Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0D01364g8.844ON1082108247840.0
Kwal_27.102398.844ON91495116230.0
KLTH0C03784g8.844ON99785916290.0
TDEL0B005408.844ON111585914291e-179
ABL122C8.844ON104382513541e-169
ZYRO0G14256g8.844ON125987813581e-167
Suva_13.268.844ON112294913441e-166
Ecym_46158.844ON106777613291e-165
NCAS0B002808.844ON108190312841e-158
KAFR0A028508.844ON104266912561e-154
CAGL0B02365g8.844ON105084012101e-148
Smik_13.178.844ON113174511761e-142
KLLA0D01485g8.844ON11515569391e-108
Kpol_1068.58.844ON10322788684e-99
TBLA0B032808.844ON13622388472e-94
TPHA0I002708.844ON10392808291e-93
YML117W (NAB6)8.844ON11343848111e-90
NDAI0E002708.844ON11983468095e-90
Skud_13.248.844ON11284437995e-89
KNAG0G034408.844ON10532307692e-85
ZYRO0G08140g6.183ON6322014107e-41
AFL061C6.183ON5232014022e-40
Ecym_22336.183ON5762014033e-40
Kwal_27.111586.183ON5672013981e-39
SAKL0A05280g6.183ON5822023981e-39
KLTH0H04906g6.183ON5692023972e-39
KNAG0M004306.183ON4432013856e-39
TBLA0B052106.183ON7102023942e-38
NCAS0H010406.183ON6292013884e-38
KAFR0B066906.183ON5332013811e-37
NDAI0F022606.183ON6802013861e-37
TDEL0G016206.183ON5842013821e-37
Kpol_1002.696.183ON5902023776e-37
KLLA0E19031g6.183ON6522013797e-37
CAGL0C01419g6.183ON6392013761e-36
TPHA0J022106.183ON5932013732e-36
Smik_6.3906.183ON6252013635e-35
Suva_16.1236.183ON5962013626e-35
YPL184C (MRN1)6.183ON6122013601e-34
Skud_16.946.183ON6142013591e-34
ACR135C8.670ON37672930.022
KAFR0A038308.670ON37465910.038
ZYRO0F07238g8.670ON38968900.046
NDAI0E011908.670ON35869870.094
Smik_15.4268.670ON37172850.18
Kwal_26.87638.670ON42672820.43
YOR242C (SSP2)8.670ON37169810.55
Suva_8.2928.670ON37069810.58
KLTH0D11088g8.670ON42269800.72
Skud_15.4098.670ON37171790.92
KAFR0C034808.40ON36365752.9
KLLA0F11275g8.670ON385121727.9
TPHA0D012108.670ON36469718.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0D01364g
         (1082 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} simil...  1847   0.0  
Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117...   629   0.0  
KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} simila...   632   0.0  
TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8....   555   e-179
ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON} ...   526   e-169
ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa...   527   e-167
Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...   522   e-166
Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {...   516   e-165
NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844     499   e-158
KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {...   488   e-154
CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] ...   470   e-148
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...   457   e-142
KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} simil...   366   e-108
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...   338   4e-99
TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {...   330   2e-94
TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON...   323   1e-93
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...   317   1e-90
NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844     316   5e-90
Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W ...   312   5e-89
KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {...   300   2e-85
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...   162   7e-41
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...   159   2e-40
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...   159   3e-40
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...   157   1e-39
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...   157   1e-39
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...   157   2e-39
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...   152   6e-39
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...   156   2e-38
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...   154   4e-38
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...   151   1e-37
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183    153   1e-37
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...   151   1e-37
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...   149   6e-37
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...   150   7e-37
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...   149   1e-36
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....   148   2e-36
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...   144   5e-35
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...   144   6e-35
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...   143   1e-34
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...   142   1e-34
ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON} S...    40   0.022
KAFR0A03830 Chr1 complement(779143..780267) [1125 bp, 374 aa] {O...    40   0.038
ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {...    39   0.046
NDAI0E01190 Chr5 (237093..238169) [1077 bp, 358 aa] {ON} Anc_8.6...    38   0.094
Smik_15.426 Chr15 complement(738453..739568) [1116 bp, 371 aa] {...    37   0.18 
Kwal_26.8763 s26 complement(934672..935952) [1281 bp, 426 aa] {O...    36   0.43 
YOR242C Chr15 complement(788742..789857) [1116 bp, 371 aa] {ON} ...    36   0.55 
Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON...    36   0.58 
KLTH0D11088g Chr4 complement(906439..907707) [1269 bp, 422 aa] {...    35   0.72 
Skud_15.409 Chr15 complement(727725..728840) [1116 bp, 371 aa] {...    35   0.92 
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    33   2.9  
KLLA0F11275g Chr6 (1038770..1039927) [1158 bp, 385 aa] {ON} weak...    32   7.9  
TPHA0D01210 Chr4 complement(253331..254425) [1095 bp, 364 aa] {O...    32   8.5  

>SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} similar to
            uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
            Putative RNA-binding protein based on computational
            analysis of large-scale protein-protein interaction data
          Length = 1082

 Score = 1847 bits (4784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 925/1082 (85%), Positives = 925/1082 (85%)

Query: 1    MPNYQNKNYSSHQYATMAPPNGIQPHYPQTMAYHPMGPMNGGVQPTMQMSLPSQQGYYAG 60
            MPNYQNKNYSSHQYATMAPPNGIQPHYPQTMAYHPMGPMNGGVQPTMQMSLPSQQGYYAG
Sbjct: 1    MPNYQNKNYSSHQYATMAPPNGIQPHYPQTMAYHPMGPMNGGVQPTMQMSLPSQQGYYAG 60

Query: 61   SPMPSAPQTPFDTSYGATLLPSHLLMGSPFISTPQNAAMMHAGSRGLNSSQQQFYHYTYX 120
            SPMPSAPQTPFDTSYGATLLPSHLLMGSPFISTPQNAAMMHAGSRGLNSSQQQFYHYTY 
Sbjct: 61   SPMPSAPQTPFDTSYGATLLPSHLLMGSPFISTPQNAAMMHAGSRGLNSSQQQFYHYTYS 120

Query: 121  XXXXXXXXXXXXXXXXXXVENGHVMMTRYSYPPPPQLNAPPMTHKRKTHLRHETNSQPSS 180
                              VENGHVMMTRYSYPPPPQLNAPPMTHKRKTHLRHETNSQPSS
Sbjct: 121  NNGKNKGSSKKNNRDKKKVENGHVMMTRYSYPPPPQLNAPPMTHKRKTHLRHETNSQPSS 180

Query: 181  EPYVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVYVVPXXXXXXX 240
            EPYVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVYVVP       
Sbjct: 181  EPYVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVYVVPEEEEEEE 240

Query: 241  XXXXXXXXXXXXXXXXXXXXXQSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTLN 300
                                 QSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTLN
Sbjct: 241  EEEEEEEEEEEEEEEKGEEKKQSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTLN 300

Query: 301  FVSLTSEDIRDDVLRKGATRSIALEFKNSFTTKQLESIEILSNASNSRFVVEKIDIVNTE 360
            FVSLTSEDIRDDVLRKGATRSIALEFKNSFTTKQLESIEILSNASNSRFVVEKIDIVNTE
Sbjct: 301  FVSLTSEDIRDDVLRKGATRSIALEFKNSFTTKQLESIEILSNASNSRFVVEKIDIVNTE 360

Query: 361  SPNKNFNTHYAIIHFISISMAVEASSYLLNWDEKLGISRLFFVTDSIINKSDYFRSAPAS 420
            SPNKNFNTHYAIIHFISISMAVEASSYLLNWDEKLGISRLFFVTDSIINKSDYFRSAPAS
Sbjct: 361  SPNKNFNTHYAIIHFISISMAVEASSYLLNWDEKLGISRLFFVTDSIINKSDYFRSAPAS 420

Query: 421  QDASRSSVSIDQTLEFATKKLQGLVLKERTLSIKPKTYPQAEIEEHQHHXXXXXXXXXXX 480
            QDASRSSVSIDQTLEFATKKLQGLVLKERTLSIKPKTYPQAEIEEHQHH           
Sbjct: 421  QDASRSSVSIDQTLEFATKKLQGLVLKERTLSIKPKTYPQAEIEEHQHHLTSISISKPLL 480

Query: 481  XXXXXXXXXXXXXXXXXTSSPVTQEMYLHDTSNSTREDVMIQSSMASGTSNFVPPPPHYY 540
                             TSSPVTQEMYLHDTSNSTREDVMIQSSMASGTSNFVPPPPHYY
Sbjct: 481  SSNNNSSSVSLQGNQNLTSSPVTQEMYLHDTSNSTREDVMIQSSMASGTSNFVPPPPHYY 540

Query: 541  MDVTKPIRXXXXXXXXXXAQVASNMGGGLGNRTVYLGNINPRSKPEDICNVVRGGILQHI 600
            MDVTKPIR          AQVASNMGGGLGNRTVYLGNINPRSKPEDICNVVRGGILQHI
Sbjct: 541  MDVTKPIRQTLQQQLTTTAQVASNMGGGLGNRTVYLGNINPRSKPEDICNVVRGGILQHI 600

Query: 601  KFFEHKHVCFVTXXXXXXXXXXXXXXSIEPIVLHGNVLKVGWGHHPGDLAQSIALAVTIG 660
            KFFEHKHVCFVT              SIEPIVLHGNVLKVGWGHHPGDLAQSIALAVTIG
Sbjct: 601  KFFEHKHVCFVTFIEAAAAVQFFANASIEPIVLHGNVLKVGWGHHPGDLAQSIALAVTIG 660

Query: 661  ASRNVYVSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQINYLDDGHC 720
            ASRNVYVSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQINYLDDGHC
Sbjct: 661  ASRNVYVSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQINYLDDGHC 720

Query: 721  CWVNFMNITSAIKLVEDANGADNKKFHGSYQDRYKGLIIGYGKDRCGNVNKNLVANXXXX 780
            CWVNFMNITSAIKLVEDANGADNKKFHGSYQDRYKGLIIGYGKDRCGNVNKNLVAN    
Sbjct: 721  CWVNFMNITSAIKLVEDANGADNKKFHGSYQDRYKGLIIGYGKDRCGNVNKNLVANKKSR 780

Query: 781  XXXXXXXASYKIRMHKQNKAGGSNGQEPISSFQDNAFGICISPRGIESEEVEALPDVPQN 840
                   ASYKIRMHKQNKAGGSNGQEPISSFQDNAFGICISPRGIESEEVEALPDVPQN
Sbjct: 781  FFKKVKKASYKIRMHKQNKAGGSNGQEPISSFQDNAFGICISPRGIESEEVEALPDVPQN 840

Query: 841  IEEEKNPQXXXXXXXXXXXXXXXXXXXXFSPGLNKEGHEGDDKFDCIQQENGFDGKXXXX 900
            IEEEKNPQ                    FSPGLNKEGHEGDDKFDCIQQENGFDGK    
Sbjct: 841  IEEEKNPQNNGLLKLANGNGIGEGLGIEFSPGLNKEGHEGDDKFDCIQQENGFDGKDEDE 900

Query: 901  XXXXXXXXXXXXVSAPEQSSAEEDDDKRSVTSYTNGHPTNKFKKEKSRTKLKRRPTSGLT 960
                        VSAPEQSSAEEDDDKRSVTSYTNGHPTNKFKKEKSRTKLKRRPTSGLT
Sbjct: 901  SYSSDSSDIDIIVSAPEQSSAEEDDDKRSVTSYTNGHPTNKFKKEKSRTKLKRRPTSGLT 960

Query: 961  DLYSLNGFPSMVSSTSLDAVPPLAPSTVSRHYSVAXXXXXXXXXXXGRHDASKKRHGGGK 1020
            DLYSLNGFPSMVSSTSLDAVPPLAPSTVSRHYSVA           GRHDASKKRHGGGK
Sbjct: 961  DLYSLNGFPSMVSSTSLDAVPPLAPSTVSRHYSVASSHSNNSYHNNGRHDASKKRHGGGK 1020

Query: 1021 GNTHHGRHRKSKAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDNEDSTLYDENGGFRG 1080
            GNTHHGRHRKSKAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDNEDSTLYDENGGFRG
Sbjct: 1021 GNTHHGRHRKSKAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDNEDSTLYDENGGFRG 1080

Query: 1081 PM 1082
            PM
Sbjct: 1081 PM 1082

>Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117W -
            Hypothetical ORF [contig 38] PARTIAL
          Length = 914

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/951 (40%), Positives = 514/951 (54%), Gaps = 122/951 (12%)

Query: 156  QLNAPP-------MTHKRKTHLRHETNSQPSSEPYVINFKILPK---GD-DEYMTRSLLL 204
            QL  PP         H ++ HL  E   Q    PY + F ILP+   GD D++ TRSL  
Sbjct: 32   QLRMPPSDAIRGSRRHNKEKHLYDEGTRQI---PYKLTFNILPRNGNGDGDKFRTRSLYF 88

Query: 205  SNVNASIKLHDFITKFVKFGPIESVYVVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSI 264
            SN+N  ++LH+F+  F KF  IESVYVV                             QS+
Sbjct: 89   SNLNPDVRLHEFLATFHKFDRIESVYVV-------------------------DREQQSV 123

Query: 265  LLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTLNFVSL-------TSEDIRDDVLRKG 317
            L+SFLTK TCLDFYN +LQKLS+FK +L SK L+L+F S        T ++I+ +VLR G
Sbjct: 124  LVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSFASPQKVESGPTLQEIKFEVLRAG 183

Query: 318  ATRSIALEFKNSFT-TKQLESIEILSNASNSRFVVEKIDIVNTESPNKNFNTHYAIIHFI 376
            ATRS+ LEFK+       L+  +   N S  R+V+E I+ VNT+ P+K F ++YAI+HFI
Sbjct: 184  ATRSLGLEFKDEIDFASLLKKFDFFDN-SGPRYVIESIETVNTDKPSKYFGSNYAIVHFI 242

Query: 377  SISMAVEASSYL-LNWDEKLGISRLFFVTDSIINKSDYFRSAPASQDASRSSVSIDQTL- 434
            SI+MAVE   YL +   E  G++++ +V  +  +    F++   S+ + ++ V +  ++ 
Sbjct: 243  SIAMAVETMEYLKVQTPESFGLTKVSYVNSTFTSGKSEFQTFSNSELSDQNDVEVQDSIS 302

Query: 435  ---EFATKKLQGLVLKERTLSIKPKTYPQAEIEEHQHHXXXXXXXXXXXXXXXXXXXXXX 491
               +    +    V  E+  ++ P  Y    +EEH  H                      
Sbjct: 303  SFEDITLSEGSMSVENEKAFTVLPSQYGPPVVEEHNQHCSHITISKALSSKVSRNGSSSS 362

Query: 492  XXXXXXTSSPVTQEMYLHDTSN-STREDVMIQSSMASGTSNFVPPPPHYYMDVTKPIRXX 550
                   +SP  QE+ + ++   S+R  ++   S  S    +  P  HYYMD++KP+   
Sbjct: 363  ------IASPQPQEVLVSNSEAPSSRNSIVSLLSARSQGPTYPVPGYHYYMDMSKPLGQT 416

Query: 551  XXXXXXXXAQVASNMGGGLGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCF 610
                    AQVA+ MGGG GNRTVY+GNI+PRSK EDICNVVRGGILQ +K+ E KH+CF
Sbjct: 417  LQQQYTATAQVATAMGGGAGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICF 476

Query: 611  VTXXXXXXXXXXXXXXSIEPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLP 670
            VT              SIEPIVLHG++LKVGWGHH G+L QSI+LAVTIGASRNVYVSLP
Sbjct: 477  VTFIEAASAVQFFANSSIEPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLP 536

Query: 671  EYAFKDKFIKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITS 730
            EYAFKDKFIKDPE+Q FREK++LPSK+QL  DFS FG+IE IN+L+DGHCCW+NFMNI++
Sbjct: 537  EYAFKDKFIKDPEYQAFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISN 596

Query: 731  AIKLVEDANGADNKKFHGSYQDRYKGLIIGYGKDRCGNVNKNLVANXXXXXXXXXXXASY 790
            AIKLVEDAN ++N+ FH  +++RY+GL IGYGKDRCGNVNKNLV+N           ASY
Sbjct: 597  AIKLVEDANNSNNESFHEKFENRYRGLFIGYGKDRCGNVNKNLVSNKNSKYFKKVKKASY 656

Query: 791  KIRMHKQNKA-------GGSNGQEPISSFQDNAFGICISPRGIESEEVEALPDVPQNIEE 843
             IR+ +Q K+        G   +      Q +AFGI +  +          PD   + EE
Sbjct: 657  NIRLRRQQKSDIEAQAKSGKGDENSEKKLQVDAFGISVGSQ----------PDARYSDEE 706

Query: 844  EKNPQXXXXXXXXXXXXXXXXXXXXFSPGLNKEGHEG---DDKFDCIQQENGFDGKXXXX 900
            +K  +                     S   + EG  G          +      GK    
Sbjct: 707  QKIEE---------------NELLLLSKPNSAEGGLGISVSQDVTVTENNTACGGKNKTG 751

Query: 901  XXXXXXXXXXXXVSAP---EQSSAEEDDDKRSVTSYTNGHPTNKFKKEKSRTKLKRRPTS 957
                        VSAP     S  E     +  T+ +NG      KKE+S         S
Sbjct: 752  SVSSGSSEVDILVSAPGSANTSQLEGGGPTQRTTAASNG------KKERS---------S 796

Query: 958  GLTDLYSLNGFPSMVSSTSLDAVPPLAPSTVSRHYSVAXXXXXXXXXXXGRHDAS----K 1013
            G++ L+  +     VS  SLDAVPPLAP+ ++ HY+ A             HD++     
Sbjct: 797  GVSKLHCFSEIAPRVSKASLDAVPPLAPAALNCHYNSAPRRSARKNGHD--HDSNPVSGS 854

Query: 1014 KRHGGGK---GNTHHGRHRKSKAIPGSQVMAQYLAQLQHSTFMYAANILGV 1061
            K   G K   G +   R R ++AIPGS VMAQYLAQLQHSTFMYAA+ILGV
Sbjct: 855  KSDIGSKSTQGKSSKSRQRNAQAIPGSNVMAQYLAQLQHSTFMYAADILGV 905

>KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 997

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/859 (43%), Positives = 482/859 (56%), Gaps = 111/859 (12%)

Query: 25  PHYPQTMAYHPMGPMNGGVQPTMQMSLPSQQ----GYYAGSPMPSAPQTPFDTSYGATLL 80
           P   ++M  HP G      +    ++LP       GYY G+ +P APQTPFDTSYG +LL
Sbjct: 6   PSAHRSMGKHPKGLY---AEQRSHVALPEGSREYSGYYHGNRVPPAPQTPFDTSYGVSLL 62

