSWHWNFWIQLIFGGVTQL 249

Query: 231 LSIWVIPNT 239
           L  +++P T
Sbjct: 250 LHFFLVPET 258

>Kpol_534.27 s534 (61814..63322) [1509 bp, 502 aa] {ON}
           (61814..63322) [1509 nt, 503 aa]
          Length = 502

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 85/388 (21%), Positives = 141/388 (36%), Gaps = 47/388 (12%)

Query: 110 SGKIGDIYGLKKTLLVGYVVTIIWSLIC-GLTSYTSSVEFFIISRAFQGLGIAFILPNIM 168
           +  I   YG KKT  +  ++  I S I     SYTS     II R   GLG    + N  
Sbjct: 112 ASSISKSYGRKKTAFIANIINAIGSYILFASNSYTS----LIIGRLIVGLGSGIFIVN-- 165

Query: 169 GIVGNIYVAGTTRKNMVISLIGACAPIGATMGVL---FSGLIGTLSERWAWTFYAYTITA 225
                ++++  T  ++   L+G+   +   +G++   F  L    + +W W  +   I +
Sbjct: 166 ---APLFISEVTPLSLK-GLMGSMNQVSINLGIILTQFCALFFANAYQWRWILFVAFIVS 221

Query: 226 AINMGLSI-------WVIPNTIPTNVRGS--SMDWXXXXXXXXXXXXFNFVWNQGPIVGW 276
             NM L +       W++ N   TN   S  S+                 + N+  I G+
Sbjct: 222 ICNMVLLVYIRESPKWLVQNHDLTNAELSLFSLRLRSDIVKDELSEIQKDLNNEQLIDGY 281

Query: 277 DTXXXXXXXXXXXXXXXXFFLYETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWT 336
           DT                  L+E  Y       +P   N   ++ +   F G  S     
Sbjct: 282 DTLEANSSNMTNSSPS----LWE--YVTSSTFKKP--RNAITMILMGQQFCGINSI---I 330

Query: 337 FYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGC 396
           FY    + NL   TP WA    F   I  +I  +   + I +     +L +S        
Sbjct: 331 FYGVKVISNL---TPNWALQINFAISILNVIMTVVSSFVIDKKGRKPLLLISTSILSISA 387

Query: 397 IMLSVTPVDQTYFRMILGMMI-ILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTMIN 455
            ++SV+        +++ + + I +F   L  P   +I+S EL   N  +      T+ N
Sbjct: 388 FLISVSITQDIVSLLVISLFVYIAAFAFGLG-PIPFLIIS-ELSSPNDSVIAQSYGTICN 445

Query: 456 YSMSMCLGIAGTVEHQINKNGDDLLKGY 483
           +  +  +     V H       DLL GY
Sbjct: 446 WLATFVVAYCFPVLH-------DLLGGY 466

>Suva_14.4 Chr14 (4495..6051) [1557 bp, 518 aa] {ON} YCR098C (REAL)
          Length = 518

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 34/162 (20%), Positives = 64/162 (39%), Gaps = 18/162 (11%)

Query: 13  QSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTT 72
             KEL   + +   E+      D +  + +        WK  + I AS  + L++     
Sbjct: 10  NEKELNENTNSRLIEY------DAEARATRSDASEKEKWKNIVTIIASGFA-LISDGYVN 62

Query: 73  QTLSLINIL------SKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVG 126
            ++S++N L       KN+ S  S +    +   ++ G F +  G   D Y  K  +LV 
Sbjct: 63  GSMSMLNKLFVMEYGKKNYSSKVSTRVSNASLVGIIFGQFFM--GIAADYYSRKSCILVA 120

Query: 127 YVVTIIWSLICGLTSYTSSVEFF---IISRAFQGLGIAFILP 165
             + ++ S +C  +  T+    F    + R   G+G+    P
Sbjct: 121 TSILVLGSALCAASHGTTVPGMFWMLTVMRGLVGIGVGAEYP 162

 Score = 30.8 bits (68), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 30/142 (21%), Positives = 65/142 (45%), Gaps = 6/142 (4%)

Query: 113 IGDIYGLKKTLLVGYVVTIIWSLI--CGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGI 170
           + D  G K TL++G+   I++ LI  C     +     FII  AF  +       +++G+
Sbjct: 328 LSDRIGRKYTLIIGFSGYIVFGLIIGCAYDQLSKITPLFIIFYAFMNMLGNAGPGDMLGV 387

Query: 171 VGNIYVAGTTRKNMVISLIGACAPIGATMGV-LFSGLIGTLSERWAWTFYAYTITAAINM 229
           + +   A T  + +   +      IG+ +GV  F  +   L  R  WTF    I   + +
Sbjct: 388 ISSESSA-TAVRGVFYGISAVTGKIGSVVGVECFQPIRDNLGAR--WTFIIAAICGLVGV 444

Query: 230 GLSIWVIPNTIPTNVRGSSMDW 251
            ++++ +P+++  ++    +++
Sbjct: 445 LITVFFVPHSLENDLMKEDVEF 466

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 82/405 (20%), Positives = 146/405 (36%), Gaps = 44/405 (10%)

Query: 13  QSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASM-MSQLLNQAGT 71
           Q +  G+ + ++ +  ++ +       +      F  P    L I  SM +   L     
Sbjct: 44  QGRAYGSTTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDG 103