Query: 81  PSHLLMGSPFISTP-QNAAMMHAGSRGLNSSQQQFYHYTYXXXXXXXXXXXXXXXXXXXV 139
           PSHLLM SPF++TP   +A  H      +S  Q  YH                       
Sbjct: 63  PSHLLMSSPFLATPGMGSASPHRAGGSRSSHAQSSYHTPNFGST---------------- 106

Query: 140 ENGHVMMTRYSYPPPPQLNAPPMTHKRK----THLRHETNSQPSSEPYVINFKILPK--- 192
                           QL  PP T KR     +  RH  NS      Y + F ILP+   
Sbjct: 107 ----------------QLRMPPPTEKRNFKHGSSYRH--NSSVQQRAYEVVFHILPRSAD 148

Query: 193 -GDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVYVVPXXXXXXXXXXXXXXXXXX 251
            G DEYMTRSLL SN+N    LHDF+TKF KF  +ESVY+V                   
Sbjct: 149 GGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVESVYLV------------------- 189

Query: 252 XXXXXXXXXXQSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTLNFVSL------- 304
                     QS+L+SFLTK TCLDFYN VLQKLS+FK +L SK LTLNF SL       
Sbjct: 190 ------DSQQQSVLVSFLTKETCLDFYNGVLQKLSEFKKELKSKELTLNFASLRDVKTGP 243

Query: 305 TSEDIRDDVLRKGATRSIALEFKNSFTTKQL-ESIEILSNASNSRFVVEKIDIVNTESPN 363
           T ++I+ +VLR GATRS+ LEF++      L +S+  + N    R+VVE I+IVN    +
Sbjct: 244 TLQEIKIEVLRAGATRSLILEFQDKVDLALLSKSLGFIVN-EGPRYVVEAIEIVNAGRSS 302

Query: 364 KNFNTHYAIIHFISISMAVEASSYLLNWDEKL-GISRLFFVTDSIINKSDYFRSAPASQ- 421
           K+F  HYAIIHFISI+MA+E   YL +   KL G+ +  +V  +  +    F++  +SQ 
Sbjct: 303 KHFGPHYAIIHFISIAMALETVEYLKSQSNKLAGLIKFRYVNTTSASGKSEFQTLSSSQL 362

Query: 422 ------DASRSSVSIDQTLEFATKKLQGLVLKERTLSIKPKTYPQAEIEEHQHHXXXXXX 475
                 + S S +S  +++     KLQ   L E+TL + P  Y +  +EE   H      
Sbjct: 363 NERALSNTSDSDISGGESVASLGSKLQQTSLGEQTLVVDPTQYGRPLVEERSEHLPHVTI 422

Query: 476 XXXXXXXXXXXXXXXXXXXXXXTSSPVTQEMYLHDTSNSTREDVMIQSSMASGTSNFVPP 535
                                 T+SP  QE+ ++D  +S+    M+    A+      PP
Sbjct: 423 SKALNSKSSLNDLTSN------TTSPQPQEVLVNDHEDSSSRGSMVSLKQANSHGPAYPP 476

Query: 536 PPHY--YMDVTKPIRXXXXXXXXXXAQVASNMGGGLGNRTVYLGNINPRSKPEDICNVVR 593
            P Y  YM+++KP+           AQVA+ MGGGLGNRTVY+GNI+PRSK EDICNVVR
Sbjct: 477 IPGYPFYMNMSKPLGQTLQQQYTTTAQVATAMGGGLGNRTVYIGNISPRSKTEDICNVVR 536

Query: 594 GGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPIVLHGNVLKVGWGHHPGDLAQSI 653
           GGILQ +K+ E KH+CFVT              +IEPIVLHGNVLKVGWGHH G+L QSI
Sbjct: 537 GGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSI 596

Query: 654 ALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQIN 713
           +LAVTIGASRNVYVSLPE+AFKDKFIKDPE+QEF+EK++LPSKEQL +DFS FG+IE +N
Sbjct: 597 SLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVN 656

Query: 714 YLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSYQDRYKGLIIGYGKDRCGNVNKNL 773
           +L+DGHCCW+NFMNI++AIKLVEDAN  +N  FH  + +RYKGL IGYGKDRCGNVNKNL
Sbjct: 657 FLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHEKFGNRYKGLFIGYGKDRCGNVNKNL 716

Query: 774 VANXXXXXXXXXXXASYKIRMHKQNKAGG-------SNGQEPISSFQDNAFGICISPRGI 826
           VAN           ASY IR+ KQ K             +E     + +AFGI +     
Sbjct: 717 VANKNSKYFKKVKKASYNIRLRKQQKGASDAPTEVKDEAKELDKPIKADAFGISVG---- 772

Query: 827 ESEEVEALPDVPQNIEEEK 845
           +++ +    D  Q +EE++
Sbjct: 773 DTQNLVRDSDEEQKLEEDE 791

 Score =  110 bits (275), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 62/115 (53%), Positives = 71/115 (61%), Gaps = 7/115 (6%)

Query: 972  VSSTSLDAVPPLAPSTVSRHYSVAXXXXXXXXXXXGRHDASKKRHGGGKGNTH----HGR 1027
            VSS SLDAVPPLAPST+SR Y+             G  + S  R+   +        H R
Sbjct: 885  VSSASLDAVPPLAPSTLSRQYTATSKHNSRRGSRFGTTEKSSPRYNDIRSQDSKKPLHPR 944

Query: 1028 HRKSKAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDNEDSTLYDENGGFRGPM 1082
             RKSKAIPGS VMAQYLAQLQHSTFMYAANILGV +G   ++  YDENG    P+
Sbjct: 945  RRKSKAIPGSDVMAQYLAQLQHSTFMYAANILGVDDG---ETVFYDENGPTTDPL 996

>TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8.844
           YML117W
          Length = 1115

 Score =  555 bits (1429), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 334/859 (38%), Positives = 462/859 (53%), Gaps = 124/859 (14%)

Query: 53  SQQGYYAGSPMPSAPQTPFDTSYGATLLPSHLLMGSPFISTPQNAAMMHAGSRGLNSSQQ 112
           SQ  YY   P+ +AP TPFDT+YG TLLPSHLLMGSPF+S+P     +         + Q
Sbjct: 43  SQPMYYPTGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPN----LFQQPHHHQHAHQ 98

Query: 113 QFYHYTYXXXXXXXXXXXXXXXXXXXVENGHVMMTRYSYPPPPQLNAPPMTH-------- 164
           +   Y++                              +YP PP LN+PP +         
Sbjct: 99  RLQQYSHNQSKSSSGRSFGKLAT--------------AYPVPPSLNSPPASRNALHNRGP 144

Query: 165 KRKTHLRHETNSQPSS---EPYVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFITKFV 221
           +R +H +   +S  S    +P+++ +++LPKG+DE+ TRSLL  NV+ SI LH F+T F 
Sbjct: 145 RRGSHYKSIQSSDASKRFKDPFILTYRVLPKGNDEFRTRSLLFENVDGSIDLHSFVTNFT 204

Query: 222 KFGPIESVYVVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSILLSFLTKNTCLDFYNNV 281
            +GP+ESVY+                               SILLSF +K  CLDFYN+V
Sbjct: 205 NYGPVESVYLFKSEGDHV-----------------------SILLSFFSKAICLDFYNSV 241

Query: 282 LQKLSDFKIDLNSKSLTLNFVSL------TSED--------------------IRDDVLR 315
           LQ+LS++K DL+SK+LTL+FVSL      TSE+                    +R DV+ 
Sbjct: 242 LQRLSEYKSDLDSKALTLSFVSLEYKVSDTSEEDIDKEDDSKPDAFNITAAGSLRYDVIN 301

Query: 316 KGATRSIALEFKNSFTTKQL--ESIEILSNASNSRFVVEKIDIVNTESPNKNFNTHYAII 373
           +GATRSI + FK   +  +L  + +E L   +N+R+V+E ID+V  + P+K+F  +YA++
Sbjct: 302 RGATRSIMITFKTPCSKDELIDKKLEFLKKENNTRYVLESIDLVTADEPSKHFPQNYAVL 361

Query: 374 HFISISMAVEASSYLLNWDEKLGISRLFFVT-------------------DSIINKSDYF 414
            F++I MAVE   Y+    +KL IS+ FF++                    S+ + S  +
Sbjct: 362 TFLNIFMAVEILDYIRLHSQKLDISKCFFISIQPQIPDGKRLSVSSASNGRSMESISGNY 421

Query: 415 RSAPAS---QDASRSSVSIDQTLEFATKKLQGLVLKERTLSIKPKTYPQAEIEEHQHHXX 471
           RS  AS    ++S S +S+DQ ++  T KLQ +  K+  L +    Y     E H  H  
Sbjct: 422 RSKNASVTSLESSGSIISLDQEIDEMTYKLQSVNSKKNILEVTTNNYKDPSFEGHTDHLT 481

Query: 472 XXXXXXXXXXXXXXXXXXXXXXXXXXTSSPVTQEMYLHDTSN--STREDV------MI-Q 522
                                        P  Q+M L +  N   + +DV      M+  
Sbjct: 482 NVTVSEAASLDSQLTMPSPQEVTVNEYVLP-NQDMPLPNDMNYAPSVQDVDAVPPSMVPM 540

Query: 523 SSMASGTSNFVPPPPHYYMD--VTKPIRXXXXXXXXXXAQVASNMGGGLGNRTVYLGNIN 580
           S+M +       PPP+   +  +TKPI           A+VAS+MGGG+GNRTVY+GNI+
Sbjct: 541 STMPNTPYGCYMPPPNVRQNGNMTKPITQSLQRQYATSAEVASSMGGGIGNRTVYIGNIH 600

Query: 581 PRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPIVLHGNVLKV 640
           PRS+ EDICNVVRGGILQ++KF   K +CFVT               I+PIVLHGN+LKV
Sbjct: 601 PRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKV 660

Query: 641 GWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLR 700
           GWGHH G L +SIALAVT+GASRNVYVSLPE+AFKDK+I DP+++E+ +K+ LP +EQLR
Sbjct: 661 GWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLR 720

Query: 701 QDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSYQDRYKGLIIG 760
            DFS++G+IEQINYL+DGHCCWVNF NI++AIKLVE+        F+     RY GL+IG
Sbjct: 721 DDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLGGRYDGLVIG 780

Query: 761 YGKDRCGNVNKNLVANXXXXXXXXXXXASYKIRMHKQNKAGGSNGQEPISSFQDN----- 815
           YGKDRCGNVNKN +A             S+ IR+ K  +    + +E +   Q+N     
Sbjct: 781 YGKDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRLSKMEEERRQH-EETLRRQQENNSEKF 839

Query: 816 ----AFGICISPRGIESEE 830
               + GI I   G E  E
Sbjct: 840 LQFGSLGITIDSNGKEDPE 858

 Score = 69.7 bits (169), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/111 (40%), Positives = 58/111 (52%), Gaps = 15/111 (13%)

Query: 978  DAVPPLAPSTVSRHYSVAXXXXXXXXXXXGRHDASKKRHGGGKGNTHHGRHRKS------ 1031
            +A PP+AP+T+SR+YS+                 S       + N      +++      
Sbjct: 1006 EANPPMAPATISRNYSLMFKQQYNHEKLRDFEGESFDDESQQESNFDFESTQQTRRRRYP 1065

Query: 1032 -----KAIPGSQVMAQYLAQLQHSTFMYAANILGVTN-GDNEDSTLYDENG 1076
                 K+IPGS VMAQYLAQLQHSTF+YAANILG +N GDN      DEN 
Sbjct: 1066 NRRHGKSIPGSDVMAQYLAQLQHSTFIYAANILGASNDGDN---NYLDENA 1113

>ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML117W
          Length = 1043

 Score =  526 bits (1354), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 334/825 (40%), Positives = 436/825 (52%), Gaps = 135/825 (16%)

Query: 37  GPMNGGVQPTMQMSLPSQQGY-YAGSPMPSAPQTPFDTSYGATLLPSHLLMGSPFISTP- 94
           GP  G  QP      P  +G   A   MP  PQTPFD +YGA+LLPSH+LMGSPF+STP 
Sbjct: 31  GPGTGPGQPAR--FFPGAEGMSLAAGSMPPVPQTPFDPTYGASLLPSHMLMGSPFLSTPL 88

Query: 95  QNAAMMHAGSRGLNSSQQQFYHYTYXXXXXXXXXXXXXXXXXXXVENGHVMMTRYS---Y 151
           +  A  H  + G +S                                 H    R S   Y
Sbjct: 89  RPQAHFHPSTPGHSSHSLH-----------------------------HAQSARSSFLYY 119

Query: 152 PPPPQLNAPPMTHKRKTHLRHETNSQPSSEPYVINFKILPKGDDEYMTRSLLLSNVNA-- 209
           P PP L   P   K+   L H       SEPY INFKILPKG DEYMTRSLLL+N+    
Sbjct: 120 PQPPMLKPIPPRRKKSVTLNH-------SEPYHINFKILPKGKDEYMTRSLLLTNLEMLR 172

Query: 210 SIKLHDFITKFVKFGPIESVYVVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSILLSFL 269
            + +H+F+  FVKFGP+ES+Y++                              SILLSFL
Sbjct: 173 DLDIHNFLNSFVKFGPVESIYLM--------------------------DDNHSILLSFL 206

Query: 270 TKNTCLDFYNNVLQKLSDFKIDLNSKSLTLNFVSLTSED----IRDDVLRKGATRSIALE 325
           TK TCLDFYNN+LQ+ S+FK  L+S  L+++FV          ++ +V+ +GATRS+ +E
Sbjct: 207 TKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFVCQDESSWFKYLQMNVVTRGATRSLTVE 266

Query: 326 FKNSFT--TKQLESIEILSNASNSRFVVEKIDIVNTESPNKNFNTHYAIIHFISISMAVE 383
           F++S     +    ++      + RFV+E+ID++N  + N++F T Y I+HFISISMA+E
Sbjct: 267 FEDSVKELNEDFVRLKFPWLFCSQRFVLERIDLINATTVNQHFGTRYMILHFISISMALE 326

Query: 384 ASSYLLNWDEK--LGISRLFFVTDSIINK-----SDYFRSAPAS---QDASRSSVSIDQT 433
              +L    +K  L ISR+ FV    +N      SD   +A A+   QD+  SSVS    
Sbjct: 327 VDDFLQQPSQKRQLNISRIQFVN---VNGHHSKLSDEEAAAAANGLQQDSRTSSVSSISL 383

Query: 434 LEFATKKLQGLV------LKERTLSIKPKTYPQAEIEEHQHHXXXXXXXXXXXXXXXXXX 487
               T  L  L       L   +L + P  YP   IE+H  H                  
Sbjct: 384 SISNTADLAALFHSLDLSLDTLSLQVVPSEYPTPLIEQHSEHLTSITISRPSKTLGPSAS 443

Query: 488 XXXXXXXXXX------TSSPVTQEMYLHDTSNSTREDVMIQSSMASGT--------SNFV 533
                            SS ++  ++++D S+S    +++ S +   T           +
Sbjct: 444 LIEMDSNATNAGNHHGVSSSLSGVLFMNDPSSSGSTPMIVPSELNLNTPVMGGPMQGQLM 503

Query: 534 PPPPH----------------YYMD--VTKPIRXXXXXXXXXXAQVASNMGGGLGNRTVY 575
           P PP                 Y+MD  V  PI           A  A+    G+ NRTVY
Sbjct: 504 PGPPQPMSLHNPSDGNGGSPSYFMDPMVGAPIGQTLQRQYLAGASQAN----GINNRTVY 559

Query: 576 LGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPIVLHG 635
           +GNI+PRSKPEDICNVVRGGILQ IK+   K +CFVT              S+EPIVLHG
Sbjct: 560 IGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPIVLHG 619

Query: 636 NVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFREKYELPS 695
           N+L+VGWG   G+L ++IALAVTIGASRNVYVSLPEY+FK+K+I +PEF+ +  KY+LP+
Sbjct: 620 NILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKYKLPT 679

Query: 696 KEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNK---KFHGSYQD 752
           +EQLRQDF+ +G++EQINYL+DGHCCWVNFMNI  AI+LVED+N    K   KFH  +  
Sbjct: 680 EEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHAQFDG 739

Query: 753 RYKGLIIGYGKDRCGNVNKNLVANXXXXXXXXXXXASYKIRMHKQ 797
           RYK LIIGYGKDRCGNVNKNL AN            SY ++  KQ
Sbjct: 740 RYKNLIIGYGKDRCGNVNKNLAANKNSRFYKKIKKQSYSMKQGKQ 784

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 56/118 (47%), Gaps = 6/118 (5%)

Query: 963  YSLNGFPSMVSSTSLDAVPPLAPSTVSRHYSVAXXXXXXXXXXXGRHDASKKRHGGGKGN 1022
            YSL       S+ SLDA PPLAPS++ +H  +A               AS+         
Sbjct: 924  YSLGSLDHTSSAGSLDAPPPLAPSSMQQH--LADRRPRHTPGRSTDSSASQYNSQTPTNA 981

Query: 1023 THHGRHRK----SKAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDNEDSTLYDENG 1076
             +  R R+    SK I G  VM+QYL QL HSTF+YA NILG T         YD NG
Sbjct: 982  NYKSRRRRQAKFSKPIAGQDVMSQYLEQLHHSTFLYATNILGATTVQEPLGGYYDSNG 1039

>ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa]
           {ON} similar to uniprot|Q03735 Saccharomyces cerevisiae
           YML117W NAB6 Putative RNA-binding protein based on
           computational analysis of large-scale protein-protein
           interaction data
          Length = 1259

 Score =  527 bits (1358), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 326/878 (37%), Positives = 455/878 (51%), Gaps = 139/878 (15%)

Query: 29  QTMAYHPMG-PMNGGVQPTMQMSLPSQQGYYA--GSPMPSAPQTPFDTSYGATLLPSHLL 85
           + MA  PM  P  G +Q       P Q  YYA  G P+ + P TPFDT+YG TLLPSHLL
Sbjct: 45  RVMANSPMAFPPVGSLQAQYA---PPQPAYYAAAGPPLMNPPPTPFDTAYGITLLPSHLL 101

Query: 86  MGSPFISTPQ--------------NAAMMHAGSRGLNSSQQQFYHYTYXXXXXXXXXXXX 131
           +GSPF+S+P                      G    N+S Q                   
Sbjct: 102 IGSPFVSSPDLFQSQQQSQHHHHHQNHQHQIGMVNSNASHQSLNQRHRRSANQRNKGSYN 161

Query: 132 XXXXXXXVENGHVMMTRYSYPPPPQLNAPPMTHKRKTHLRHETNSQPSS---EPYVINFK 188
                    NGH  ++  SYP PP L  P     R  H R   N Q      EP+V+ ++
Sbjct: 162 NNSDTNISTNGHSRLSEASYPVPPPLKNP-PVVARNRHRRRAQNEQADKMFKEPFVVTYR 220

Query: 189 ILPKGDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVYVVPXXXXXXXXXXXXXXX 248
           +LPKGDDEY TRSLL  NVN S+ L+ F++K+ ++GP+ES+Y+                 
Sbjct: 221 MLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYSRYGPVESIYMF---------------- 264

Query: 249 XXXXXXXXXXXXXQSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTLNFVSL---- 304
                         S+LLSFL++  CLD YN+VLQ+L++FK  L SKSLT++FVSL    
Sbjct: 265 -----KDRNDKTKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSFVSLKYRK 319

Query: 305 -------------------------------TSEDIRDD-------------VLRKGATR 320
                                           + +++DD             ++ +GATR
Sbjct: 320 HVDENEVDQNDNSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDIVNRGATR 379

Query: 321 SIALEFKNSFTTKQL--ESIEILSNASNSRFVVEKIDIVNTESPNKNFNTHYAIIHFISI 378
           S+ALE    +   +L  + ++ LS A+N R+V+E I ++N + P K+F  +YAI+ F++I
Sbjct: 380 SVALELDGEYDKTKLLDQELDFLSPANNQRYVLESIYLINAKEPFKHFPKNYAILTFLNI 439

Query: 379 SMAVEASSYLLNWD-EKLGISRLFFVTDS----------IINKSDYFRSAPA-------- 419
           SMAVE   Y+ N +  +    + FFV+ S          I+  S+      +        
Sbjct: 440 SMAVEVLDYVRNNETARSKFQKCFFVSVSSCPQTSSDGGIVTTSNSITPVASGGSAGIAT 499

Query: 420 --------SQDASRSS-------VSIDQTLEFATKKLQGLVLKERTLSIKPKTYPQAEIE 464
                   S++AS SS       +S+DQ ++F +  L+G      T+++    YP+    
Sbjct: 500 NGDLGGYTSKNASLSSLNSVGSYISLDQEIDFLSSSLKG----SHTITVAVDEYPKPFFA 555

Query: 465 EHQHHXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSSPVT------QEMYLHDTSNSTRED 518
           E   H                              SP+         ++   T   + + 
Sbjct: 556 EFSDHLSNASVLEASALDTQISSPHPQEVIVPSQDSPLVGGAPPLDAVHPAATPALSSQV 615

Query: 519 VMIQSSMASGTSNFVPPPPHYYMDVTKPIRXXXXXXXXXXAQVASNMGGGLGNRTVYLGN 578
           + +Q  MA  +  ++ P       + KPI           A+VA++MGGG+GNRTVY+GN
Sbjct: 616 LPLQPHMAMNSGIYMEPFGRRNKTMIKPITQSLQKQFATSAEVANSMGGGIGNRTVYIGN 675

Query: 579 INPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPIVLHGNVL 638
           I+PRSKPEDICNVVRGGILQ I+F + KH+CFVT               I+PIVLHGN+L
Sbjct: 676 IHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPIVLHGNML 735

Query: 639 KVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFREKYELPSKEQ 698
           KVGWGHH G L +S++LAVT+GASRNVYVSLP++AFKDK+I DP++Q + ++Y+LP++EQ
Sbjct: 736 KVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQ 795

Query: 699 LRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSYQDRYKGLI 758
           LR DF+ FG+IEQIN+L DGHCCWVNFMNI+SAIKLVE+    D + FH S+ +RY+GLI
Sbjct: 796 LRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDNRYRGLI 855

Query: 759 IGYGKDRCGNVNKNLVANXXXXXXXXXXXASYKIRMHK 796
           IGYGKDRCGNVNKNL++             SY IR+ +
Sbjct: 856 IGYGKDRCGNVNKNLISGKNSRFYKKVKKPSYNIRLSR 893

 Score = 72.0 bits (175), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 80/183 (43%), Gaps = 58/183 (31%)

Query: 936  GHPTNKFKKEKSRT-----KLKRRPTSGLTDLY----SLNGFPSMVSSTSLDAVPPLAPS 986
            G   N+ K EK+       KL+    +G  D+     SL    S VS+ S+   PP+APS
Sbjct: 1065 GDSNNQKKHEKNNKPFKSKKLENVSATGTGDVSNYNSSLGEGASAVSNPSISMNPPIAPS 1124

Query: 987  TVSRHYSVAXXXXXXXXXXXGRHDASKK-------------------------------- 1014
            T+SR+YS+             R D+S +                                
Sbjct: 1125 TISRNYSLMMKTQNGHPHP--RRDSSDRQNQQQQQQQQQQQQQQQQQQQQHQQQQQQQPN 1182

Query: 1015 ----RHGGGKGNTHHG-----------RHRKSKAIPGSQVMAQYLAQLQHSTFMYAANIL 1059
                 + G + ++H G           + R +KAIPGS VMAQYLAQLQHSTFMYAANIL
Sbjct: 1183 PSSSHNSGDRMSSHVGNSRGQQGKGRNKRRNAKAIPGSDVMAQYLAQLQHSTFMYAANIL 1242

Query: 1060 GVT 1062
            G T
Sbjct: 1243 GAT 1245

>Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W
           (REAL)
          Length = 1122

 Score =  522 bits (1344), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 339/949 (35%), Positives = 459/949 (48%), Gaps = 163/949 (17%)

Query: 10  SSHQYATMAPPNGIQPHYPQTMAYHPMGPMNGGVQPTMQMSLPSQQ-GYYAGSPMPSAPQ 68
           ++H Y      NG+       M YHP+  MNG  Q       PSQ   YY  SP+P+ P 
Sbjct: 11  ANHAYRKQHDHNGMNAMVGNPMLYHPVDFMNGAGQYG-----PSQHPAYYTNSPLPNVPP 65

Query: 69  TPFDTSYGATLLPSHLLMGSPFISTPQNAAMMHAG-SRGLNS-------SQQQFYHYTYX 120
           TPFDT+YGA+LLPSHLLMGSPF+S+P      + G S   N        S Q  Y+  + 
Sbjct: 66  TPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYNLGRSSKFNRKAYSRPISSQNSYNANHN 125

Query: 121 XXXXXXXXXXXXXXXXXXVENGHVMMTRYSYPPPPQLNAPPMTHK--RKTHLRHETNSQP 178
                               NG  + +R         NA  +TH   +    R+ +  + 
Sbjct: 126 NNNNNSNSNNGMMTPSSYYRNGRTLFSRKDN------NAVNVTHNIHKGYETRNSSGRRT 179

Query: 179 SS---------------EPYVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFITKFVKF 223
           SS               +P+ IN+KILP GDD Y TRSLL+ NV+ S  LH  +  FVK 
Sbjct: 180 SSRINIFDEIDPETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKS 239

Query: 224 GPIESVYVVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSILLSFLTKNTCLDFYNNVLQ 283
             +ES Y+V                              SIL+SFLT+  CL+FYNN+LQ
Sbjct: 240 NALESAYIV--------------GSKETDNLEKEETKNLSILISFLTRGDCLNFYNNILQ 285

Query: 284 KLSDFKIDLNSKSLTLNFVSLT-------------------------------SEDIRDD 312
           +LS+FK  L SKSL L FV L                                S  +  D
Sbjct: 286 RLSEFKTFLKSKSLNLKFVCLNYDSKSLPTPVEDEELSRSEEQAATDDASTMISASLHHD 345

Query: 313 VLRKGATRSIALEFKNSFTTKQL--ESIEILSNASNSRFVVEKIDIVNTESPNKNFNTHY 370
           V  K ATRSI +EFK+     +L  E ++ L  + N R+++E IDIV+T+ P+  F  +Y
Sbjct: 346 VENKDATRSIIIEFKSPLEKAELFKEKLQFLDRSKNKRYILESIDIVDTDVPSNQFPENY 405

Query: 371 AIIHFISISMAVEASSYLLNWDEKLGISRLFFVTDSII-------NKSDYFRSAPASQDA 423
            ++ F++I MA+E   YL  + +KLGIS+ F+V+ + +       + +  + S  +S   
Sbjct: 406 VVLTFLNIFMAIEVLDYLKKYSKKLGISKCFYVSLTPLMVSSARSSVASIYESKSSSHRL 465

Query: 424 SRSSV---------------------------------------SIDQTLEFATKKLQGL 444
           S  SV                                       S+++ +E  T KLQG+
Sbjct: 466 STPSVPAGNNNDINNINNNNNNGSIGSSIYGNSNISLTSLSSSVSLNEEIEVLTTKLQGI 525

Query: 445 VLKERTLSIKPKTYPQAEIEEHQHHXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSSPVTQ 504
            L    L +    YP   I EH  H                            +  P+ +
Sbjct: 526 DLDGTILEVTCHDYPTPVINEHSAHLSNIKISKTVDNSRQFTQDIP-------SPLPLNE 578

Query: 505 EMYLHDTSNSTREDVMIQSSMASGTSNFVPPPPHYYMDVTKPIRXXXXXXXXXXAQVASN 564
            M++ D++ S     ++   + +  S   P P      +  PI           A+VAS+
Sbjct: 579 HMFMTDSNQSN--GTIVSQQLITAPSPQSPNPQMNQRVLPNPITQSLEQNFNVSAKVASS 636

Query: 565 MGGGLGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXX 624
           MG  +GNRT+Y+GNINPRS+ EDICNVVRGGILQ+IK+   K +CFVT            
Sbjct: 637 MGSDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYA 696

Query: 625 XXSIEPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEF 684
              I+PIVLHGN+L+VGWGH+ G L +SI+LAVTIGASRNVYVSLPE+AFK+KFI DP++
Sbjct: 697 NSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQY 756

Query: 685 QEFREKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDAN----- 739
           ++  E   LP  EQLR+DFS +G+IEQINYL D HCCW+NFMNI+SAI LVE+ N     
Sbjct: 757 KQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTG 816

Query: 740 ----------GADNKKFHGSYQDRYKGLIIGYGKDRCGNVNKNLVANXXXXXXXXXXXAS 789
                      A  +KF G    RYKGL+I YGKDRCGN+NKNLVA             S
Sbjct: 817 HDDSGELIPKTATEEKFDG----RYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPS 872

Query: 790 YKIRMHKQNKAGGSNGQEPISSFQD----NAFGICISP-RGIESEEVEA 833
           Y IR+ K  +    N  +   SF       + GI + P +G + +E EA
Sbjct: 873 YNIRLSKLEERRRQNENDKKESFDKVLNLESLGISLDPHKGTDIDEAEA 921

 Score = 70.5 bits (171), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 61/123 (49%), Gaps = 8/123 (6%)

Query: 944  KEKSRTKLKRRPTSGLTDLYSLNGFPSMVSSTSLDAVPPLAPSTVSRHYSVAXXXXXXXX 1003
            +  S+T L  +  + + +   L G       +SL   PP APST+S ++S          
Sbjct: 1003 RSSSQTVLNSKRPAKVENEDGLVGLSQFNHRSSLKQAPPRAPSTLSHNHSKKNQMPIQDA 1062

Query: 1004 XXXGRHDASKKRHGGGKGNTHHGRHRKSKAIPGSQVMAQYLAQLQHSTFMYAANILGVTN 1063
                    +K +  G        RHR    IPGS VMAQYLAQ+QHSTFMYAANILG + 
Sbjct: 1063 GINAEVTDNKTKKRGS-----FPRHR---TIPGSDVMAQYLAQVQHSTFMYAANILGASA 1114

Query: 1064 GDN 1066
             DN
Sbjct: 1115 EDN 1117

>Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {ON}
           similar to Ashbya gossypii ABL122C
          Length = 1067

 Score =  516 bits (1329), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 316/776 (40%), Positives = 411/776 (52%), Gaps = 140/776 (18%)

Query: 63  MPSAPQTPFDTSYGATLLPSHLLMGSPFISTPQNAAMMHAGSRGLNSSQQQFYHYTYXXX 122
           MP  PQTPFD +YGA+LLPSH+LMGSPF+STP         S   +S+  + + Y     
Sbjct: 79  MPPVPQTPFDPTYGASLLPSHMLMGSPFVSTPMRPQGHFHPSASSHSNHSRSFLY----- 133

Query: 123 XXXXXXXXXXXXXXXXVENGHVMMTRYSYPPPPQLNAPPMTHKRKTHLRHETNSQPSSEP 182
                                       YP PP L   P   ++   L H       SEP
Sbjct: 134 ----------------------------YPQPPILKPIPPRRRKSFSLNH-------SEP 158

Query: 183 YVINFKILPKGDDEYMTRSLLLSNV--NASIKLHDFITKFVKFGPIESVYVVPXXXXXXX 240
           Y +NFKILPKG DEYMTRSLL SN+    +  +H+F+T F+KFGPIES+Y++        
Sbjct: 159 YQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLL-------- 210

Query: 241 XXXXXXXXXXXXXXXXXXXXXQSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTLN 300
                                 SILLSFLTK TCLDFYNN+LQ+ S+FK  L+S  L+++
Sbjct: 211 ------------------DDSHSILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVS 252

Query: 301 FVSLTSED----IRDDVLRKGATRSIALEFKNSFTTKQLESIEILSNASNS--------- 347
           FV     +    ++ +V+ +G TRS+ +EF++       +S+E+ S+  +          
Sbjct: 253 FVCQDETNWFRLLQMNVVTRGVTRSLCIEFED-------QSMELTSDLIHEKIPWLFFSH 305

Query: 348 RFVVEKIDIVNTESP-NKNFNTHYAIIHFISISMAVEASSYLLNWDEK--LGISRLFFVT 404
           RFV+E+ID+VN  +P N+NFN  Y +IHFI ISMA+E   YL    +K  LGIS++ FV 
Sbjct: 306 RFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQKKQLGISKIQFVN 365

Query: 405 ----DSIINKSDYFRSAPASQDASRSSVSIDQTLEFATKK-------LQGLVLKERTLSI 453
                S ++  D   +A   Q  SR+S     +L  +             L L   +L +
Sbjct: 366 VNGHSSDLSDEDAVAAANGLQRESRTSSVSSISLPISNSSDLVELFHSLDLALGIISLQV 425

Query: 454 KPKTYPQAEIEEHQHHXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSSPVTQEM----YLH 509
            P  YP   IE H  H                             +   +  M     L 
Sbjct: 426 IPSEYPVPLIESHDDHLHSVTISRPSKTLTSSTSLVEMDGGPNGGTPNGSNAMQGVLLLS 485

Query: 510 DTSNSTREDVMIQSSMASGTSNFVPPP------------------------PHYYMDVTK 545
           D S+      M+ + +   TS  +P P                        P Y+MD   
Sbjct: 486 DPSSDGNTPSMLPNELNINTS-LMPGPMGGQVLGTSQSLSLHNPNDNGGAGPSYFMDPMS 544

Query: 546 --PIRXXXXXXXXXXAQVASNMGGGLGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFF 603
             PI               +   GG  NRTVY+GNI+PRSKPEDICNVVRGGILQ+IK+ 
Sbjct: 545 GAPINQALQRQYL----TGTGQVGGSNNRTVYIGNIHPRSKPEDICNVVRGGILQNIKWI 600

Query: 604 EHKHVCFVTXXXXXXXXXXXXXXSIEPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASR 663
             K +CFVT              S+EPIVLHGN+L+VGWG   G+L ++IALAVTIGASR
Sbjct: 601 HSKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASR 660

Query: 664 NVYVSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWV 723
           NVYVSLPEY+FK+K+I +PEF+E+  KY+LPS+EQLRQDF+ +G++EQINYLDDGHCCWV
Sbjct: 661 NVYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWV 720

Query: 724 NFMNITSAIKLVEDANGADNK---KFHGSYQDRYKGLIIGYGKDRCGNVNKNLVAN 776
           NFMNI  AI+LVED N    +   KFH  +  RYK LIIGYGKDRCGNVNKNL AN
Sbjct: 721 NFMNIAHAIRLVEDCNSLSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLTAN 776

 Score = 55.5 bits (132), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 50/108 (46%), Gaps = 8/108 (7%)

Query: 963  YSLNGFPSMVSSTSLDAVPPLAPSTVSRHY-----SVAXXXXXXXXXXXGRHDASKKRHG 1017
            Y    F  + S+T LD++PPL PS +++H+                   G  +      G
Sbjct: 944  YLAGSFELVNSNTYLDSIPPLVPSPINQHFHDKSLCRGSAHVNDNNNALGGFNNYSYNCG 1003

Query: 1018 GGKGNTHHG---RHRKSKAIPGSQVMAQYLAQLQHSTFMYAANILGVT 1062
            G           + + SK I G  VM+QYL QL HSTF+Y+ NILG T
Sbjct: 1004 GSNNGNRTRRRRQAKFSKPIAGQDVMSQYLEQLHHSTFLYSTNILGAT 1051

>NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844
          Length = 1081

 Score =  499 bits (1284), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 321/903 (35%), Positives = 447/903 (49%), Gaps = 174/903 (19%)

Query: 32  AYHPMGPMNG------GVQPTMQMSLPSQQGYYAGSPMPSAPQTPFDTSYGATLLPSHLL 85
           +Y P+GP         G Q   Q   P+QQ YY  SP+P+ P TPFDT+YGATLLPSHLL
Sbjct: 39  SYGPLGPGTNSMLFYQGEQARSQY-FPTQQPYYQTSPLPNVPPTPFDTAYGATLLPSHLL 97

Query: 86  MGSPFISTPQNAAMMHAGSRGLNSSQQQFYHYTYXXXXXXXXXXXXXXXXXXXVENGHVM 145
           MGSPF++TP               SQ   +   Y                          
Sbjct: 98  MGSPFVATPTTG-----------HSQSAIFQQPYMMTPNRASFSQIPS------------ 134

Query: 146 MTRYSYPPPP--QLNAPPMTHKRKTHLRHETNSQPSS---EPYVINFKILPKGDDEYMTR 200
           M     PP    Q N      +R ++      + P +   +P+ +++KILP GDD Y TR
Sbjct: 135 MLNVGNPPSARRQGNQNDPNRRRSSYRSKVPETDPKTLFLQPFRMSYKILPSGDDAYRTR 194

Query: 201 SLLLSNVNASIKLHDFITKFVKFGPIESVYVVPXXXXXXXXXXXXXXXXXXXXXXXXXXX 260
           SLL  NV  SI+LH F+T+FV+F PIESVY++                            
Sbjct: 195 SLLFENVVNSIELHTFMTEFVRFSPIESVYLI---------------NHHDSDKPDDDTE 239

Query: 261 XQSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTLNFVSL---------------- 304
            +SILLSFLT+  CL FYNNVLQ+L +FK  L S++L L+FVS+                
Sbjct: 240 CRSILLSFLTREVCLTFYNNVLQRLKEFKAKLKSENLRLSFVSIKYQDENEEEETNIVDE 299