Query: 72  TQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTI 131
           T   +L+  +   F+S   + +W+  S+ L S +   + GK+ D  G K  L+    V  
Sbjct: 104 TIVSTLLTHIGSEFNS-LDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFA 162

Query: 132 IWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGA 191
           I  LICGL   ++S+   +  R   G+G   +      I+ ++      R   V    G 
Sbjct: 163 IGCLICGL---SNSIWAVVAGRFISGIGGCGLTSLATMIMSDLV---PLRDRAVYQ--GL 214

Query: 192 CAPIGATMGVLFSGLIGTLSERWAWTF---YAYTITAAINMGLSIWVIPNTIPTN----- 243
           C  +   +G    GL+G     W   F      ++ + I + + + + P    +N     
Sbjct: 215 CNFVFG-LGTASGGLVGAYFRDWRLAFILQCPISVLSGILIVVYLELPPRASASNKDCWS 273

Query: 244 VRGSSMDWXXXXXXXXXXXXFNFVWNQ-GPIVGWDTXXXXXXXXXXXXXXXXFFLYETKY 302
            R   +DW            F    +  G  V + +                F   E + 
Sbjct: 274 ARLRRLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRV 333

Query: 303 ANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFY---YFCFVLNLR------------ 347
           A DP++P   + +  +L + LA +F   S     FY   Y+  VL ++            
Sbjct: 334 AADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSF 393

Query: 348 ---EYTPLWAG------GSYFMFLIWGIIAAISVGYTIKRIPPSL 383
               +  L AG      G Y+ FL+   + AI+    I  I P +
Sbjct: 394 FSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQM 438

>TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 53/99 (53%), Gaps = 10/99 (10%)

Query: 104 GSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFI 163
           G F L  G++GDIYG +  L+V  V+ II S+I  + S  +  + ++I R   G+G   I
Sbjct: 132 GCFFL--GRLGDIYGRRIGLIVASVIFIIGSVI-QIASVKAWYQ-YMIGRIVAGIGCGLI 187

Query: 164 LPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVL 202
                 I+  + ++  + KNM  +++ +C  +  T+G+ 
Sbjct: 188 -----AILSPMLISEVSPKNMRGAMV-SCYQLMVTLGIF 220

>SAKL0F12848g Chr6 complement(1004963..1008310) [3348 bp, 1115 aa]
           {ON} highly similar to uniprot|P40069 Saccharomyces
           cerevisiae YER110C KAP123 Karyopherin beta mediates
           nuclear import of ribosomal proteins prior to assembly
           into ribosomes and import of histones H3 and H4
           localizes to the nuclear pore nucleus and cytoplasm
           exhibits genetic interactions with RAI1
          Length = 1115

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 62/136 (45%), Gaps = 23/136 (16%)

Query: 23  TAFTEHSDV---------------QVDDKKWPS-----IQDPTYFSAPWKE-YLFIFASM 61
           TAFTE  D+               ++D+KKWP      IQ  +   A  +E  +FI  S+
Sbjct: 91  TAFTEPKDIVRHANARVIAAIGSEELDEKKWPELVPNLIQAASGDDAKTRETAVFILYSL 150

Query: 62  MSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVS-GSFILVSGKIGDIYGLK 120
           + +  N A       L+N+ ++  + + S +T  +++  L    + I   G I   Y  K
Sbjct: 151 L-ESFNPALHIYIDELLNLFAQTMNDTASLETRSLSAQGLNHVSALIEEEGDINPQYAAK 209

Query: 121 KTLLVGYVVTIIWSLI 136
            + L+  VVT++ ++I
Sbjct: 210 FSTLIPSVVTVLDAVI 225

>Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}
           YBR293W - Hypothetical ORF [contig 381] FULL
          Length = 577

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 104/496 (20%), Positives = 192/496 (38%), Gaps = 68/496 (13%)

Query: 33  VDDKKWP----SIQDPTYFSAP-----WKEY---LFIFASMMSQL-LNQAGTTQTLSLIN 79
           +D KK P    SIQ     + P     W E    L I  ++ + + L+   +T T S+  
Sbjct: 12  IDQKKVPRSYASIQTEETTTEPLAPSSWTERNRILLIETALFTNVFLSGLDSTITASIYQ 71

Query: 80  ILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGL 139
           ++   F+      +W+  ++ +   SF  + G   D  G ++ L     +  +  L CGL
Sbjct: 72  LIGNEFED-VKVSSWITTAYLVTCTSFQPLYGSFSDTLGRRRCLFFANTIFALGCLGCGL 130

Query: 140 TSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVIS----LIGACAPI 195
              TS++   II RA  G+G   +    +  + N  +    ++ M  S    L+G  A +
Sbjct: 131 ---TSTIYSLIIMRAVTGIGGGGL--ITLSTIVNSDIIPAKKRGMYQSFQNILVGTGAVV 185

Query: 196 GATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVI------------PNT--IP 241
           GA+ G   +  +G     W W F    +   I++G ++               P +  +P
Sbjct: 186 GASCGGEIASSMG-----WRWCFL---LQVPISIGGAVMAYLFVQDQDVVDKNPRSGALP 237