Query: 305 ----TSEDIRDDVLRKGATRSIALEFKNSFTTKQL--ESIEILSNASNSRFVVEKIDIVN 358
               T E +  ++    ATRSI ++FKN  + ++L  + ++ L+  +NSR+++E ID+VN
Sbjct: 300 PSFYTKESVYFELSNPQATRSILIQFKNPCSEQELFDKKLKFLNQENNSRYILESIDLVN 359

Query: 359 TESPNKNFNTHYAIIHFISISMAVEASSYLLNWDEKLGISRLFFVT-------------D 405
                  F  HYAI+ FI+I MA+E   YL     + GI    FV               
Sbjct: 360 VTQTENEFPKHYAILTFINILMAMEICDYLKIHGPRYGIQDCMFVQVIPKAVSCVSSKRA 419

Query: 406 SII-----NKSDYFRSAPASQDASRSS------------VSIDQTLEFATKKLQGLVLKE 448
           SII     N  +   S     D  ++S            VS ++ L+  ++KL+   ++E
Sbjct: 420 SIISKDNDNNDETLSSQQKKNDILKNSSIISLPSAENDQVSDEEKLDKLSEKLKSTNIEE 479

Query: 449 RTLSIKPKTYPQAEIEEHQHHXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSSPVTQEM-Y 507
             L +   TYP+     H  H                            +S+P  Q++ Y
Sbjct: 480 LILIVDTATYPRPSFLSHDEHLPNATLSLSS------------------SSNPFEQQLPY 521

Query: 508 LHDTSNSTREDVMIQS--------SMASGTSNFVPPPPH------------YYMD----- 542
            ++  +  R +V   S        +M +    ++ P P+            Y+++     
Sbjct: 522 SYEEDDDQRTNVRSGSLPANPQFPNMPNLPKGYISPNPNMNYNTPLMYPNGYFVNDPAFS 581

Query: 543 ----------VTKPIRXXXXXXXXXXAQVASNMGGGLGNRTVYLGNINPRSKPEDICNVV 592
                        PI           +QV +++G   GNRT+Y+GNIN RSK EDICNVV
Sbjct: 582 MNNNYNNNTNYRNPISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVV 641

Query: 593 RGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPIVLHGNVLKVGWGHHPGDLAQS 652
           RGGILQ++K+ EHKH+CF+T               I+PIVLH + LK+GWG++   L ++
Sbjct: 642 RGGILQNVKYIEHKHICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKA 701

Query: 653 IALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQI 712
           +ALAVT+GASRNVYVSLPE+AFKDKFI DPE+QE+ +KY+LP  +QLR DFS +G IEQI
Sbjct: 702 VALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQI 761

Query: 713 NYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSYQDRYKGLIIGYGKDRCGNVNKN 772
           NYL D HCCWVNF+NI++AI+LVEDA+     KF   + +RY GLII YGKDRCGNVNK+
Sbjct: 762 NYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEKFNNRYDGLIINYGKDRCGNVNKS 821

Query: 773 LVANXXXXXXXXXXXASYKI--------------RMHKQNKAGGSNGQEPISSFQDNAFG 818
           L++N            S  +              R++   K   S+GQ  +S    +AFG
Sbjct: 822 LMSNKNSRFYKKVKSISNNVKLKELEEKRKADTERLNSLRKTSSSDGQ--LSKL--DAFG 877

Query: 819 ICI 821
           I I
Sbjct: 878 IGI 880

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 3/54 (5%)

Query: 1024 HHGRHRKSKAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDNEDSTLYDENGG 1077
            H+   ++++ IPGS VMAQYLAQLQHSTFMYAANILG +    ED + YDE+  
Sbjct: 1031 HNTNDKEARVIPGSDVMAQYLAQLQHSTFMYAANILGAS---AEDGSYYDESNA 1081

>KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {ON}
           Anc_8.844 YML117W
          Length = 1042

 Score =  488 bits (1256), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 291/669 (43%), Positives = 375/669 (56%), Gaps = 108/669 (16%)

Query: 180 SEPYVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVYVVPXXXXXX 239
           +EP  I++ ILPKGDD Y TRSLL  NV+ +I LH FIT FVK   IES+Y+VP      
Sbjct: 178 TEPINISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPNKNDSN 237

Query: 240 XXXXXXXXXXXXXXXXXXXXXXQSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTL 299
                                   I+LSFL+++ CLDFYNNVLQ+L +FK  LNS+SL L
Sbjct: 238 TC---------------------DIILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNL 276

Query: 300 NFVSL----TSED-----IRDDVLRKGATRSIALEFKNS------FTTKQL-ESI--EIL 341
           NFVSL    T+ D     +  +++ + ATRS+A+E  ++         +QL E I  EIL
Sbjct: 277 NFVSLKYNKTTRDNQGPSLEFNIVTRDATRSLAIELCSNENDSLILEKEQLFEKILNEIL 336

Query: 342 SNASNSRFVVEKIDIVNTESPNKNFNTHYAIIHFISISMAVEASSYLLNWDEKLGISRLF 401
               N R+V+E ID+V+T+  NK F  +YAI+ F++I+MA+E   Y+     KL I +  
Sbjct: 337 RTDENKRYVLESIDLVSTDKSNKEFGKNYAILSFLNITMAIEIMDYIQVISSKLNIGKCS 396

Query: 402 FVT------DSIINKSDYFRSAPASQDASRSS---------------------------V 428
           FVT      ++++N S    SA   Q +  S                            V
Sbjct: 397 FVTIQPLIENNVMNNSSALSSATNIQSSVSSEGNNNQNNNGSTFFHKNSINSLLSSESSV 456

Query: 429 SIDQTLEFATKKLQGLVLKERTLSIKPKTYPQAEIEEHQHHXXXXXXXXXXXXXXXXXXX 488
           SID+ +     KL+G+ LK+ +L I P+ YP+ E      H                   
Sbjct: 457 SIDEEVISIADKLKGIKLKDISLDILPRDYPEPEFNFSTDHLPNVTISVPTQLDQI---- 512

Query: 489 XXXXXXXXXTSSPVTQEMYLHDTSNSTREDVMIQSS--MASGTSNFVP------PPPHYY 540
                      +P TQE+Y++D S S     M+ SS  M SG   F+       P   +Y
Sbjct: 513 ---------PGTPRTQEIYINDMSPSFEGIDMMNSSSTMLSGNGTFISNTPMLIPSQSFY 563

Query: 541 MD--------------VTKPIRXXXXXXXXXXAQVASNMGGGLGNRTVYLGNINPRSKPE 586
           MD                 PI           A+VAS MG   GNRT+Y+GNINPRSK E
Sbjct: 564 MDQNTQIQEAPFRSNSFIHPITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAE 623

Query: 587 DICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPIVLHGNVLKVGWGHHP 646
           DICNVVRGGILQ IKF E KH+CFVT               I+PIVLHGN LK+GWG++ 
Sbjct: 624 DICNVVRGGILQSIKFIESKHICFVTFIEAAAAVQFYANAFIDPIVLHGNTLKLGWGNYS 683

Query: 647 GDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLRQDFSNF 706
           G L +SIALAVTIGASRNVYVSLPE+AFKDK+I DPEF+E+ EK++LP  EQLR DFS++
Sbjct: 684 GPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSY 743

Query: 707 GEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSYQDRYKGLIIGYGKDRC 766
           G  EQINYL D HCCWVNFMNI+SAIKLVE+A   D  +F+  + +RY GL+I YGKDRC
Sbjct: 744 GPTEQINYLSDSHCCWVNFMNISSAIKLVEEATN-DFDRFNEKFDERYNGLVINYGKDRC 802

Query: 767 GNVNKNLVA 775
           GN+NKNL+A
Sbjct: 803 GNINKNLIA 811

 Score = 84.3 bits (207), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 56/100 (56%), Gaps = 9/100 (9%)

Query: 2   PNYQNKNYSSHQYATMAPPNGIQPHYPQTMAYHPM-------GPMNGGVQPTMQMSLPSQ 54
           P+Y  KN   H Y +  P      +Y      +P+        P      P +  S   Q
Sbjct: 4   PSYSRKNSGFHIYQSQQPAQ--DQYYSAFDTTNPLMSYPQFEQPYGATFPPPLSSSTHFQ 61

Query: 55  QGYYAGSPMPSAPQTPFDTSYGATLLPSHLLMGSPFISTP 94
           Q YY GSP+P+AP TPFDT+YGATLLPSHLLMGSPFIS+P
Sbjct: 62  QTYYKGSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSP 101

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 47/67 (70%), Gaps = 4/67 (5%)

Query: 1008 RHDASKKRHGGGKGNTHHGRHRKSKAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDNE 1067
            ++D +K R+ G + N    R R S+ IPGS VMAQYLAQLQHSTFMYAANILG + G+ E
Sbjct: 971  KNDYTKNRNDGMRNNRSRNRSRYSRTIPGSDVMAQYLAQLQHSTFMYAANILGAS-GEEE 1029

Query: 1068 DSTLYDE 1074
                YDE
Sbjct: 1030 ---YYDE 1033

>CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa]
           {ON} some similarities with uniprot|Q03735 Saccharomyces
           cerevisiae YML117w
          Length = 1050

 Score =  470 bits (1210), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 304/840 (36%), Positives = 404/840 (48%), Gaps = 159/840 (18%)

Query: 61  SPMPSAPQTPFDTSYGATLLPSHLLMGSPFISTP----QNAAMMHAGSRGLNSSQQQFYH 116
           SP  + P TPFDT+YGA+LLPSHLLMGSP IST      N A + AG    N+   QF  
Sbjct: 44  SPYQNVPPTPFDTAYGASLLPSHLLMGSPMISTTNLPRDNNADLLAGGYNRNNRSFQFRR 103

Query: 117 YTYXXXXXXXXXXXXXXXXXXXVENGHVMM----TRYSYPPPPQLNAPPMTHKR------ 166
                                   +G V+     T Y       L+  PM+ KR      
Sbjct: 104 -----------------------NSGFVLQSNGNTPYMSSKRSSLSQAPMSQKRAEKNST 140

Query: 167 --------KTHLRHETNS-----QPSSEPYVINFKILPKGDDEYMTRSLLLSNVNASIK- 212
                   K  L+H+  +     +    P  IN+++LP GDD Y TRSLL  NV  + + 
Sbjct: 141 DSSVGSHGKKKLQHKKRTPIDVTKKLISPISINYRVLPSGDDTYKTRSLLFENVQKNDEM 200

Query: 213 LHDFITKFVKFGPIESVYVVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSILLSFLTKN 272
           L  F+   + +  +ESVYV                                + LSFL++ 
Sbjct: 201 LSVFMRLIINYSQVESVYVF-------------QQTDTPSKDKESDKDTCCLQLSFLSRQ 247

Query: 273 TCLDFYNNVLQKLSDFKIDLNSKSLTLNFVS----------------------------- 303
             LDFYNN LQ+L DFK  L+S  L+++FVS                             
Sbjct: 248 AALDFYNNFLQRLPDFKKKLSSPKLSVSFVSFSYVTDEDKDKDKDKDKDINTEKRNIKRS 307

Query: 304 ---LTSEDIRDDVLRKGATRSIALEFKNSFTTKQL-ESIEILSNASNSRFVVEKIDIVNT 359
              L    + +++    ATRSIA+EF +      L E +  L +  N R+++E +DI++ 
Sbjct: 308 QELLKEPALGEEIFSHDATRSIAIEFYSQVEQDALFEKLPFLDDKDNKRYILEAVDIISA 367

Query: 360 ESPNKNFNTHYAIIHFISISMAVEASSYLLNWDEKLGISRLFFVTDSIINKSDYFRSAPA 419
           E    +F  +Y I+ FI+I MA+E   YL        ++  FFV+           + P 
Sbjct: 368 EDAADDFPANYVILTFINIKMAIEVLDYLKANLMTYSVNECFFVSLPGCKSQRESSTTPV 427

Query: 420 ----SQDASRS-----------SVSIDQTLEFATKKLQGLVLKERTLSIKPKTYPQAEIE 464
               S + S+S           +V ID+ LE  + +L  L L+E+ L I    YP+ EI 
Sbjct: 428 LGHISTEGSKSVSEVNLANGGNTVMIDRELESLSDELASLKLEEKCLKIIRSDYPKPEIR 487

Query: 465 EHQHHXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSSPVTQEMYLHDTSNSTREDVMIQSS 524
            H  H                                    MYLHD  N T    +I S 
Sbjct: 488 SHDDHIPGSTNFSMYIFDDGMNPEGNSG-------------MYLHD--NLTDHSSIIGSP 532

Query: 525 MASGTSNFVPPPPHYYM----------------------------DVTKPIRXXXXXXXX 556
                SN++ P   + M                               K I         
Sbjct: 533 F----SNYIDPSISHVMLPNNGLPVGGFDAPGKFPIEPISGPPFNHTNKVITQSIEDRLN 588

Query: 557 XXAQVASNMGGGLGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXX 616
             A++A+ MGG   NRTVY+GNINPRSK EDICNVVRGGILQ++KF E K +CFVT    
Sbjct: 589 TSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEA 648

Query: 617 XXXXXXXXXXSIEPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKD 676
                      I+PIVLHGN L+VGWG+  G L +SIALAVT+GA+RNVYVSLPEYAFKD
Sbjct: 649 SAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKD 708

Query: 677 KFIKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVE 736
           KFI DP+++E+ E+Y+LPS+EQLR+DF+ +GEIEQINYL D HCCWVNF+NI SAI+LVE
Sbjct: 709 KFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVE 768

Query: 737 DANGADNKKFHGSYQDRYKGLIIGYGKDRCGNVNKNLVANXXXXXXXXXXXASYKIRMHK 796
           D N  + ++FH  + +RY+GLII YGKDRCGN+NKNL+A             SY IR+ K
Sbjct: 769 DINHNNGEEFHKKFNNRYEGLIINYGKDRCGNINKNLIAGKGSKFYKKVKKPSYDIRIKK 828

 Score = 65.9 bits (159), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 62/131 (47%), Gaps = 16/131 (12%)

Query: 940  NKFKKEKSRTKLKRRPTSGLTDLYSLNGFPSMVSSTSLDAVPPLAPSTVSRHYSVAXXXX 999
            N   KE S +  K + T+   D +        V  T+L   PP APST++  Y       
Sbjct: 930  NSASKETSSSDRKYQTTNSRGDTF--------VPKTNLSHAPPRAPSTINMTYKKISYVP 981

Query: 1000 XXXXXXXGRHDASKKRHGGGKGNTHHG--RHRKSKAIPGSQVMAQYLAQLQHSTFMYAAN 1057
                       A K  +      TH+     + ++ IPGS VMAQYLAQLQHSTFMYAAN
Sbjct: 982  PLNGQ------APKMDYPKKYKRTHNNFPNQQPTRPIPGSDVMAQYLAQLQHSTFMYAAN 1035

Query: 1058 ILGVTNGDNED 1068
            ILG +    ED
Sbjct: 1036 ILGASVETEED 1046

>Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W
           (REAL)
          Length = 1131

 Score =  457 bits (1176), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 282/745 (37%), Positives = 382/745 (51%), Gaps = 146/745 (19%)

Query: 166 RKTHLRHETNSQPSSE-----PYVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFITKF 220
           R+T  R+      SSE     P+ IN+KILP GDD Y TRSLL+ NV+ S  LH  +  F
Sbjct: 174 RRTSTRNNIFDDISSELLLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNF 233

Query: 221 VKFGPIESVYVVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSILLSFLTKNTCLDFYNN 280
           VK   +ES Y++                              SIL+SFLT++ CL+FYNN
Sbjct: 234 VKSNTLESTYIIGNEKSDDLKDEQTSNL--------------SILISFLTRSDCLNFYNN 279

Query: 281 VLQKLSDFKIDLNSKSLTLNFVSLT------SEDIRDDVL-------------------- 314
           +LQ+LS+FK  L S+SL L FV L       S  I DD L                    
Sbjct: 280 ILQRLSEFKTFLKSESLNLKFVCLNYDFKCLSTFIEDDALTENVEQIDITNDSSMISASL 339

Query: 315 -----RKGATRSIALEFKNSFTTKQL--ESIEILSNASNSRFVVEKIDIVNTESPNKNFN 367
                 K ATRSI +EFK+   + +L  + ++ L  ++N R+++E IDIVNT+ P+  F 
Sbjct: 340 HHDLENKDATRSIIVEFKSPLKSTELFNKKLQFLDRSNNKRYILESIDIVNTDVPSNQFP 399

Query: 368 THYAIIHFISISMAVEASSYLLNWDEKLGISRLFFVT----------DSIIN-----KSD 412
            +YA++ F++I MA+E   YL  + +KLGIS+ F+V+           S+ N      S 
Sbjct: 400 ENYAVLTFLNIFMAIEVLDYLKKYSKKLGISKCFYVSLAPLVISSTRSSVANIYEIKTST 459

Query: 413 YFRSAPA--------------------------SQDASRSS---------------VSID 431
           +  S P+                          S +++R+S               VS++
Sbjct: 460 HRLSVPSVPVENNNDNNNSNNHKSNISDANTHNSNNSTRASLYGNSNVSLASLPSSVSLN 519

Query: 432 QTLEFATKKLQGLVLKERTLSIKPKTYPQAEIEEHQHHXXXXXXXXXXXXXXXXXXXXXX 491
           + ++  T KLQG+ L    L I    Y    + EH  H                      
Sbjct: 520 EEIDILTTKLQGIQLDGTDLEINYHDYQTPTVHEHSTH-------LSNVKISKTVENSRQ 572

Query: 492 XXXXXXTSSPVTQEMYLHDTSNSTREDVMIQSSMASGTSNFVPPPPHYYMDVTK-----P 546
                 +  P+ + M+++D SN +   ++ Q  MA+      P P    + + +     P
Sbjct: 573 FPHDIPSPLPLNERMFMND-SNHSNGSIVPQQLMAT------PSPVSSTIQMNQRVLPNP 625

Query: 547 IRXXXXXXXXXXAQVASNMGGGLGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHK 606
           I           A+VAS+MG  +GNRT+Y+GNINPRS+ EDICNVVRGGILQ IK+   K
Sbjct: 626 ITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEK 685

Query: 607 HVCFVTXXXXXXXXXXXXXXSIEPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVY 666
            +CFVT               I+PIVLHGN+L+VGWGH+ G L +SI+LAVTIGASRNVY
Sbjct: 686 RICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVY 745

Query: 667 VSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFM 726
           VSLPE+AFK+KFI DP++++  E   LP  EQLR+DFS +G+IEQINYL D HCCW+NFM
Sbjct: 746 VSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFM 805

Query: 727 NITSAIKLVEDANG---------------ADNKKFHGSYQDRYKGLIIGYGKDRCGNVNK 771
           NI+SAI LVE+ N                A  KKF G    RY+GL+I YGKDRCGN+NK
Sbjct: 806 NISSAISLVEEMNKESTAHNEDGEMTHKTATEKKFGG----RYEGLLINYGKDRCGNINK 861