Query: 242 TNV-RGSSMDWXXX------XXXXXXXXXFNFVWNQGPIVGWDTXXXXXXXXXXXXXXXX 294
           +NV +   +D+                   N    +G    W +                
Sbjct: 238 SNVSKIKKIDFLGAFLLISGLVSQLIFLTINSSAQEGKST-WLSGRSLALGLVTAVSLIL 296

Query: 295 FFLYETKYANDPLIPRPAMHN-HRLLMTLLAVFFGWGSFG-IWT--FYYFCFVLNLREYT 350
           F   E     +P+IP   +   +   + ++ V  G+ S+  I+T   Y+   V +     
Sbjct: 297 FAYVEKTTTANPIIPHDLLGQWYSTTVLIVGVLVGFVSYAYIFTLPLYFQVVVGDTAAEA 356

Query: 351 PLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFR 410
            L      F   I G+I  IS+    KR+P  LI+ +S++ F   C +L + P    +  
Sbjct: 357 GLRLTVPSFCTPIGGVIMGISMKDP-KRLPGLLIVGISLMLFGNLCFLL-IKPTTPYWLT 414

Query: 411 MILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCL-GIAGT-- 467
            +L  ++  + G  ++FP++        P   Q  A    +T+  +    C+ G+AGT  
Sbjct: 415 SLL--LVPANIGQGITFPSTLFSFLFAFPPYKQATA---TATLYLFRSVGCVWGVAGTSS 469

Query: 468 -VEHQINKNGDDLLKG 482
            ++  + K     L+G
Sbjct: 470 LIQSVVRKQATKRLQG 485

>TBLA0A01270 Chr1 complement(300796..302364) [1569 bp, 522 aa] {ON} 
          Length = 522

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 65/142 (45%), Gaps = 14/142 (9%)

Query: 29  SDVQVDDK-KWPSIQDPTYFSAPWKEYLFIFASMMS--QLLNQAGTTQTLSLINILSKNF 85
           S+++  D   + +I+ P      W   L  F  + +   LLN  G  +T    N LS   
Sbjct: 85  SNIEKQDTIDFTNIEYPEGGLRSWLVVLGCFCGLFTCLGLLNAIGIVETYIQENQLS--- 141

Query: 86  DSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSS 145
           + S+S   W+ +    V+ S  + SG   D  G K  ++VG ++      +CGL +  +S
Sbjct: 142 NESSSSIGWIFSLLLFVNFSSCIFSGTYFDRNGFKIPVIVGTILH-----VCGLVAMANS 196

Query: 146 VEF--FIISRAFQ-GLGIAFIL 164
            +   FI+S +   GLG  FI+
Sbjct: 197 TKLWQFILSLSIAVGLGNGFIM 218

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 52/221 (23%), Positives = 90/221 (40%), Gaps = 16/221 (7%)

Query: 7   NESVSSQSKELGTQSATAF---TEHSDV-----QVDDKKWPSIQDPTYFSAPWKEYLFIF 58
             +VSS +K+              HSDV     + +D +   + D T   +       I 
Sbjct: 11  TRTVSSSNKQTNADKINQHYLSISHSDVGEYREEPNDDEQGDLDDETTPLSRIPHLWLIE 70

Query: 59  ASMMSQL-LNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIY 117
           A++ + + L+   +T T S    +   F+      +W+ AS+ + S SF  + G   D+ 
Sbjct: 71  AALYTNVFLSGFDSTVTASTYQTIGNEFNH-MDLSSWITASYLITSTSFQPLYGSFSDVL 129

Query: 118 GLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVA 177
           G +K L    ++  I  L CG++     + F    RAF   GI       +  + N  + 
Sbjct: 130 GRRKCLFFASMIFSIGCLGCGISINILWLSFM---RAFT--GIGGGGLITLSTIVNSDMI 184

Query: 178 GTTRKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTF 218
            T+++ +  +       +GA  G  F G+I T S  W W F
Sbjct: 185 PTSKRGIFQAFQNLLLGLGAICGASFGGVI-TSSIGWRWCF 224

>Kpol_461.15 s461 complement(27790..29343) [1554 bp, 517 aa] {ON}
           complement(27790..29343) [1554 nt, 518 aa]
          Length = 517

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 47/226 (20%), Positives = 96/226 (42%), Gaps = 21/226 (9%)

Query: 5   RSNESVSSQSKELGT--QSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMM 62
           R    ++S  K+ G+  ++ T    ++D   D++ W    D       W+ +L +F S +
Sbjct: 63  RKAGILTSDEKDKGSIIETGTELGPNTDDSADEE-WVMEHDDNIPDGGWEAWLVVFGSFV 121

Query: 63  SQLLNQAGTTQTLSLINILSKNF---DSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGL 119
             L+   G   +L  +    K+    D   S  +W+ + F  V+    +++G   D  G 
Sbjct: 122 G-LIPVYGIFNSLGALESYIKSHQLADVELSTTSWIFSIFLAVTCFGTILTGSYFDRNGG 180

Query: 120 KKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGT 179
               ++G ++ +  S +    + T+  +F +      GLG  F++  ++G V   ++   
Sbjct: 181 FYPHIIGSILFL--SGLVATANCTTVWQFMLAFSVTCGLGSGFLITPLVGSVATWFL--- 235

Query: 180 TRKNMVISLIGACAPIGATMG-----VLFSGLIGTLSERWAWTFYA 220
            RK  + + I   A IG ++G     ++   L G +   WA   +A
Sbjct: 236 -RKRGIATCI---ATIGGSVGGVIFPIMLRKLYGEVGFEWAIRIFA 277

>TDEL0D06570 Chr4 complement(1183554..1185254) [1701 bp, 566 aa]
           {ON} 
          Length = 566

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 42/232 (18%), Positives = 92/232 (39%), Gaps = 10/232 (4%)

Query: 8   ESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLN 67
           E++ ++ K+  T S  +  +   +  + + +  +         W     IF + +S   N
Sbjct: 17  ENIQNREKQRETNSRGSSEDPRRILREYECYDKLGYSFSTRKKWTILTIIFITQLSMNFN 76

Query: 68  QAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGY 127
            +     + LI   +K F  ST         F +  G    +     + YG  + + +  
Sbjct: 77  ASAYPHAIPLI---AKEFGVSTQAANTSQMIFLVSYGFGCELWAPWSEEYGRWRVMQLSL 133

Query: 128 VVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVIS 187
           + + IW ++ GL     ++   I++R   G+ +A      +G+V +++          ++
Sbjct: 134 LFSNIWQILGGLAPNFGTI---IVARFLGGMSLAG-GSVTLGVVADMF--DPIDHGYAVA 187

Query: 188 LIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNT 239
            I   +  G+ +G +F GL+      W W F+   I   +   L  +++P T
Sbjct: 188 FIVLSSVCGSVIGPIFGGLMQE-HLSWHWNFWIQLIFNGVAQILHFFIVPET 238

>SAKL0G10758g Chr7 (913417..915018) [1602 bp, 533 aa] {ON} similar
           to uniprot|P38776 Saccharomyces cerevisiae YHR048W
           Hypothetical ORF
          Length = 533

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 64/129 (49%), Gaps = 11/129 (8%)

Query: 113 IGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVG 172
           + ++YG K T ++   ++I+W +   LT ++ ++      R   G   +  L    G++ 
Sbjct: 149 LSEMYGRKITFVMSLSMSIVWQV---LTVWSPTIVGMFFGRFLAGFFGSSFLSVAGGVIS 205

Query: 173 NIYVAGTTRKNMVISL-IGACAP-IGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMG 230
           +I+    TR+ + I + +   +P +G  +G + SG +  +S  + WTF A  I + + + 
Sbjct: 206 DIF----TRQEIGIPMTVYTTSPFLGPALGPVVSGALYGVS--YKWTFIALLIASGVCLV 259

Query: 231 LSIWVIPNT 239
           L  + +P T
Sbjct: 260 LIAFTVPET 268

>Suva_15.236 Chr15 (408206..409750) [1545 bp, 514 aa] {ON} YHR048W
           (REAL)
          Length = 514

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 48/236 (20%), Positives = 94/236 (39%), Gaps = 17/236 (7%)

Query: 5   RSNESVSSQSKELGTQS-ATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMS 63
                ++S+ K  GTQ+    F E+     D  +   +    Y S+     +  F SM+ 
Sbjct: 32  ERGSQLTSEGKPNGTQTYEVGFGENLADPEDIARHMGMARRYYISS-----VITFTSMVI 86

Query: 64  QLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTL 123
            +++   T  +  +I     + + ST   T  +  F L  G   L    + ++YG + T 
Sbjct: 87  TMVSSCWTLPSTHIIEHFHISHEVSTLGIT--LYVFGLGIGPLFL--SPLSELYGRRTTF 142

Query: 124 LVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKN 183
           +    ++++W     LT ++ ++   +  R   G   +  L    G + +I+        
Sbjct: 143 IYALTLSVVWQC---LTIWSKTITGVMFGRFLSGFFGSAFLSVAGGAIADIFDKDQIGVP 199

Query: 184 MVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNT 239
           M I    A   +G ++G +  G +    E + WTF    IT+   + + +  IP T
Sbjct: 200 MAIYTTSAF--LGPSLGPIIGGAL--YHENYKWTFITLLITSGCCLVVIMLTIPET 251

>TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.242
           YNL065W
          Length = 529

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 58/254 (22%), Positives = 103/254 (40%), Gaps = 28/254 (11%)

Query: 6   SNESVSSQSKEL-----GTQSATAFTEHSD-VQVDDKKWPSIQDPTYFSAPW------KE 53
            N+ +S +S E+     G  S    T+H D V  +DK   +    +   AP+      ++
Sbjct: 7   ENDDISIESGEVPRLIHGDDS----TKHGDMVMTNDKPIENNGTISRNEAPYTLLSYGQK 62

Query: 54  YLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKI 113
           +  +    M    +  G+      +  L K F+    +    +  + L  G     SG +
Sbjct: 63  WGMVALLTMCTFWSSLGSPIYYPALRQLEKEFNIDEDKVNVTVVVYLLFQGIAPTFSGGL 122

Query: 114 GDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGN 173
            DIYG +  +++G ++ +  S+  GL   ++S    +  R  Q   I+  +    G VG+
Sbjct: 123 ADIYGRRPVIVIGMIIYVAVSV--GLAC-SNSYGVLVFLRILQSACISPTIAISSGFVGD 179