Query: 772 NLVANXXXXXXXXXXXASYKIRMHK 796
           NLVA             SY IR+ K
Sbjct: 862 NLVAGKNSRFYKKVKRPSYNIRLSK 886

 Score = 80.9 bits (198), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 56/91 (61%), Gaps = 6/91 (6%)

Query: 5  QNKNYSSHQYATMAPPNGIQPHYPQTMAYHPMGPMNGGVQPTMQMSLPSQQ-GYYAGSPM 63
          Q K  +++ Y      NG+       + YHP+  +NG  Q       PSQ   YY+ SP+
Sbjct: 6  QRKPVANYAYRQQQDYNGMNAMVGNPIIYHPVDFINGAGQYG-----PSQHPAYYSNSPL 60

Query: 64 PSAPQTPFDTSYGATLLPSHLLMGSPFISTP 94
          P+ P TPFDT+YGA+LLPSHLLMGSPF+S+P
Sbjct: 61 PNIPPTPFDTAYGASLLPSHLLMGSPFVSSP 91

 Score = 72.4 bits (176), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/92 (46%), Positives = 53/92 (57%), Gaps = 8/92 (8%)

Query: 975  TSLDAVPPLAPSTVSRHYSVAXXXXXXXXXXXGRHDASKKRHGGGKGNTHHGRHRKSKAI 1034
            +SL   PP APST+S + S             G   +++K++ G        RHR    I
Sbjct: 1043 SSLRHAPPRAPSTLSYNRSKKNETPIRDIVPNGETTSNRKKNRGS-----FPRHR---TI 1094

Query: 1035 PGSQVMAQYLAQLQHSTFMYAANILGVTNGDN 1066
            PGS VMAQYLAQ+QHSTFMYAANILG +  DN
Sbjct: 1095 PGSDVMAQYLAQVQHSTFMYAANILGASAEDN 1126

>KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1151

 Score =  366 bits (939), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 215/556 (38%), Positives = 310/556 (55%), Gaps = 71/556 (12%)

Query: 262 QSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTLNFVSLTSED-----IRDDVLRK 316
           QS LLSF TK +CLDFYNN+LQ+ ++ K  + S  L +NFV +  ++     ++ +V+  
Sbjct: 325 QSYLLSFFTKESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQDDEEWMANLKMNVISL 384

Query: 317 GATRSIALEFKNSFTTKQ--LESIEILSNASNSRFVVEKIDIVNTESPNKNFNTHYAIIH 374
           GATRS+ +EF +   T     +++  L N+   ++VV  +D+V T+   KNF  HY ++H
Sbjct: 385 GATRSLYVEFADDSVTSDTIWDTLPFLKNSG--KYVVIDVDVVTTDERRKNFGLHYCLLH 442

Query: 375 FISISMAVEASSYLLNWDEKLGISRLFFVT--DSIINKSDYFRSAPAS--QDASRSSVSI 430
           F+S++MA+E    L   DE   +SR+ FVT  +S   +    RS+  S  Q+AS    S 
Sbjct: 443 FLSVTMALEVKELLETGDE--AVSRVSFVTPANSADKEMRRRRSSAISLKQEASPQMFST 500

Query: 431 D---------------QTLEFATKKLQGLVLKE-------RTLSIKPKTYPQAEIEEHQH 468
           D               + +  A+  +   + +E        TL +    Y +  + E  H
Sbjct: 501 DSRSRSRSSNVSLPLSEQVSTASTDISTPIYEEFDGNLTWSTLIVDVSEYKEPIVNEFDH 560

Query: 469 HXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSSPVTQEMYLHDTSNSTREDVMIQSSMASG 528
           H                             S P T  +Y+H++  +      +   +   
Sbjct: 561 HLNSWS-----------------------ISKPTT--LYMHESGTTNFSSSNLSDDIDPL 595

Query: 529 TSNFVPPPPH--------YYMDVTKPIRXXXXXXXXXXAQVASNMGGGLGNRTVYLGNIN 580
           + +   P P         Y M+   P +            + + +  G+ +RTVY+GNIN
Sbjct: 596 SISSHDPVPQQMLLNEYPYIMEPLMPPQITQTIQNQYSKSIQA-VNAGMEHRTVYIGNIN 654

Query: 581 PRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPIVLHGNVLKV 640
           PRSK EDICNVVRGGILQHIK+  HK +CFVT              ++EPI+LHGNVLKV
Sbjct: 655 PRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKV 714

Query: 641 GWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLR 700
           GWG +PG L ++IALAVT+GASRNVYVSLP+ AFKDKFI DP+F+E++ +Y++P+  QL+
Sbjct: 715 GWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLK 774

Query: 701 QDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSYQDRYKGLIIG 760
            DF  +G +EQ+N+  DGHCCW+NFMNI+SAIKLVE+ +   +  FH   + RY GLIIG
Sbjct: 775 SDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTEGRYVGLIIG 834

Query: 761 YGKDRCGNVNKNLVAN 776
           YGKDRCGN+N+NLV N
Sbjct: 835 YGKDRCGNINRNLVFN 850

 Score = 62.4 bits (150), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 48/97 (49%), Gaps = 14/97 (14%)

Query: 9   YSSHQYATMAPPNGIQPHYPQTMAY-HPMGPMNGGVQPTMQMSLPSQQGYYAGSPMPSAP 67
           Y    Y       G   H PQ + Y H  G M G +  ++  ++             S P
Sbjct: 23  YEQQVYDVAGRNGGSNHHPPQYIYYTHRGGSMPGSIPGSIPGTV-------------SIP 69

Query: 68  QTPFDTSYGATLLPSHLLMGSPFISTPQNAAMMHAGS 104
           QTPFD  YG TLLPSHLL+GSPF++TPQ    M AG+
Sbjct: 70  QTPFDPVYGITLLPSHLLVGSPFVNTPQTGGPMSAGT 106

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 34/46 (73%)

Query: 187 FKILPKGDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVYVV 232
           + ILPKG+D Y +RSLL +NVN+ + + +F+ K  K  PIES+Y++
Sbjct: 219 YSILPKGNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLI 264

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 36/56 (64%), Gaps = 6/56 (10%)

Query: 1024 HHGRHRKS--KAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDNEDSTLYDENGG 1077
            ++G  RKS  K I GS VM +YL QL H+TF+YAANILG T    +D   YDE+  
Sbjct: 1100 NNGNPRKSSMKPIAGSDVMTRYLEQLHHNTFVYAANILGAT----QDPVFYDEDNA 1151

>Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,
           1032 aa] {ON} (7832..9475,9855..9863,10320..11765) [3099
           nt, 1033 aa]
          Length = 1032

 Score =  338 bits (868), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 161/278 (57%), Positives = 199/278 (71%), Gaps = 4/278 (1%)

Query: 559 AQVASNMGGGLGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXX 618
           A++A+ MGGG GNRTVY+GNINPRSK EDICNVVRGG LQ IKFF+ K +CFVT      
Sbjct: 568 AEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAAS 627

Query: 619 XXXXXXXXSIEPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKF 678
                    I+PI+LH N L+VGWG H G L +SI+LAVT+GASRNVYVSLPEYAFKDKF
Sbjct: 628 AAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKF 687

Query: 679 IKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDA 738
           I DPE++E+  KY LP++E+LR+DFS FGE+EQ+N+L+DGHCCW+NFMNI SAIKLVE  
Sbjct: 688 INDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESV 747

Query: 739 NGAD-NKKFHGSYQDRYKGLIIGYGKDRCGNVNKNLVANXXXXXXXXXXXASYKIRMHKQ 797
           N ++  K FH  Y +RYKGLIIGYGKDRCGNVNK+L++             SY IR+ + 
Sbjct: 748 NSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNIRLQQL 807

Query: 798 NKAGGSNGQEPIS--SFQDNAFGICI-SPRGIESEEVE 832
            +      +  IS  S   N+FGI + +P   ESE+ E
Sbjct: 808 EEERKQEEKNKISNKSINLNSFGIQVETPSQNESEQEE 845

 Score =  204 bits (520), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 142/417 (34%), Positives = 194/417 (46%), Gaps = 99/417 (23%)

Query: 57  YYAGSPMPSAPQTPFDTSYGATLLPSHLLMGSPFISTPQNAAMMHAGSRGLNSSQQQFYH 116
           YY    +P+AP TPFD++YGA+LLPSHLLMGSPF+STP              S  QQF  
Sbjct: 112 YYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQ----------SYSQQF-- 159

Query: 117 YTYXXXXXXXXXXXXXXXXXXXVENGHVMMTRYS--YPPPPQLNAPPMTH---------- 164
                                    G   M R S  YP PP +N PP +           
Sbjct: 160 ------------------ARPSPSKGGNSMGRLSSAYPAPPTINLPPSSRAHASSNNNNN 201

Query: 165 ---------------KRKTHLRHE-TNS---------------QPSSEPYVINFKILPKG 193
                          +R  H  H  TN+               + S   + I++K+LPKG
Sbjct: 202 NNNSSSSNNNNNNNNRRGNHNSHRNTNNNGGRFTQKNIIKRFQENSLNRFTISYKVLPKG 261

Query: 194 DDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVYVVPXX-----XXXXXXXXXXXXX 248
           +DEY TRSLL  NV+ S+ LH FI KFV FGPIESVY++                     
Sbjct: 262 NDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYDNNKNNDDYDDDNDN 321

Query: 249 XXXXXXXXXXXXXQSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTLNFVSLTSED 308
                        QSILLSFL++  CLDFYN+VLQ+LS+FK  LNS  LTL+FV L  ++
Sbjct: 322 NNDNDDNANNHDTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDLTLSFVLLKYKN 381

Query: 309 ------------------IRDDVLRKGATRSIALEFKNSFTTKQ---LESIEILSNASNS 347
                             +  D++++GATRSIA+EF    T+K+      +  L +  N 
Sbjct: 382 QDRPDDEESDFSPALPLSLEYDIIKRGATRSIAVEFNQPITSKEGFMNSKLSFLLSPENK 441

Query: 348 RFVVEKIDIVNTESPNKNFNTHYAIIHFISISMAVEASSYLLNWDEKLGISRLFFVT 404
           R+++E +DI+N    + N   +  I+ F++ISM V+    +    +  GIS+  FVT
Sbjct: 442 RYIIESVDIINAAERDANLPKNTVILTFLNISMTVDVMDRIRLERKDSGISKCVFVT 498

 Score = 82.8 bits (203), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 51/114 (44%), Positives = 64/114 (56%), Gaps = 8/114 (7%)

Query: 967  GFPSMVSSTSLDAVPPLAPSTVSRHY---SVAXXXXXXXXXXXGRHDASKKRHGGGKGNT 1023
            G P  VS T L++ PPLAP+T+SR +   S              ++D S+        N 
Sbjct: 915  GNPPPVSKTLLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMDQNDMSENDSNTSSKNA 974

Query: 1024 HHGRHRKS--KAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDNEDSTLYDEN 1075
             H R  K   K +PGS VM+QYLAQLQHSTFMYAANILG ++ + E    YDEN
Sbjct: 975  SHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPE---FYDEN 1025

>TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {ON}
            Anc_8.844 YML117W
          Length = 1362

 Score =  330 bits (847), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 146/238 (61%), Positives = 181/238 (76%)

Query: 559  AQVASNMGGGLGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXX 618
             ++++ +GGG GNRTVY+GNINPRSKPED+CNVVRGGILQ I F   KH+CFVT      
Sbjct: 813  TELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATN 872

Query: 619  XXXXXXXXSIEPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKF 678
                     I+PIVLHGN+LKVGWG+H G L +SI+LAVTIGA+RNVYVSLPE+AFKDKF
Sbjct: 873  AAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKF 932

Query: 679  IKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDA 738
            I +P+++++ E Y+LP++ QLR+DFS +GEIEQINYL+DGHCCW+NFMNI SAI LVE+ 
Sbjct: 933  INNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEV 992

Query: 739  NGADNKKFHGSYQDRYKGLIIGYGKDRCGNVNKNLVANXXXXXXXXXXXASYKIRMHK 796
            N  D  +FH  +  RY GLIIGYGKDRCGNVNKNLVA             +Y+I++ K
Sbjct: 993  NEDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLVATKNSKFFKKVKKPAYQIKLKK 1050

 Score =  156 bits (395), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 146/506 (28%), Positives = 207/506 (40%), Gaps = 169/506 (33%)

Query: 57  YYAGSPMPSAPQTPFDTSYGATLLPSHLLMGSPFISTPQNAAMMHAGSRGLNSSQQQFYH 116
           YY  SP+PSAP TPFD SYGATLLPSHLLMGSPF+STP     +H+      S       
Sbjct: 97  YY--SPIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPN----IHSFPYSATSISSTPTR 150

Query: 117 YTYXXXXXXXXXXXXXXXXXXXVENGHVMMTRYSYPPPPQLNAPPMT------------- 163
            ++                     N +     Y  PP P L  PP+              
Sbjct: 151 KSFSRKNSNSNSISNSNSSSMSNLNLNSKYDNYPIPPVPILKNPPLNNQNIRNSRNNSNR 210

Query: 164 ----HKRKTHLRHETNSQPSSE------PYVI---------------------NFKILPK 192
               H     L  + NS   S+      P +I                     ++KILPK
Sbjct: 211 IRNNHIINRKLLKDDNSYRISQQTFKENPMIIEKPKYSSVIDINKLLEIPLVVSYKILPK 270

Query: 193 GDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVYVVPXXXXXXXXXXXXXXXXXXX 252
           G DE+ TRSLLL N+N SI     +  F+ FGPIESVY++                    
Sbjct: 271 GTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLI-------------------- 310

Query: 253 XXXXXXXXXQSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTLNFVSL-------- 304
                     SILLSF+++  CLDFYNNVLQ+L +FK +L+SKSLTL+FV L        
Sbjct: 311 -KLNPGSKYNSILLSFVSREICLDFYNNVLQRLMEFKTELSSKSLTLSFVILKYEFTDYN 369

Query: 305 -----------------------------------------TSEDIRDD----------- 312
                                                      EDIR+D           
Sbjct: 370 HPINEHASDNGDESSSSNKNLKIDTIKEEEEDEEETDGEEIVIEDIRNDLNKENFPLTFA 429

Query: 313 ------VLRKGATRSIALEFKNSFTTKQL---ESIEILSNASNSRFVVEKIDIVNT---- 359
                 ++++GATRS+ L+F    +  QL   +    ++N  N+R+++E I +VN     
Sbjct: 430 SALQSDLVKRGATRSLLLKFNGVVSKDQLINEKLNLFINNNLNNRYILESISLVNIENNT 489

Query: 360 ----------------ESPNKNFNTHYAIIHFISISMAVEASSYLLNWDEKLGISRLFFV 403
                           ++P   F  +Y ++ F +I MA+EA  Y      +L I   FFV
Sbjct: 490 KNNKNTIGDDNEDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYFKAKLNELNIFDCFFV 549

Query: 404 TDSIINKSDYFRSAPASQDASRSSVS 429
           +     K++Y +++    + S+S++S
Sbjct: 550 S-----KTNYHKNS----ENSKSTIS 566

 Score = 65.5 bits (158), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 51/103 (49%), Gaps = 14/103 (13%)

Query: 977  LDAVPPLAPSTVSRHYSVAXXXXXXXXXXXGRHDA-------------SKKRHGGGKGNT 1023
            L+  PP+A ST++R Y                 D               +K    G  N 
Sbjct: 1249 LNQYPPMASSTLTRTYRKTKLKPKNDNPKFITSDTEDEILSQLPDEVLDEKNPFRGPRNK 1308

Query: 1024 HHGRHRKSKAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDN 1066
            +  R+ + K IPGS VM+QYL QLQHSTFMYAANILGV+  DN
Sbjct: 1309 NKNRNTR-KTIPGSDVMSQYLTQLQHSTFMYAANILGVSAEDN 1350

>TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON}
           Anc_8.844 YML117W
          Length = 1039

 Score =  323 bits (829), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 152/280 (54%), Positives = 195/280 (69%), Gaps = 4/280 (1%)

Query: 559 AQVASNMGGGLGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXX 618
           A++AS MGGG+GNRT+++GNINPRSK EDICNV RGGI+Q +K+   K++CFV       
Sbjct: 607 AEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQA 666

Query: 619 XXXXXXXXSIEPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKF 678
                    I+PI+LH N LK+GWG HPG L ++I LAVT GASRNVYVSLPE+AFKDK+
Sbjct: 667 AAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKY 726

Query: 679 IKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDA 738
           I DP ++E+  KY LPS++QLR+DFS FGE+EQIN+L D HCCW+NF NI SAIKLVE  
Sbjct: 727 INDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELV 786

Query: 739 NGADNKKFHGSYQDRYKGLIIGYGKDRCGNVNKNLVANXXXXXXXXXXXASYKIRMHKQN 798
              DN  FH  Y++RYKGLIIGYGKDRCGNVNK+LV+N            SY IR+ +  
Sbjct: 787 KNEDNNNFHERYKNRYKGLIIGYGKDRCGNVNKSLVSNKNSRYFRKVKKPSYNIRLQQLE 846

Query: 799 KAGGSNGQ-EPISSFQDN--AFGICISP-RGIESEEVEAL 834
           +    N + + I + + N  + GI  SP + I+ +E  +L
Sbjct: 847 EERKRNDEIKQIDNKRINLDSLGITTSPNQNIQEDETLSL 886

 Score =  177 bits (450), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 128/411 (31%), Positives = 193/411 (46%), Gaps = 116/411 (28%)

Query: 71  FDTSYGATLLPSHLLMGSPFISTPQNAAMMHAGS--RGLNSSQQQFYHYTYXXXXXXXXX 128
           FD +YG TLLPSH+LM SPF+STP  + +    S  RG++ +++                
Sbjct: 112 FDYAYGTTLLPSHILMNSPFVSTPNKSYLSFQASPSRGISYNRR---------------- 155

Query: 129 XXXXXXXXXXVENGHVMMTRYSYPPPPQLNAPPMTHKRKTHLR----------------H 172
                       N + M+    +P PP + +P +   +    +                 
Sbjct: 156 ------------NSNQMV----FPNPPIITSPHLVGDKSERAKSDNYEKVDTLDDEKRNR 199

Query: 173 ETNSQPSSEPYVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVYVV 232
           E   + S+  Y I+++ILPKGDD Y TRSLL  N+N SI LH FI KFV +G IESVYVV
Sbjct: 200 EVFEEESAIAYKISYQILPKGDDTYHTRSLLFENINESIDLHTFIEKFVNYGLIESVYVV 259