Query: 174 IYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIG-TLSERWAWT--FYAYTITAAINMG 230
                 T K    + +GA +   A +G  F  LIG  L+  W W   F+   I   + M 
Sbjct: 180 F-----TLKFERGTFVGATSGF-ALLGQAFGSLIGAALAAAWDWRAIFWFLVIGCGVCML 233

Query: 231 LSIWVIPNTIPTNV 244
           +   ++P T  T V
Sbjct: 234 IIFTLLPETKRTLV 247

>TBLA0B04640 Chr2 complement(1082147..1083595) [1449 bp, 482 aa]
           {ON} Anc_6.155 YBR241C
          Length = 482

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 61/138 (44%), Gaps = 16/138 (11%)

Query: 88  STSQQTWLMASFPL--VSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSS 145
           S +Q  W+ + F L  + GSF   +G   D YG KK  +   VV  I SL+     Y+++
Sbjct: 72  SNTQIGWITSIFSLGGLLGSFY--AGSWADHYGRKKVSIASSVVVTIGSLVL---FYSNT 126

Query: 146 VEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSG 205
               +I R   G+     L     ++  +Y+          +L GA   +   +G+L + 
Sbjct: 127 YLQLLIGRTIVGIACGVYL-----VITPLYINEIAPAQHRGAL-GAMNQVAINLGILLTQ 180

Query: 206 LIG---TLSERWAWTFYA 220
           L+    T S RW W F+A
Sbjct: 181 LLALRYTDSFRWRWLFFA 198

>KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa]
           {ON} Anc_8.261 YLR088W
          Length = 555

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 28/130 (21%), Positives = 60/130 (46%), Gaps = 23/130 (17%)

Query: 338 YYFCFVLNLREYT-PLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGC 396
           + FCF +   +YT P+      F+ +++  I  IS G  +     ++   +   AF    
Sbjct: 400 FSFCFAITYLKYTFPVML---MFICILFSFIPLISRGLPLAETKITVAHRMKAFAFG--- 453

Query: 397 IMLSVTPVDQTYFRMILGMMIILSFGMDLS-----FPASSIILSDELPMENQGMAGSLVS 451
                      YF ++L  +++++F + L+     FP + + +S+ LP  +Q +  S++ 
Sbjct: 454 -----------YFSLVLTSLLMINFPLALTIGVLAFPMTLVKISNTLPTSSQALKNSMLL 502

Query: 452 TMINYSMSMC 461
            + N  +S+C
Sbjct: 503 LVSNPYISIC 512

>TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON}
           Anc_8.570 YBR180W
          Length = 608

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 47/253 (18%), Positives = 103/253 (40%), Gaps = 13/253 (5%)

Query: 6   SNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEY-------LFIF 58
           SN  +S++  E+  + +  F   ++ +++ +  P    P     P+ ++       +F  
Sbjct: 81  SNSKISTKI-EIENKLSNEFAYSTETEIEKQSVPEQAVPITEEIPYTKFTKAQQFVIFCI 139

Query: 59  ASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYG 118
              +  L    G     +L  IL + F  +T+     ++ F  +     LV G   D  G
Sbjct: 140 IVYIGFLGPMCGNIYIPAL-PILQEEFQVTTTTINGTVSIFMGLFAFMPLVWGMFADFGG 198

Query: 119 LKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAG 178
            K   ++   +  + +++  L S  +++    + R  Q +G +  +    G V +I    
Sbjct: 199 RKFLYIISLFIFTVANIL--LASLPANIIALYLVRVLQVVGASAAISLGTGTVADISPPK 256

Query: 179 TTRKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPN 238
              K++ + ++G    +G  +  + +GLI   S +W W F    I   + + + I ++P 
Sbjct: 257 HRGKSVALFMLGPN--MGPIIAPIIAGLILMNSNQWRWLFGFSAICTGVALMIVIVILPE 314

Query: 239 TIPTNVRGSSMDW 251
           T+   V  +   W
Sbjct: 315 TLRCIVGNNDPKW 327

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 3/66 (4%)

Query: 94  WLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISR 153
           W+  S+ L S  F  + GK+ DI+G K  L+   ++     +ICG+   ++S+   +  R
Sbjct: 436 WVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGM---SNSLNMLVWGR 492

Query: 154 AFQGLG 159
              G+G
Sbjct: 493 FVAGIG 498

>KAFR0D00790 Chr4 (168111..169796) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 43/209 (20%), Positives = 91/209 (43%), Gaps = 22/209 (10%)

Query: 7   NESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYL----------F 56
           + SVS++S++    +  +  E  D   D++    I  P    + + +++          F
Sbjct: 12  DASVSNRSQQSTVSNKVSDNEIKDESYDEQAGQEITLPKKPISAYSKFIILSLCVAFGGF 71

Query: 57  IFA---SMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKI 113
           IF      +S  + Q    Q    +N  S  +  S  ++  ++  F +      ++  K+
Sbjct: 72  IFGWDTGTISGFVAQTDFLQRFGELN-SSGEYYLSNVREGLIVGIFNIGCAFGGIILSKL 130

Query: 114 GDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGN 173
           GD+YG K  L    ++ I+  +IC + S     ++F I R   GLG+  I      ++  
Sbjct: 131 GDMYGRKIGLTCVTIIYIVGQVIC-IASVDKWYQYF-IGRIVAGLGVGGI-----AVLSP 183

Query: 174 IYVAGTTRKNMVISLIGACAPIGATMGVL 202
           + ++ T+ K++  +L+ +C  +  T G+ 
Sbjct: 184 MLISETSPKHLRGTLV-SCYQLMCTAGIF 211

>Smik_3.200 Chr3 complement(296300..297856) [1557 bp, 518 aa] {ON}
           YCR098C (REAL)
          Length = 518

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 58/140 (41%), Gaps = 12/140 (8%)

Query: 35  DKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINIL------SKNFDSS 88
           D +  + +  T     WK  + I AS  + L++      ++S++N +       +N+ S 
Sbjct: 26  DAERRAARTETSRKNKWKNIVTIIASGFA-LISDGYVNGSMSMLNKVFVMEYGKENYSSK 84

Query: 89  TSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEF 148
            S +    A   ++ G F +  G   D Y  K  +LV   + +I S +C  +  T+    
Sbjct: 85  VSTRVSNAALVGIIFGQFFM--GIAADYYSRKSCILVATTILVIGSALCAASHGTTIPGM 142

Query: 149 F---IISRAFQGLGIAFILP 165
           F    + R   G+G+    P
Sbjct: 143 FWMLTVMRGLVGIGVGAEYP 162

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 55/126 (43%), Gaps = 6/126 (4%)

Query: 94  WLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISR 153
           WL+  + L +  F+L+ G++ +I G  + L++  V+  I SLI  L++   ++    +  
Sbjct: 47  WLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIFEIGSLISALSNTMGTLIGGRVIA 106

Query: 154 AFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLSER 213
            F G GI     ++  +VG   V    R  M+ +L      I   +G    G        
Sbjct: 107 GFGGSGI----ESLAFVVGTSIVQENYRGIMITAL-AVSYVIAEGVGPFIGGAFNE-HLS 160

Query: 214 WAWTFY 219
           W W FY
Sbjct: 161 WRWCFY 166

>KLLA0F08525g Chr6 complement(793929..795410) [1482 bp, 493 aa] {ON}
           similar to uniprot|Q08777 Saccharomyces cerevisiae
           YOR306C MCH5 Protein with similarity to mammalian
           monocarboxylate permeases which are involved in
           transport of monocarboxylic acids across the plasma
           membrane mutant is not deficient in monocarboxylate
           transport
          Length = 493

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 55/135 (40%), Gaps = 15/135 (11%)

Query: 7   NESVSSQSKELGTQSATAFTEHSDVQVDDKKWPS-IQDPTYF--SAPWKEYLFIFASMMS 63
            + V   +K    ++   + E +       K PS IQD   F     +  +L IF     
Sbjct: 27  RKEVDVDNKFADLEATQTYNEQTRPVESGVKRPSFIQDDGLFYPEGGFAAWLVIFGCFCG 86

Query: 64  -----QLLNQAGTTQTLSLINILSKNFDSSTSQQT--WLMASFPLVSGSFILVSGKIGDI 116
                 +LN  G  +     N + +N  SSTS  T  W+ + F  V+ +  + SG   D 
Sbjct: 87  FIPVFGMLNTIGVME-----NFIERNQLSSTSSSTVGWIFSIFSFVNFASCIFSGTYFDR 141

Query: 117 YGLKKTLLVGYVVTI 131
            G K  L+VG V+ +
Sbjct: 142 NGAKGPLIVGSVLHV 156

>KAFR0G00160 Chr7 (51436..53346) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 83/222 (37%), Gaps = 49/222 (22%)

Query: 6   SNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEY----LFIFASM 61
           SN+S S +  E    S  +F E+    +D+        P     P  EY    L  F   
Sbjct: 98  SNDSYSLEPHE--KVSGESFNEYHSEVLDEA-------PGLPKKPITEYAGTILIFFCIA 148

Query: 62  MSQLLN--QAGTTQTLSLINILSKNFDSSTSQQTWLMASFPL------------VSGSFI 107
             + +     GT       +   +NF       T+ +++               V G F+
Sbjct: 149 FGEFIYGWDTGTISGFVAFDNFLENFGEKRKDDTYYLSNVRTGLIVAIFNIGCAVGGIFL 208

Query: 108 LVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNI 167
               KIGDIYG K  ++   V+ II  LIC +TS       + I R   GL +   +  I
Sbjct: 209 ---SKIGDIYGRKIGIIFMNVIYIIGQLIC-ITSMKHKWYQYTIGRIISGLAVGGFMTLI 264

Query: 168 MGIVGNIYVAGTTRKN---MVIS----------LIGACAPIG 196
                 I++A T  K+   + IS          L+G CA +G
Sbjct: 265 -----PIFLAETAPKHLRGLAISVGMFMCTLGILLGYCANLG 301

>Suva_4.431 Chr4 (759282..761000) [1719 bp, 572 aa] {ON} YBR180W
           (REAL)
          Length = 572

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 36/174 (20%), Positives = 71/174 (40%), Gaps = 4/174 (2%)

Query: 78  INILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLIC 137
           + +L + FD S +     +++F  V     L  G + D  G K   +V   + +  ++I 
Sbjct: 134 LPLLQREFDVSATTINSTVSAFMAVFSVGPLFWGALADFGGRKFLYMVSLSLMLAVNII- 192