Query: 233 PXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSILLSFLTKNTCLDFYNNVLQKLSDFKIDL 292
           P                            +SILLSF +++ CLDFYN+VLQKLS++K  L
Sbjct: 260 P-------------------SYETHQNSVKSILLSFTSRSICLDFYNSVLQKLSEYKTQL 300

Query: 293 NSKSLTLNFVSLT--------------------------SEDIRDDVLRKGATRSIALEF 326
           NS++L L+FVSL                           +  I+  V   GATRS+ +EF
Sbjct: 301 NSENLKLSFVSLCYLQNNINKGNGKISVESQKNETDFELTSLIQYQVANFGATRSLCIEF 360

Query: 327 KNSFTTKQLESIE--------ILSNASNSRFVVEKIDIVNTESPNKNFNTHYAIIHFISI 378
                 K+++ I+         LS+ +N R+++E + IVN    +  F  HY I+ F++I
Sbjct: 361 D-----KRVDKIDDFIETYLPFLSSNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNI 415

Query: 379 SMAVEASSYLLNWDEKLGISRLFFVTDSIINKSDYFRSAPASQDASRSSVS 429
           SM +E   Y+ + +    I    +V+        + R+  A  +++R S+S
Sbjct: 416 SMVIEVLHYIRSKNLSKTIKNCLYVS--------FDRTKHAVSNSNRQSLS 458

 Score = 63.5 bits (153), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 56/167 (33%), Positives = 71/167 (42%), Gaps = 40/167 (23%)

Query: 917  EQSSAEEDDDKRSVTSYTN-----GHPTNKFKKEKSRTKLKRRPTSGLTDLYSLNGFPSM 971
            + S  E D D  +  S T+       P N FK  ++R     +P     DL    G    
Sbjct: 898  KNSENESDIDDSASNSSTDVELIINSPGNGFKSHRNR-----KPKPNNLDL----GERPK 948

Query: 972  VSSTSLDAVPPLAPSTVSRHYSVAXXXXXXXXXXXGRHDASKKRHGGGKGNTHHGRHRK- 1030
            V +    A  P+AP+ +S  Y                     + H     N    R RK 
Sbjct: 949  VDAIVFKADGPMAPNKLSHDY--------------------HRTHNTRVDNPRSERTRKR 988

Query: 1031 --SKAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDNEDSTLYDEN 1075
               K IPGS VM+QYLAQ+QHSTFMYAAN+L   N   E+   YDEN
Sbjct: 989  THKKIIPGSDVMSQYLAQVQHSTFMYAANVL---NASIEEPEFYDEN 1032

>YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putative
           RNA-binding protein that associates with mRNAs encoding
           cell wall proteins in high-throughput studies; deletion
           mutants display increased sensitivity to some cell wall
           disrupting agents; expression negatively regulated by
           cAMP
          Length = 1134

 Score =  317 bits (811), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 169/384 (44%), Positives = 220/384 (57%), Gaps = 34/384 (8%)

Query: 431 DQTLEFATKKLQGLVLKERTLSIKPKTYPQAEIEEHQHHXXXXXXXXXXXXXXXXXXXXX 490
           ++ ++    KLQG+ L    L I  + Y    IEEH  H                     
Sbjct: 521 NEEIDMLATKLQGVELDGTYLEINYRDYQTPTIEEHSTHLSNVKISKTTENSRQFSQDIP 580

Query: 491 XXXXXXXTSSPVTQEMYLHDTSNSTREDVMIQSSMASGTSNFVPPPPHYYMD---VTKPI 547
                  +  P+ + M+++D SN +   ++ Q  +A+ +    P  P+  M+   +  PI
Sbjct: 581 -------SPLPLNEHMFMND-SNQSNGAIIPQQLIATPS----PVSPNLQMNQRVLPNPI 628

Query: 548 RXXXXXXXXXXAQVASNMGGGLGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKH 607
                      A+VAS+MG  +GNRT+Y+GNINPRSK EDICNVVRGGILQ IK+   K 
Sbjct: 629 TQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKK 688

Query: 608 VCFVTXXXXXXXXXXXXXXSIEPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYV 667
           +CFVT               I+PIVLHGN+L+VGWGH+ G L + I+LAVTIGASRNVYV
Sbjct: 689 ICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYV 748

Query: 668 SLPEYAFKDKFIKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMN 727
           SLPE+AFK+KFI DP++++  E   LP  EQLR+DFS +G+IEQINYL D HCCW+NFMN
Sbjct: 749 SLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMN 808

Query: 728 ITSAIKLVEDANG---------------ADNKKFHGSYQDRYKGLIIGYGKDRCGNVNKN 772
           I+SAI LVE+ N                A  +KF G    RYKGL+I YGKDRCGN+NKN
Sbjct: 809 ISSAISLVEEMNKESTVQNESGEVTLKRATEEKFGG----RYKGLLINYGKDRCGNINKN 864

Query: 773 LVANXXXXXXXXXXXASYKIRMHK 796
           L+A             SY IR+ K
Sbjct: 865 LIAGKNSRFYKKVKRPSYNIRLSK 888

 Score =  164 bits (414), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 98/281 (34%), Positives = 143/281 (50%), Gaps = 58/281 (20%)

Query: 182 PYVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVYVVPXXXXXXXX 241
           P+ IN+K+LP GDD Y TRSLL+ NV+ SI LH  +  FVK   +ES Y++         
Sbjct: 196 PFCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSNTLESAYLIEGGKSDDSK 255

Query: 242 XXXXXXXXXXXXXXXXXXXXQSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTLNF 301
                                SIL+SFLTK  CL+FYNN+LQ+LS+FK  L S++L L F
Sbjct: 256 DVETKNL--------------SILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLKF 301

Query: 302 VSLT-------------------------------SEDIRDDVLRKGATRSIALEFKNSF 330
           V L                                S  +  ++  K ATRSI +EFK+  
Sbjct: 302 VCLNYDPKCLPTFIESEALTENAEEADITNGSTMISASLHHNIANKDATRSIIIEFKSPV 361

Query: 331 TTKQL--ESIEILSNASNSRFVVEKIDIVNTESPNKNFNTHYAIIHFISISMAVEASSYL 388
               L  + ++ L  + N R+++E ID+VNT+ P+  F  +YA++ F++ISMA+E   YL
Sbjct: 362 EKSDLFKKKLQFLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNISMAIEVLDYL 421

Query: 389 LNWDEKLGISRLFFVTDSIINKSDYFRSAPASQDASRSSVS 429
             + + LGIS+ F+V+            AP    ++RSSV+
Sbjct: 422 KKYSKNLGISKCFYVS-----------LAPLVVSSARSSVA 451

 Score = 78.6 bits (192), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 56/99 (56%), Gaps = 10/99 (10%)

Query: 21  NGIQPHYPQTMAYHPMGPMNGGVQPTMQMSLPSQQ-GYYAGSPMPSAPQTPFDTSYGATL 79
           NG+       M YHP+  +NG  Q       PSQ   YY  SP+P+ P TPFDT+YGA+L
Sbjct: 22  NGMNAMVGNPMMYHPVDFVNGAGQYG-----PSQHPAYYTNSPLPNIPPTPFDTAYGASL 76

Query: 80  LPSHLLMGSPFISTPQNAAMMHAGSRGLNSSQQQFYHYT 118
            PSHLLMGSPF+S+P     M +G     SS  +   Y+
Sbjct: 77  FPSHLLMGSPFVSSPN----MQSGYNSARSSNLKRKAYS 111

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 54/100 (54%), Gaps = 8/100 (8%)

Query: 967  GFPSMVSSTSLDAVPPLAPSTVSRHYSVAXXXXXXXXXXXGRHDASKKRHGGGKGNTHHG 1026
            G   +   +SL   PP APST+S ++S             G    ++K+  G        
Sbjct: 1038 GMSQLNYRSSLRQAPPRAPSTLSYNHSKNNETPMQDIFTNGETANNRKKKRGS-----FA 1092

Query: 1027 RHRKSKAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDN 1066
            RHR    IPGS VMAQYLAQ+QHSTFMYAANILG +  DN
Sbjct: 1093 RHR---TIPGSDVMAQYLAQVQHSTFMYAANILGASAEDN 1129

>NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844
          Length = 1198

 Score =  316 bits (809), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 170/346 (49%), Positives = 215/346 (62%), Gaps = 18/346 (5%)

Query: 513  NSTREDVMIQSSMASGTSNFVPPPPHYYMDVTK-PIRXXXXXXXXXXAQVASNMGGGLGN 571
            N+  ++V  Q+        F    P +  D T  PI           AQVAS+MG  +GN
Sbjct: 668  NTEAKEVKEQNKGERNEGIFFVEQPTFNTDPTMYPIVRTLEDKFNTSAQVASSMGVEMGN 727

Query: 572  RTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPI 631
            RT+Y+GN+NPRSK ED+CNVVRGGILQ IK    K +CFVT               I+P+
Sbjct: 728  RTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPL 787

Query: 632  VLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFREKY 691
            +LHGN LK+GWG++   L++SIALAVTIGASRNVYVSLPE+AFKDKF+ DPE++EF EKY
Sbjct: 788  ILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFHEKY 847

Query: 692  ELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANG--ADNKKFHGS 749
            +LPS++QLR DF+ +G IEQINYL D HCCWVNFMNITSAIKLVED N    DN  F   
Sbjct: 848  KLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDN-TFSKK 906

Query: 750  YQDRYKGLIIGYGKDRCGNVNKNLVANXXXXXXXXXXXAS--YKIR-MHKQNKAGGSNGQ 806
            +  RY GLII YGKDRCGNVN+NL++N            S  YK+R + ++ +     G+
Sbjct: 907  FNHRYDGLIINYGKDRCGNVNRNLISNKNSRHYRKVKKFSDNYKLRQLQEKRRVEQEKGK 966

Query: 807  EPISSFQDN------AFGICISPRGIESEEVEALPDVPQNIEEEKN 846
            E      DN      A GI +  R    EE +    VP++ E++ N
Sbjct: 967  ELNGGVNDNKLPSLDALGIGLQ-RTAPPEEQK----VPESNEDDAN 1007

 Score =  181 bits (458), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 138/438 (31%), Positives = 192/438 (43%), Gaps = 119/438 (27%)

Query: 53  SQQGYYAGSPMPSAPQTPFDTSYGATLLPSHLLMGSPFISTPQNAAMMHAGSRGLNSSQQ 112
           +QQ YY  SP+P+AP TPFDT+YGATLLPSHLLMGSP++STP            + SSQQ
Sbjct: 69  TQQAYYIPSPLPNAPPTPFDTAYGATLLPSHLLMGSPYVSTPNGI---------VPSSQQ 119

Query: 113 QFYHYTYXXXXXXXXXXXXXXXXXXXVEN----GHVMMTRYS--YPPPPQLNAPPMTHKR 166
           Q   + Y                   +       +     Y+  Y   PQ   P +    
Sbjct: 120 QSQMFLYSQSPAGTPNRKSFSQLNSMLNQPSSRSNFFTDSYNNRYQNNPQTRIPEVDP-- 177

Query: 167 KTHLRHETNSQPSSEPYVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPI 226
                    ++   +P+VI++K+LP GDD Y TRSLL SNV +SI LH FI  FV++  I
Sbjct: 178 ---------NELFQKPFVISYKLLPTGDDAYRTRSLLFSNVASSIDLHSFIYDFVQYSSI 228

Query: 227 ESVYVVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSILLSFLTKNTCLDFYNNVLQKLS 286
           ES+Y++                             +SILLSFL++  CL FYNNVLQ+L+
Sbjct: 229 ESIYLI------------SNTDDEKDQDNENDKNKRSILLSFLSREICLSFYNNVLQRLN 276

Query: 287 DFKIDLNSKSLTLNFVSL-----------------------------------------T 305
           +FK +L SKSLTLNFV L                                         T
Sbjct: 277 EFKTNLQSKSLTLNFVILNYLEKTDDGSTANISNNQLNQIQENENDVNTNEFDYRNSMNT 336

Query: 306 SEDIRDDVLRKGATRSIALEFKNSFTTKQLESIE---ILSNASNSRFVVEKIDIVN---- 358
              ++ D++   ATR I +E K     + L +     ++ N  N R+++E ID+ N    
Sbjct: 337 VNALKFDLINPDATRFIMIELKTKCDKETLLNKHLSFLIDNKKNIRYILESIDLFNIIEN 396

Query: 359 ---------TESPNKNFNT------------------------HYAIIHFISISMAVEAS 385
                     E+ N+N N+                        HYA++ FI+I MA+E  
Sbjct: 397 ENSSENKSIIEAKNENENSPQGKEKDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELR 456

Query: 386 SYLLNWDEKLGISRLFFV 403
            YL     K GI+   +V
Sbjct: 457 DYLKLNGLKHGITNASYV 474

 Score = 66.2 bits (160), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/64 (54%), Positives = 43/64 (67%), Gaps = 5/64 (7%)

Query: 1013 KKRHGGGKGNTHH--GRHRKSKAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDNEDST 1070
            K+  GG +    H     ++ + IPG+ VMAQYL QLQHSTFMYAANILGV+    ED+T
Sbjct: 1134 KQVQGGIQDQDPHLSSTGKQQRVIPGADVMAQYLTQLQHSTFMYAANILGVS---AEDNT 1190

Query: 1071 LYDE 1074
             YDE
Sbjct: 1191 YYDE 1194

>Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W
           (REAL)
          Length = 1128

 Score =  312 bits (799), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 181/443 (40%), Positives = 238/443 (53%), Gaps = 47/443 (10%)

Query: 431 DQTLEFATKKLQGLVLKERTLSIKPKTYPQAEIEEHQHHXXXXXXXXXXXXXXXXXXXXX 490
           ++ ++  T KLQG+ L   +L I    Y    I EH  H                     
Sbjct: 518 NEEIDLLTTKLQGIELDGTSLEITSHDYSTPTINEHSTHLSNIKISKTVENSRHFPQDIP 577

Query: 491 XXXXXXXTSSPVTQEMYLHDTSNSTREDVMIQSSMASGTSNFVPPPPHYYMDVTK----- 545
                  +  P+ ++M+++D SN +   V+ Q  +A+      P P    + + +     
Sbjct: 578 -------SPLPLNEQMFMND-SNQSNGAVIPQQLIAA------PSPLSSNLQINQRVLPN 623

Query: 546 PIRXXXXXXXXXXAQVASNMGGGLGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEH 605
            I           A+VAS+MG  +GNRT+Y+GNINPRS+ EDICNVVRGGILQ IK+   
Sbjct: 624 AITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPE 683

Query: 606 KHVCFVTXXXXXXXXXXXXXXSIEPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNV 665
           K + FVT               I+PIVLHGN+L+VGWGH+ G L +SI+LAVTIGASRNV
Sbjct: 684 KRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNV 743

Query: 666 YVSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNF 725
           YVSLPE+AFK+KFI DP++++  E   LP  EQLR+DFS +G+IEQINYL D HCCW+NF
Sbjct: 744 YVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINF 803

Query: 726 MNITSAIKLVEDANG---------------ADNKKFHGSYQDRYKGLIIGYGKDRCGNVN 770
           MNI+SAI LVE+ N                A  +KF G    RYKGL+I YGKDRCGN+N
Sbjct: 804 MNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKFDG----RYKGLLINYGKDRCGNIN 859

Query: 771 KNLVANXXXXXXXXXXXASYKIRMHKQNKAGGSNGQEPISSFQD----NAFGICISPR-- 824
           KNLVA             SY IR+ K  +    N  +   SF       + GI + P   
Sbjct: 860 KNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKESFDKVLNLESLGISLDPHKD 919

Query: 825 -GIESEEVEALP--DVPQNIEEE 844
            GI   E E +   ++   IE E
Sbjct: 920 AGIGVIETENITGDEIESEIEAE 942

 Score =  166 bits (419), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 96/256 (37%), Positives = 135/256 (52%), Gaps = 47/256 (18%)

Query: 182 PYVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVYVVPXXXXXXXX 241
           P+ IN+KILP GDD Y TRSLL+ NV+ S  LH  +  FVKF  +ES Y V         
Sbjct: 195 PFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLESAYFVDNDKNDDLE 254

Query: 242 XXXXXXXXXXXXXXXXXXXXQSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTLNF 301
                                S+L+SFLT++ CL+FYNN+LQ+LS+FKI L SKSL L F
Sbjct: 255 DGETENL--------------SVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKF 300

Query: 302 VSLTSED-------------------------------IRDDVLRKGATRSIALEFKNSF 330
           V L  E                                +  DV  K ATRSI +EFK++ 
Sbjct: 301 VCLNYESECLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFKSAL 360

Query: 331 TTKQL--ESIEILSNASNSRFVVEKIDIVNTESPNKNFNTHYAIIHFISISMAVEASSYL 388
              +L  + ++ L  + N R+++E ID+VNT+ P+  F  +YA++ F++I MAVE   YL
Sbjct: 361 EKTELFRKRLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVLDYL 420

Query: 389 LNWDEKLGISRLFFVT 404
             + + L IS+ F+V+
Sbjct: 421 KKFSKSLEISKCFYVS 436

 Score = 78.6 bits (192), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 46/74 (62%), Gaps = 4/74 (5%)

Query: 21 NGIQPHYPQTMAYHPMGPMNGGVQPTMQMSLPSQQGYYAGSPMPSAPQTPFDTSYGATLL 80
          NG+       M YHP+  +NG      Q        YY  SP+P+ P TPFDT+YGA+LL
Sbjct: 22 NGMNAMVGNQMMYHPVDFING----VGQYGSSQHPAYYTNSPLPNVPPTPFDTAYGASLL 77

Query: 81 PSHLLMGSPFISTP 94
          PSHLLMGSPF+S+P
Sbjct: 78 PSHLLMGSPFVSSP 91

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 52/101 (51%), Gaps = 11/101 (10%)

Query: 967  GFPSMVSSTSLDAVPPLAPSTVS-RHYSVAXXXXXXXXXXXGRHDASKKRHGGGKGNTHH 1025
            G   +   +SL   PP APST+S  H   +             ++  +KR          
Sbjct: 1033 GISQLNHRSSLRQAPPRAPSTLSYDHLKKSETSFQDSRNAETANNRERKR---------- 1082

Query: 1026 GRHRKSKAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDN 1066
            G   + + IPGS VMAQYLAQ+QHSTFMYAANILG +  DN
Sbjct: 1083 GSLPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDN 1123

>KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {ON}
           Anc_8.844 YML117W
          Length = 1053

 Score =  300 bits (769), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 137/230 (59%), Positives = 170/230 (73%), Gaps = 1/230 (0%)

Query: 546 PIRXXXXXXXXXXAQVASNMGGGLGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEH 605
           PI            QVA+ MG    NRT+Y+GNINPRS+ EDICNVVRGGILQ+IKF E 
Sbjct: 577 PITDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEA 636