Query: 138 GLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGA 197
            L +  +++    + R FQ    + ++    G V ++       K +   ++G    +G 
Sbjct: 193 -LAAVPANIAALFVLRVFQAFASSSVISLGAGTVTDVVPPKHRGKAIAYFMMGPN--MGP 249

Query: 198 TMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSMDW 251
            +  + +GLI      W W F   +I A I + L   ++P T+   V      W
Sbjct: 250 IIAPIVAGLILMKGNYWRWLFGFTSIMAGIALILVTALLPETLRCIVGNGDPKW 303

>Kpol_463.6 s463 (13470..15443) [1974 bp, 657 aa] {ON}
           (13470..15443) [1974 nt, 658 aa]
          Length = 657

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 6/50 (12%)

Query: 324 AVFFGWG-SFGIWTFYYFCFVLNLR----EYTPLWAGGSYFMFLIWGIIA 368
           AV F +  S+G +T  YFCF+  L     +YTP+   G  F F+IW + A
Sbjct: 358 AVVFKYAESWGYFTSIYFCFLCLLTIGYGDYTPVTGAGRAF-FIIWALAA 406

>TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}
          Length = 578

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 53/100 (53%), Gaps = 10/100 (10%)

Query: 104 GSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFI 163
           GSF L  G++GDIYG +  L+V  V+ I  ++I  + S  +  + ++I R   GLG   I
Sbjct: 137 GSFFL--GRLGDIYGRRIGLIVASVIFIAGTII-QIASIKAWYQ-YMIGRIVAGLGCGLI 192

Query: 164 LPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLF 203
                 I+  + ++  + KNM  +++ +C  +  T+G+  
Sbjct: 193 -----AILSPMLISEVSPKNMRGAMV-SCYQLMITLGIFL 226

>Kpol_1051.15 s1051 (29969..31474) [1506 bp, 501 aa] {ON}
           (29969..31474) [1506 nt, 502 aa]
          Length = 501

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 64/134 (47%), Gaps = 11/134 (8%)

Query: 108 LVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNI 167
           L+   + ++YG + T +    ++IIW   C LT+++ ++E  +  R   G   +  L   
Sbjct: 114 LILSPLSELYGRRLTFIFSLALSIIWQ--C-LTTWSKTIEGVMFGRFLSGFFGSSFLSVA 170

Query: 168 MGIVGNIYVAGTTRKNMVISL-IGACAP-IGATMGVLFSGLIGTLSERWAWTFYAYTITA 225
            G + +I+     +K++ I + I   +P +G ++G +  G +    + + WTF    I +
Sbjct: 171 GGSISDIF----EKKDIGIPMAIFTTSPMLGPSIGPIIGGALH--KDSYKWTFIVLLIAS 224

Query: 226 AINMGLSIWVIPNT 239
            + + L    +P T
Sbjct: 225 GVCLVLITLTVPET 238

>Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON}
           YKR105C - Hypothetical ORF [contig 245] FULL
          Length = 568

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 91/212 (42%), Gaps = 17/212 (8%)

Query: 8   ESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLN 67
           ES S++++E+ T   +   E  + +    K     +     + +   L +F + +  L+ 
Sbjct: 7   ESGSNRTREMSTGKESLCPEQEECETSKAKN---NNTRLLLSLFSLGLSMFVTALDVLI- 62

Query: 68  QAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGY 127
             GT     +I+ + K+F   T +  W++  + L +  F L+ G+I    G + +++   
Sbjct: 63  -VGT-----IIDTVCKSFGDYT-KSGWIVTGYSLPNALFSLLWGRISANLGPRISIVACI 115

Query: 128 VVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVIS 187
           V+    SLI  L     S+   I  R   G+G +  L  +  ++G   V   +R  +V+S
Sbjct: 116 VLFEAGSLISAL---ARSMNMLIAGRVVSGVGGSG-LQTLSLVIGCQLVDEKSRP-LVLS 170

Query: 188 LIGACAPIGATMGVLFSGLIGTLSERWAWTFY 219
           L+     I + +G    G   T    W W FY
Sbjct: 171 LLNCTFAIASIIGPFIGGAF-TTHVTWRWCFY 201

>ZYRO0A03564g Chr1 (283783..285837) [2055 bp, 684 aa] {ON} similar
           to YBR043C, uniprot|P38227 Saccharomyces cerevisiae
           YBR043C (QDR3)
          Length = 684

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 40/214 (18%), Positives = 91/214 (42%), Gaps = 13/214 (6%)

Query: 39  PSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMAS 98
           P  +D   +    K+++ +F    S ++    T+     I+ + +++ +++      +  
Sbjct: 109 PEFKDARDYPPHIKKFI-VFVIAFSSMMGPMATSIVYPAIDPIKEDYKTTSIMVNVSVGV 167

Query: 99  FPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGL 158
           + +  G F L    I ++ G +   ++ +++ + +++  GL+    ++  FII R   G 
Sbjct: 168 YQISLGVFPLWWSSISEMNGRRTVYVLSFLLLLAFNVGTGLSP---NINDFIILRVLSGG 224