Query: 606 KHVCFVTXXXXXXXXXXXXXXSIEPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNV 665
           KH+CF+T               I+PIVLHGN LK+GWG + G L + IALAVTIGASRNV
Sbjct: 637 KHICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNV 696

Query: 666 YVSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNF 725
           Y+SLPE AFKDK+IKDP+F+ + E ++LP+KE LR+DF ++G IEQIN L+D HCCWVNF
Sbjct: 697 YISLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNF 756

Query: 726 MNITSAIKLVEDANGADNKKFHGSYQDRYKGLIIGYGKDRCGNVNKNLVA 775
           MNI+SAI+LVEDA+   +  F+  +  RY+GL+I YGKDRCGN+N+NLVA
Sbjct: 757 MNISSAIRLVEDASTKQD-HFNQLFDHRYEGLVINYGKDRCGNINRNLVA 805

 Score =  141 bits (355), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 103/345 (29%), Positives = 161/345 (46%), Gaps = 79/345 (22%)

Query: 182 PYVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVYVVPXXXXXXXX 241
           P+ I++KILPKGDD Y TRSLLL N++  + LH F++KFV+   +ESVY+          
Sbjct: 159 PFEISYKILPKGDDLYRTRSLLLGNIDDMVDLHTFVSKFVQNNSVESVYIT--------- 209

Query: 242 XXXXXXXXXXXXXXXXXXXXQSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTLNF 301
                                  LLSFL+   CL+FYNNVLQ+L +FK  L + SL L+F
Sbjct: 210 ------------KEGQQPEKYGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSLELSF 257

Query: 302 VSLTSEDIR----------------------DDVLRKGATRSIALEFKNS---FTTKQL- 335
           VS+     +                      D   + GATRSIA+EF +     T  +L 
Sbjct: 258 VSMRQRPTKVEGKIYRRFAADDGDGMANLHFDMAAQTGATRSIAIEFVDKDVILTRDELL 317

Query: 336 -ESIEILSNASNSRFVVEKIDIVNTESPNKNFNTHYAIIHFISISMAVEASSYLLNWDEK 394
            + ++ LS   N+R+++E I +  T+   K F  +YAII F+SI MA+E   YL    ++
Sbjct: 318 NKKLKFLSEG-NNRYILEHIAVFKTQHGTKVFGKNYAIITFLSIPMAMEIMDYLKLNIKQ 376

Query: 395 LGISRLFFV--------TDSIINKSDYFRSAPASQDASRSSVSIDQT------------- 433
           L +++ F+V        + +   K  +     +++D S  +   DQ              
Sbjct: 377 LHLTKFFYVQVTHPPQQSPAASQKKPHANDTESNRDTSPPNSKKDQEFFPNNSMLSLVSS 436

Query: 434 ---------LEFATKKLQGLVLKERTLSIKPKTYPQAEIEEHQHH 469
                    ++    KL+ + L+E TL ++ + YP+   E+   H
Sbjct: 437 ESSTSLADDVDGLVNKLKSIELQESTLKLRVEDYPEPLFEQFSEH 481

 Score = 77.8 bits (190), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 55/99 (55%), Gaps = 16/99 (16%)

Query: 981  PPLAPSTVSRHYSVAXXXXXXXXXXXGRHDASKKRHGGGKGNTHHGRHRK-----SKAIP 1035
            PPLAP T+SR Y+ A                       G G   +GRHR+     ++ IP
Sbjct: 965  PPLAPDTISRQYAEASYHNELV--------TGNDHPDTGYGKAENGRHRQQLPRNARTIP 1016

Query: 1036 GSQVMAQYLAQLQHSTFMYAANILGVTNGDNEDSTLYDE 1074
            GS VMAQYLAQLQHSTFMYAAN+LG +   NE +  YD+
Sbjct: 1017 GSDVMAQYLAQLQHSTFMYAANVLGAS---NEGTEQYDD 1052

 Score = 64.7 bits (156), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/84 (47%), Positives = 48/84 (57%), Gaps = 12/84 (14%)

Query: 22  GIQPHYPQTMAY-------HPMGPMNGGVQPTMQMSLPSQQGYYAG----SPMPSAPQTP 70
           G +P YPQ M         +P G ++    P  Q S P  Q +       SPM +   TP
Sbjct: 35  GPRPTYPQVMYQFNQNTHGYPQGTVSKQA-PLSQQSHPFPQNFAQNFPPNSPMTNGMPTP 93

Query: 71  FDTSYGATLLPSHLLMGSPFISTP 94
           FDT+YGATLLPSHLLMGSPF+STP
Sbjct: 94  FDTAYGATLLPSHLLMGSPFVSTP 117

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 632

 Score =  162 bits (410), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 116/201 (57%), Gaps = 21/201 (10%)

Query: 569 LGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSI 628
           LGNRTVYLGN+    K E+ICNVVRGG+LQ++K    +HVCFVT              S+
Sbjct: 448 LGNRTVYLGNLPKDVKVEEICNVVRGGLLQNVKVLSDRHVCFVTFIDPTAAAQFYAMSSL 507

Query: 629 EPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFR 688
             I +     +VGWG HPG L  ++ALAV+ GASRNVYV    +  +D   +DP F E  
Sbjct: 508 HGITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYVGNINFD-EDSKREDPIFTE-- 564

Query: 689 EKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHG 748
                     LR  F  +GE+EQINYL + +CC+VN+ NI++AI  +      D  K H 
Sbjct: 565 --------SSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILAI------DKIKGHP 610

Query: 749 SYQDRYKGLIIGYGKDRCGNV 769
            ++D    L I +GKDRCGNV
Sbjct: 611 VFKD----LKINFGKDRCGNV 627

 Score = 68.9 bits (167), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 95/205 (46%), Gaps = 23/205 (11%)

Query: 572 RTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPI 631
           +TVYLGN       +++ + VR G+++ ++    K   FV+               ++ +
Sbjct: 210 KTVYLGNTPITLTVKELLDHVRSGVVEDVRILPDKMCAFVSFVDESAALLFHSDAILKRL 269

Query: 632 VLHGNVLKVGWGHHPGDLAQSIALAVT-IGASRNVYVSLPEYAFKDKFIKDPEFQEFREK 690
            + G  +K+GWG  P  +   +A AV    A+RNVY+         +    P+       
Sbjct: 270 HIDGRDIKIGWGK-PTPIDPVVATAVANDNATRNVYIG--------QLNTGPKLSSQVSP 320

Query: 691 YELP----SKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKF 746
            ++     ++++LR D   FGEI+ I  +++    +V+F +I +AIK V  AN A+   +
Sbjct: 321 VDVTEPVITEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAV--ANLANINPY 378

Query: 747 HGSYQDRYKGLIIGYGKDRCGNVNK 771
                  Y+   I YGKDRC  + K
Sbjct: 379 -------YRNKKIFYGKDRCAFITK 396

>AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL184C
          Length = 523

 Score =  159 bits (402), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 112/201 (55%), Gaps = 21/201 (10%)

Query: 569 LGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSI 628
           LGNRT+YLGN+    K E+ICN VRGG+LQHIK    +HVCFVT              S+
Sbjct: 339 LGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLSDRHVCFVTFIDPTAAAQFYAMSSL 398

Query: 629 EPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFR 688
             + +H    K+GWG H G L   +ALAV+ GASRN+Y+   ++A  DK  + P F E  
Sbjct: 399 HGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFA-ADKKSQHPIFTE-- 455

Query: 689 EKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHG 748
                     LR  F  FGE+EQIN+L + +CC++NF NI+SAI  ++            
Sbjct: 456 --------AALRAVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKSIPT----- 502

Query: 749 SYQDRYKGLIIGYGKDRCGNV 769
                +K L I +GKDRCGNV
Sbjct: 503 -----FKDLKINFGKDRCGNV 518

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 102/203 (50%), Gaps = 18/203 (8%)

Query: 571 NRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEP 630
           +RTVYLGN+ P    +++ + VR G+++ +K    K   F++               ++ 
Sbjct: 102 SRTVYLGNVPPYITTKELLDHVRSGVVEEVKILPEKMCAFISFVEENSALLFHSDAILKR 161

Query: 631 IVLHGNVLKVGWGHHPGDLAQSIALAVT-IGASRNVYVSLPEYAFKDKFIKDPEFQEFRE 689
           + +    +K+GWG  P  +   +A  +T  GA+RNVY+       K    KD   Q   +
Sbjct: 162 LNIDDRDIKIGWGK-PTQIDPIVAAGITNDGATRNVYIG------KLNTNKDICAQWGVD 214

Query: 690 -KYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHG 748
              E+ ++E+LR D S+FGE+E +  + +    +V+F +I +AIK+V  AN A+   ++ 
Sbjct: 215 PNEEVITEEKLRNDLSDFGEVENVKIVPEKGIAFVHFSSIFAAIKVV--ANLANINPYYA 272

Query: 749 SYQDRYKGLIIGYGKDRCGNVNK 771
             +       I YGKDRC  + K
Sbjct: 273 QKK-------IFYGKDRCAFITK 288

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score =  159 bits (403), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 83/201 (41%), Positives = 112/201 (55%), Gaps = 21/201 (10%)

Query: 569 LGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSI 628
           LGNRT+YLGN+    K E+ICN VRGG+LQHIK    +HVCFVT              S+
Sbjct: 392 LGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLNDRHVCFVTFIDPTAAAQFYAMSSL 451

Query: 629 EPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFR 688
             + +H    K+GWG H G L   +ALAV+ GASRN+Y+   ++   D+ ++ P F E  
Sbjct: 452 HGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFE-DDRKLEQPIFTE-- 508

Query: 689 EKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHG 748
                     LR  F  FGE+EQIN+L + +CC++NF NI+SAI  ++            
Sbjct: 509 --------TSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKSIPT----- 555

Query: 749 SYQDRYKGLIIGYGKDRCGNV 769
                +K L I +GKDRCGNV
Sbjct: 556 -----FKDLKINFGKDRCGNV 571

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 99/205 (48%), Gaps = 24/205 (11%)

Query: 572 RTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPI 631
           RTVYLGN+ P     ++ + VR G+++ +K    K   F++               ++ +
Sbjct: 156 RTVYLGNVPPYITTRELLDHVRSGVVEDVKILPEKMCAFISFVDENSALLFHSDAILKRL 215

Query: 632 VLHGNVLKVGWGHHPGDLAQSIALAVT-IGASRNVYV----SLPEYAFKDKFIKDPEFQE 686
            +    +K+GWG  P  +   +A  +   GA+RNVY+    + P+     ++  DP  + 
Sbjct: 216 NIDDRDIKIGWGK-PTQIDPIVAAGINNDGATRNVYLGKLNTNPKMC--AQWGADPNEET 272

Query: 687 FREKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKF 746
             E       E+LR D ++FGE+E +  + +    +V+F +I SAIK+V  AN A+   +
Sbjct: 273 ITE-------EKLRNDLADFGEVESVKIVTEKGIAFVHFSSIFSAIKVV--ANLANVNPY 323

Query: 747 HGSYQDRYKGLIIGYGKDRCGNVNK 771
           +   +       I YGKDRC  + K
Sbjct: 324 YAQKK-------IFYGKDRCAFITK 341

>Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184C -
           Hypothetical ORF [contig 30] FULL
          Length = 567

 Score =  157 bits (398), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 115/201 (57%), Gaps = 21/201 (10%)

Query: 569 LGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSI 628
           LGNRT+YLGN+    K E+ICNVVRGG+LQ IK    +HVCFVT              S+
Sbjct: 383 LGNRTIYLGNLPKDVKIEEICNVVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMASL 442

Query: 629 EPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFR 688
             + +H    K+GWG H G L+ ++ALAV+ GASRN+Y+   ++   D   + P F E  
Sbjct: 443 HGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFK-ADSETEHPIFTE-- 499

Query: 689 EKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHG 748
                   + LR  F  FGE+EQIN+L + +CC+VNF NI++AI  +      D  K + 
Sbjct: 500 --------QNLRSIFEEFGEVEQINFLIERNCCFVNFTNISNAILAI------DKIKNNP 545

Query: 749 SYQDRYKGLIIGYGKDRCGNV 769
            + D    L I +GKDRCGNV
Sbjct: 546 QFSD----LKINFGKDRCGNV 562

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 99/207 (47%), Gaps = 28/207 (13%)

Query: 572 RTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPI 631
           RTVYLGNI P  +   + + VR G+++ I+    K   F++               ++ +
Sbjct: 146 RTVYLGNIPPNLEARQLLDHVRSGVVEDIRILREKMCAFISFLDESSALLFHSDAILKRL 205

Query: 632 VLHGNVLKVGWGH-HPGDLAQSIALAVTIGASRNVYVSL--PEYAFKDKFIKDPEFQEFR 688
            + G  +K+GWG   P D   + A+A   GA+RNVY+     + +F  +   DP      
Sbjct: 206 NIDGRDIKIGWGKPTPIDPVVTSAVA-NDGATRNVYIGRLNTDSSFAPQIGADP------ 258

Query: 689 EKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGAD----NK 744
            + E+ ++++LR D S +GEIE +  + +    +V+F +I SAIK+V      +    NK
Sbjct: 259 -RDEVVTEQKLRDDLSFYGEIESVKIITEKGIAFVHFCSIFSAIKVVSSLAAVNPYYANK 317

Query: 745 KFHGSYQDRYKGLIIGYGKDRCGNVNK 771
           K             I YGKDRC  + K
Sbjct: 318 K-------------IFYGKDRCAFITK 331

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score =  157 bits (398), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/202 (40%), Positives = 111/202 (54%), Gaps = 23/202 (11%)

Query: 569 LGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSI 628
           LGNRTVYLGN+    K E+ICN VRGG+LQ +K    +HVCFVT              S+
Sbjct: 398 LGNRTVYLGNLPKDVKIEEICNAVRGGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSL 457

Query: 629 EPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFR 688
             + +H    K+GWG H G L  ++ALAV+ GASRN+YV             + +F    
Sbjct: 458 HGLTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVG------------NIDFNAID 505

Query: 689 EKYELPSKEQ-LRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFH 747
           E  E    EQ LR+ F  FGE+EQIN+L + +CC++NF NI++AI  ++           
Sbjct: 506 ETGETIFTEQNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAIDKIKC------- 558

Query: 748 GSYQDRYKGLIIGYGKDRCGNV 769
                 +K L + +GKDRCGNV
Sbjct: 559 ---NPYFKNLKVNFGKDRCGNV 577

 Score = 90.5 bits (223), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 101/205 (49%), Gaps = 24/205 (11%)

Query: 572 RTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPI 631
           RTVYLGNI P    + + + VR G+++ +K    +   F++               ++ +
Sbjct: 161 RTVYLGNIPPFLPAKQLLDHVRSGVIEELKILPDRMCAFISFVDESSALLFHSDAILKRL 220

Query: 632 VLHGNVLKVGWGHHPGDLAQSIALAV-TIGASRNVYV----SLPEYAFKDKFIKDPEFQE 686
            + G  +KVGWG  P  +   +A  + + GA+RNVY+    + P+ A   +F  DP    
Sbjct: 221 NIEGRDIKVGWGK-PTPIDPIVAAGIASDGATRNVYIGRLNTDPQLA--PQFGTDP---- 273

Query: 687 FREKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKF 746
                E+ S+E+LR+D ++FGEIE I  + D    +V+F +I SAIK+V +         
Sbjct: 274 ---NEEIVSEEKLRKDLNDFGEIESIKIVRDKGIAFVHFSSIFSAIKVVSNL-------- 322

Query: 747 HGSYQDRYKGLIIGYGKDRCGNVNK 771
             S    Y    I YGKDRC  + K
Sbjct: 323 -ASVNPYYTNKKIFYGKDRCAFITK 346

>KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 569

 Score =  157 bits (397), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 84/202 (41%), Positives = 114/202 (56%), Gaps = 23/202 (11%)

Query: 569 LGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSI 628
           LGNRT+YLGN+    K E+ICN VRGG+LQ IK    +HVCFVT              S+
Sbjct: 385 LGNRTIYLGNLPKDVKIEEICNAVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMTSL 444

Query: 629 EPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKD-PEFQEF 687
             + +H    K+GWG H G L+ ++ALAV+ GASRN+Y  L    FK    +D P F E 
Sbjct: 445 HGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIY--LGNIDFKADSERDVPVFTE- 501

Query: 688 REKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFH 747
                    + LR+ F  +GE+EQIN+L +  CC+VNF NI++AI  ++           
Sbjct: 502 ---------QNLRKLFEEYGEVEQINFLPERSCCFVNFTNISNAILAIDKIKS------- 545

Query: 748 GSYQDRYKGLIIGYGKDRCGNV 769
               +++K L I +GKDRCGNV
Sbjct: 546 ---NEQFKDLKINFGKDRCGNV 564

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 95/203 (46%), Gaps = 20/203 (9%)

Query: 572 RTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPI 631
           RTVYLGNI P  +  ++ + VR G+++ ++    K   F++               ++ +
Sbjct: 148 RTVYLGNIPPNLEVRELLDHVRSGVVEDVRILREKMCAFISFLDESSALLFHSDAILKRL 207

Query: 632 VLHGNVLKVGWGHHPGDLAQSIALAVT-IGASRNVYVSL--PEYAFKDKFIKDPEFQEFR 688
            + G  +KVGWG  P  +   +  AV+  GA+RNVY+     +     +F  DP      
Sbjct: 208 NIGGRDIKVGWG-KPTPIDPVVTAAVSNDGATRNVYIGRLNTDRDLAPQFGADP------ 260

Query: 689 EKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHG 748
            +  + ++E+LR D   +GEIE +  + +    +V+F +I SAIK+V             
Sbjct: 261 -RDLIATEEKLRADLDFYGEIESVKIIVEKGIAFVHFSSIFSAIKVVSSL---------A 310

Query: 749 SYQDRYKGLIIGYGKDRCGNVNK 771
           +    Y    I YGKDRC  V K
Sbjct: 311 TVNPYYSNKKIFYGKDRCAFVTK 333

>KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON}
           Anc_6.183 YPL184C
          Length = 443

 Score =  152 bits (385), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 82/201 (40%), Positives = 114/201 (56%), Gaps = 23/201 (11%)

Query: 569 LGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSI 628
           LGNRT+Y+GN++ R + E++CNVVRGG+LQ +KF   +HVCFVT              S+
Sbjct: 262 LGNRTIYVGNLSARCRIEEVCNVVRGGLLQSVKFLPDRHVCFVTFADPTAAAQFYAMASL 321

Query: 629 EPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFR 688
             + +     K+GWG H G L   +A A++ GASRNVY       F +   +DP   EF 
Sbjct: 322 HGLTIQRRRCKIGWGKHSGPLPAHLADAISHGASRNVY-------FGNVNWQDPAVAEFF 374