Query: 159 GIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGTL---SERWA 215
             A +     G V ++YV      N+ I  +G        M  L S +IG        W 
Sbjct: 225 AAASVQSVGAGTVADLYVPEERGTNIGIYYMGPL------MAPLVSPIIGAALVSGFPWK 278

Query: 216 WTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSM 249
            T +   I + +N+ L +  +P T+     G+++
Sbjct: 279 STQWFMVILSGVNVILLVLFLPETLRKQDSGAAI 312

>AER339C Chr5 complement(1259842..1261563) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR273C
           (TPO4)
          Length = 573

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 48/239 (20%), Positives = 99/239 (41%), Gaps = 12/239 (5%)

Query: 4   KRSNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPT--YFSAPWKEYLFIFASM 61
           K + + +S  S     Q A+   ++++V      W    DP   +    WK++     S 
Sbjct: 22  KHTKQIMSLSSNSQSGQYASEELQNTEVDAKSLDWDDRFDPANPHNWPLWKKWSTAMVSA 81

Query: 62  MSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPL-VSGSFILVSGKIGDIYGLK 120
           +  L    G++  +  +  L K +  +   QT   A   L + G   +V   + +++G K
Sbjct: 82  LLCLAVTMGSSLYMGAVPTLVKEYGVN---QTLACAGLSLYLLGLATVVGAPLSEVFGRK 138

Query: 121 KTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTT 180
              L+   +++++SL  GL++   +V   +  R F G+  +  L    G + +I+     
Sbjct: 139 PVYLISLPISLLFSLGVGLSNGRMAV--ILPMRLFSGIFASPALSVASGTIVDIF--DVD 194

Query: 181 RKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNT 239
             ++ +SL      +G  +  +  G     +  W W  +   I+  + M + I V+P T
Sbjct: 195 EVSVAMSLFCMAPFLGPVISPIMGGYAAE-NGGWRWVVWIRLISGGVLMPMLI-VMPET 251

>NDAI0D05010 Chr4 complement(1193201..1194925) [1725 bp, 574 aa]
           {ON} 
          Length = 574

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 81/198 (40%), Gaps = 26/198 (13%)

Query: 4   KRSNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYF--SAPWKEYLFIFASM 61
           KR N    SQ  E G+ S      +   + ++K +  +  P       P  EY+ +  S+
Sbjct: 15  KRVNNDFQSQPSESGSHSIMEAPSNKGEEEENKGFNDVNIPPAEMPKKPASEYVTV--SI 72

Query: 62  MSQLLNQAGTT---QTLSLINILS-----KNFDSSTSQQTW---------LMASFPLVSG 104
           +  ++   G      T ++   +S     + F    +  T+         L+A F +   
Sbjct: 73  LCLMIAFGGYVYGWDTGTISGFVSQTDWIRRFGQQRADGTYYLSKVRTGLLLAIFNIGCA 132

Query: 105 SFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGL---GIA 161
              L   ++GDIYG +K L+   +V ++  L+  + S     ++F I R   G+   GIA
Sbjct: 133 IGGLAFSRLGDIYGRRKALVFVTIVYMV-GLVISIASIDKWYQYF-IGRIISGMGVGGIA 190

Query: 162 FILPNIMGIVGNIYVAGT 179
              P ++  V   +V GT
Sbjct: 191 VYSPLLISEVSPKHVRGT 208

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 38/183 (20%), Positives = 72/183 (39%), Gaps = 17/183 (9%)

Query: 57  IFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDI 116
           IF+  ++  L        ++L + + K F+   +   WLM  + L +   +L+ G+I  +
Sbjct: 10  IFSLSLTLFLGALDIVICITLYDTIGKVFND-YANVGWLMTGYNLPNALCMLLWGRIASL 68

Query: 117 YGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYV 176
            GLK +L+   V+    SL+  L    +S+   I  R   G G +       GI   ++ 
Sbjct: 69  VGLKNSLVASIVIFEAGSLLAAL---ATSMGMLIGGRVIAGFGGS-------GIETLVFA 118

Query: 177 AGT-----TRKNMVISLIGACAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGL 231
            GT       +  V++++G    +    G    G        W W F+       + + +
Sbjct: 119 VGTRMVDEKHRARVVTILGIAYMLAEGAGPFIGGAFAE-HVSWRWCFFINIPIGGVALAI 177

Query: 232 SIW 234
             W
Sbjct: 178 LCW 180

>TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}
          Length = 568

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 53/102 (51%), Gaps = 16/102 (15%)

Query: 104 GSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEF---FIISRAFQGLGI 160
           GSF L  G++GDIYG +  L+V   + I+ ++I       +SV+    ++I R   GLG 
Sbjct: 127 GSFFL--GRLGDIYGRRIGLIVASFIFIVGTVI-----QIASVKAWYQYMIGRIVAGLGC 179

Query: 161 AFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVL 202
             I      I+  + ++  + KNM  +++ +C  +  T+G+ 
Sbjct: 180 GLI-----AILSPMLISEVSPKNMRGAMV-SCYQLMITLGIF 215

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.139    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,492,558
Number of extensions: 1887535
Number of successful extensions: 6862
Number of sequences better than 10.0: 338
Number of HSP's gapped: 6903
Number of HSP's successfully gapped: 357
Length of query: 521
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 407
Effective length of database: 40,409,475
Effective search space: 16446656325
Effective search space used: 16446656325
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)