Query: 689 EKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHG 748
           E      +  LRQ  S+FGE+EQ+N + +  C +VNF N+ SAI  VE       KK+  
Sbjct: 375 E------ERHLRQAMSHFGEMEQVNAVPERRCVFVNFTNLESAIAAVEQV-----KKW-- 421

Query: 749 SYQDRYKGLIIGYGKDRCGNV 769
               +++ L + YGKDRCGNV
Sbjct: 422 ---PQFQQLKVNYGKDRCGNV 439

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 88/205 (42%), Gaps = 37/205 (18%)

Query: 571 NRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEP 630
           +RTVYLGNI P     ++ + V+ G+++  + F  K   FV+               +  
Sbjct: 38  SRTVYLGNIAPEVTLRELLDHVQSGVVEDARLFPAKSCAFVSFVDENSALLFHSDAILNR 97

Query: 631 IVLHGNVLKVGWGHHPGDLAQSIALAVTI---GASRNVYV-SLPEYAFKDKFIKDPEFQE 686
           + +    +K+GW      L   + +A  I   GA+RNVY+ +LP+               
Sbjct: 98  LRIGDRDVKIGWA--TATLMDPL-VATRIQSEGATRNVYLGNLPDGV------------- 141

Query: 687 FREKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKF 746
                   S+ +L +D S +GEI+ +  L      +V+  +I  AI  V +    DNK  
Sbjct: 142 --------SRYELTKDLSVYGEIDSVKLLSSKGVAFVHMASIGQAIHAVANLQ-RDNK-- 190

Query: 747 HGSYQDRYKGLIIGYGKDRCGNVNK 771
              Y DR     + +GKDRC  V K
Sbjct: 191 --IYSDRR----VSFGKDRCAYVTK 209

>TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa]
           {ON} Anc_6.183 YPL184C
          Length = 710

 Score =  156 bits (394), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 84/202 (41%), Positives = 110/202 (54%), Gaps = 22/202 (10%)

Query: 569 LGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSI 628
           LGNRTVYLGN+    K ++ICN VRGG+LQHIK    +HVCFVT              S+
Sbjct: 525 LGNRTVYLGNLPVDVKIDEICNAVRGGLLQHIKLLTDRHVCFVTFIDPTAAAQFYAMSSL 584

Query: 629 EPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFR 688
             + +     KVGWG H G L   IALAV+ GASRNVY+   ++    K    P F E  
Sbjct: 585 HGLSIQKKRCKVGWGKHSGPLPNLIALAVSNGASRNVYLGNIDFENDIKLHNPPIFTEL- 643

Query: 689 EKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVED-ANGADNKKFH 747
                     LR  F  +G++EQIN+L + +CC++NF NI++AI  +E   N  D     
Sbjct: 644 ---------SLRNIFQQYGDVEQINFLPEKNCCFINFTNISNAILAIEKIKNNPD----- 689

Query: 748 GSYQDRYKGLIIGYGKDRCGNV 769
                 +K L I +GKDRCGN+
Sbjct: 690 ------FKDLKINFGKDRCGNI 705

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 108/226 (47%), Gaps = 28/226 (12%)

Query: 563 SNMGGGLGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXX 622
           +N  G   +RTVYLGNI      +D+ + VR G++++IK    K   F++          
Sbjct: 259 NNTFGNTPSRTVYLGNIPSDLSVKDLLDHVRSGVVENIKILPDKMCAFISFVDESSALLF 318

Query: 623 XXXXSIEPIVLHGNVLKVGWGHHPGDLAQSIALA-VTIGASRNVYV-------------- 667
                ++ + + G  +K+GWG  P  +   +A + VT GA+RNVY+              
Sbjct: 319 HSDAILKRLNIGGRDIKIGWG-KPTPIDPIVATSIVTDGATRNVYIGQLSNSSNNNTSSS 377

Query: 668 --SLPEYAFKDKFIKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNF 725
             S    +  +    D E ++  +   L ++E+LR+D  ++GEI+ +  + D    +V+ 
Sbjct: 378 SSSTSPSSPSNNTSDDLEKKKNIDDSPL-TEEKLREDLKDYGEIDCVKIVQDKGFAFVHM 436

Query: 726 MNITSAIKLVEDANGADNKKFHGSYQDRYKGLIIGYGKDRCGNVNK 771
            +I SAIK+V   N A    +   YQ++     I YGKDRC  + K
Sbjct: 437 SSILSAIKVVN--NLAQTNPY---YQNKR----IFYGKDRCAFITK 473

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
           Anc_6.183
          Length = 629

 Score =  154 bits (388), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 82/201 (40%), Positives = 117/201 (58%), Gaps = 21/201 (10%)

Query: 569 LGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSI 628
           LGNRTVYLGN+    K E+ICNVVRGG+LQ +K    ++VCFVT              S+
Sbjct: 445 LGNRTVYLGNLPKDIKIEEICNVVRGGLLQSVKLLSDRYVCFVTFIDPTAAAQFYAMSSL 504

Query: 629 EPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFR 688
             + +     KVGWG H G L  ++ALAV+ GASRNVY+      F+   ++DP      
Sbjct: 505 HGLTIQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYIG--NINFEKDAMRDP------ 556

Query: 689 EKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHG 748
               + +++ LR+ F  +GE+EQIN+L + +CC++NF NI++AI  +      D  K + 
Sbjct: 557 ---RIFTEDSLRKLFRQYGEVEQINFLPEKNCCFINFTNISNAILAL------DKIKSNP 607

Query: 749 SYQDRYKGLIIGYGKDRCGNV 769
            ++D    L I +GKDRCGNV
Sbjct: 608 HFED----LKINFGKDRCGNV 624

 Score = 81.3 bits (199), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 92/201 (45%), Gaps = 22/201 (10%)

Query: 572 RTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPI 631
           RTVYLGNI      +++ + VR G+++ +K    K   F++               ++ +
Sbjct: 214 RTVYLGNIPSNLTVKELLDHVRSGVVEDVKIIPEKLCAFISFVDESSALLFHSDAILKRL 273

Query: 632 VLHGNVLKVGWGHHPGDLAQSI-ALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFREK 690
            + G  +K+GWG  P  +   I A  +   A+RNV++        D   K+P        
Sbjct: 274 NIGGKDIKIGWGK-PTTVDPMISARIINDDATRNVFIGHLNKTDNDSCTKEPI------- 325

Query: 691 YELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSY 750
               ++ +LR+D  +FGEIE +  + +    +V+F +ITSAIK V +           S 
Sbjct: 326 ----TEAKLREDLEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVHNLR---------SM 372

Query: 751 QDRYKGLIIGYGKDRCGNVNK 771
              Y+   I YGKDRC  + K
Sbjct: 373 NPYYENKKIAYGKDRCAFITK 393

>KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON}
           Anc_6.183 YPL184C
          Length = 533

 Score =  151 bits (381), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 112/201 (55%), Gaps = 25/201 (12%)

Query: 569 LGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSI 628
           LGNRT+YLGN+    K E+ICNVVRGG+LQ+IK    +  CF+T              S+
Sbjct: 353 LGNRTIYLGNLPKGVKIEEICNVVRGGLLQNIKLLSDRFACFITFIDPTAAAQFYAMSSL 412

Query: 629 EPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFR 688
             + +  N  KVGWG H G L+ ++ALA++ GASRN+Y+                  +F 
Sbjct: 413 HGLTIQKNRCKVGWGKHSGPLSNALALAISNGASRNIYIGNV---------------DFE 457

Query: 689 EKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHG 748
           +K E  ++E LR+ F  FGE+EQIN+L +  CC+VNF NI  AI  +      D  K   
Sbjct: 458 KKNEYFNEEHLREIFEEFGEVEQINFLREKGCCFVNFTNINHAILAL------DKIKSLP 511

Query: 749 SYQDRYKGLIIGYGKDRCGNV 769
            ++D    L I +GKDRCGN+
Sbjct: 512 EFED----LKINFGKDRCGNI 528

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 92/200 (46%), Gaps = 26/200 (13%)

Query: 572 RTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPI 631
           RTVYLGNI      +++ + VR G+++ +K    K   F++               ++ +
Sbjct: 128 RTVYLGNIPQGLTIKELLDHVRSGVVESVKILPTKLCAFISFIDERGALLFHSDAILKRL 187

Query: 632 VLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFREKY 691
            + G  +K+GWG      +   A     GA+RNVY+         +   DP         
Sbjct: 188 NIRGKDIKIGWGKSNHIDSIVAARITNDGATRNVYIG--------QLNDDPT-------- 231

Query: 692 ELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSYQ 751
            + ++++L +D   FGEI+ I +L +    +V+F +I+ AI +V++ +            
Sbjct: 232 -ITTEQELEKDMQKFGEIDCIKFLSNKGIAFVHFASISVAIYVVQNLS---------KLN 281

Query: 752 DRYKGLIIGYGKDRCGNVNK 771
           ++YK   I YGKDRC  + K
Sbjct: 282 EKYKNKRIFYGKDRCAFITK 301

>NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183
          Length = 680

 Score =  153 bits (386), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 80/201 (39%), Positives = 116/201 (57%), Gaps = 21/201 (10%)

Query: 569 LGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSI 628
           LGNRT+YLGN+    + E+ICNVVRGG+LQ +K    ++VCFVT              S+
Sbjct: 496 LGNRTIYLGNLPKDIRVEEICNVVRGGLLQSVKLLGDRYVCFVTFIDPTAAAQFFAMSSL 555

Query: 629 EPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFR 688
             + +     KVGWG H G L+ ++ALAV+ GASRN+Y+   ++A  DK   +P F E  
Sbjct: 556 HGLTIQKKRCKVGWGKHSGPLSNALALAVSHGASRNIYIGNIDFA-TDKKRDNPIFTE-- 612

Query: 689 EKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHG 748
                   + LR+ FS +GE+EQIN+L + +CC++NF NI++AI  ++            
Sbjct: 613 --------DSLRKMFSMYGEMEQINFLPEKNCCFINFTNISNAILALDKIKS-------- 656

Query: 749 SYQDRYKGLIIGYGKDRCGNV 769
                +K L I +GKDRCGN+
Sbjct: 657 --NPVFKDLKINFGKDRCGNI 675

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 98/232 (42%), Gaps = 41/232 (17%)

Query: 572 RTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPI 631
           RTVYLGNI      +++ + VR G+++ +K    K   F++               ++ +
Sbjct: 222 RTVYLGNIPSDLTVKELLDHVRSGVIEDVKIIPEKLCAFISFLDENSALLFHSDAILKRL 281

Query: 632 VLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVS-LPEYAF---KDKFIKDP----- 682
            ++G  +K+GWG             +  GA+RNV++  L   +F   K K  K P     
Sbjct: 282 NINGKDIKIGWGKSTAVDPMIATRIINDGATRNVFIGQLKTKSFDPNKAKVTKMPPSRNH 341

Query: 683 --------EFQEFREKYELP---------------SKEQLRQDFSNFGEIEQINYLDDGH 719
                   E  E     +                 S  +LR+D ++FG+I+ I  ++D  
Sbjct: 342 DINATISNENDEKENGVDTAHVEGEVEVGEEEEPISDAKLRKDLADFGDIDCIKIVEDKG 401

Query: 720 CCWVNFMNITSAIKLVEDANGADNKKFHGSYQDRYKGLIIGYGKDRCGNVNK 771
             +++F +ITSAIK V + N         S  D Y    I YGKDRC  + K
Sbjct: 402 IAFIHFASITSAIKCVHNLN---------SMNDYYSTKKIFYGKDRCAFITK 444

>TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {ON}
           Anc_6.183 YPL184C
          Length = 584

 Score =  151 bits (382), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 114/201 (56%), Gaps = 21/201 (10%)

Query: 569 LGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSI 628
           LGNRTVYLGN+    K E+ICNVVRGGILQ IK    +HVCFVT              S+
Sbjct: 400 LGNRTVYLGNLPKDVKIEEICNVVRGGILQAIKVLSDRHVCFVTFIDPIAAAQFYAMSSL 459

Query: 629 EPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFR 688
             I +     +VGWG HPG L  +IALAV+ GASRNVY+   ++ ++D   ++P F    
Sbjct: 460 HGITIQKRRCRVGWGKHPGPLPNAIALAVSNGASRNVYIGNIDF-YEDSKRQEPIF---- 514

Query: 689 EKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHG 748
                 + + LR+ F  +GE+EQ+N+L + +C +VN+ NI++AI  ++            
Sbjct: 515 ------TADYLRKIFQEYGEVEQLNFLPEKNCAFVNYTNISNAISAIDKIKS-------- 560

Query: 749 SYQDRYKGLIIGYGKDRCGNV 769
                +K L I +GKDRCG +
Sbjct: 561 --NPLFKNLKINFGKDRCGTI 579

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 99/207 (47%), Gaps = 28/207 (13%)

Query: 572 RTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPI 631
           +TVYLGNI P     ++ + VR G+++ +K    K   F+T               ++ +
Sbjct: 163 KTVYLGNIPPSLTVRELLDHVRSGVVEEVKILPEKTCAFLTFVDESAALLFHSDAILKRL 222

Query: 632 VLHGNVLKVGWGHH-PGDLAQSIALAVTIGASRNVYVSL--PEYAFKDKFIKDPEFQEFR 688
            + G  +K+GWG   P D   + A+A + GA+RNVY+ L   +     +   DP  ++  
Sbjct: 223 HIDGRDIKIGWGKATPVDPLVTTAIA-SDGATRNVYIGLLNTDSDIALQVGADPNDEKIT 281

Query: 689 EKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGA----DNK 744
           E       E+LR D   FGEI+ +  +++    +++F +I SA+K+V +  G     +NK
Sbjct: 282 E-------EKLRSDLGEFGEIDCVKIVEEKGIAFIHFASILSAVKVVANLAGINPYYENK 334

Query: 745 KFHGSYQDRYKGLIIGYGKDRCGNVNK 771
           K +             YGKDRC  + K
Sbjct: 335 KIY-------------YGKDRCAFITK 348

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score =  149 bits (377), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 80/202 (39%), Positives = 113/202 (55%), Gaps = 23/202 (11%)

Query: 569 LGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSI 628
           LGNRTVYLGN+    K E+ICN VR G+LQ +K    +HVCFVT              S+
Sbjct: 406 LGNRTVYLGNLPKGIKIEEICNTVRSGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSL 465

Query: 629 EPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFR 688
             ++L     KVGWG H G L   IALAV+ GASRNVY            I + +F+E  
Sbjct: 466 HGLILQRKRCKVGWGKHSGPLPNLIALAVSNGASRNVY------------IGNIDFEEDS 513

Query: 689 EKYE-LPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFH 747
           ++ E + +++ LR+ F  +GE+EQIN+L   +CC++N+ NI++AI  ++           
Sbjct: 514 KRNERVFTEDNLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAIDKIKS------- 566

Query: 748 GSYQDRYKGLIIGYGKDRCGNV 769
                 +K L I +GKDRCGN+
Sbjct: 567 ---NPYFKDLKINFGKDRCGNI 585

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 100/204 (49%), Gaps = 22/204 (10%)

Query: 572 RTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPI 631
           RTVYLGNI      +++ + VR G+++ +K    K   F++               ++ +
Sbjct: 169 RTVYLGNIPTTLTVKELLDHVRSGVVEDVKILPEKMCAFISFVDDSSALLFHSDAILKRL 228

Query: 632 VLHGNVLKVGWGHHPGDLAQSIALAVTI-GASRNVYVSLPEYAFKDKFIKDPEFQE---F 687
            + G  +K+GWG  P  +   +A  +T  GA+RNVY+         +   D E  E    
Sbjct: 229 NIEGRDIKIGWG-KPTKIDPIVANGITTDGATRNVYIG--------QLYTDAEVAESLNI 279

Query: 688 REKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFH 747
            ++ E+ ++E+L  D   +G+I+ +  + +    +++F +I SAIK+V +   A N+   
Sbjct: 280 PKESEIVTEERLIADLEIYGDIDSVKIVKEKGIAFIHFASILSAIKVVNNL-AASNRY-- 336

Query: 748 GSYQDRYKGLIIGYGKDRCGNVNK 771
             YQ+R     I YGKDRC  + K
Sbjct: 337 --YQNRK----IFYGKDRCAFITK 354

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 652

 Score =  150 bits (379), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 76/201 (37%), Positives = 111/201 (55%), Gaps = 21/201 (10%)

Query: 569 LGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSI 628
           LGNRTVYLGN+    K E+ICN +RGG+LQ+IK    +HVCFVT              S+
Sbjct: 469 LGNRTVYLGNLPKNVKLEEICNAIRGGLLQNIKLLNDRHVCFVTFIDPTAAAQFYAMSSL 528

Query: 629 EPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFR 688
             + +H    K+GWG H G L   IALAV+ GASRN+Y+    +            ++ +
Sbjct: 529 HGLTIHNKRCKIGWGKHSGPLPNPIALAVSRGASRNIYLGNINFE-----------EDAK 577

Query: 689 EKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHG 748
           ++  + +++ LR  F  FG +EQIN+L + +CC++NF NI++AI  ++            
Sbjct: 578 QEESVFAEDTLRAIFEEFGTVEQINFLYEKNCCFINFANISNAILAIDKIKS-------- 629

Query: 749 SYQDRYKGLIIGYGKDRCGNV 769
                +  L I +GKDRCGNV
Sbjct: 630 --NPHFNNLKINFGKDRCGNV 648

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 94/204 (46%), Gaps = 22/204 (10%)

Query: 572 RTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPI 631
           RTVYLGNI      + + + VR G+++ +K    K   FV+               ++ +
Sbjct: 233 RTVYLGNIPATITYKALLDYVRTGVVEEVKILSEKMCAFVSFVDENDALLFHSDAILKRL 292

Query: 632 VLHGNVLKVGWGH-HPGDLAQSIALAVTIGASRNVYVSLPEYAFKD---KFIKDPEFQEF 687
            + G  +K+GWG   P D      +A   GA+RNVY+       KD   K+  DP     
Sbjct: 293 NIDGRDIKIGWGKPQPIDPIVRAGIA-NDGATRNVYIGKLNTN-KDSCEKWGADP----- 345

Query: 688 REKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFH 747
             K  L +KE+L  D S FGEIE I  ++D    +V+F +I +AIK V +          
Sbjct: 346 --KEILVTKEKLYDDLSQFGEIESIKLVEDRGIAFVHFTSIFAAIKAVANI--------- 394

Query: 748 GSYQDRYKGLIIGYGKDRCGNVNK 771
           GS    Y    + YGKDRC  + K
Sbjct: 395 GSIDPYYSNKKVFYGKDRCAFITK 418

>CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184c
          Length = 639

 Score =  149 bits (376), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 82/201 (40%), Positives = 107/201 (53%), Gaps = 21/201 (10%)

Query: 569 LGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSI 628
           LGNRTVYLGN+    K E+ICN VRGG+LQ IK  + +HVCFVT              S+
Sbjct: 455 LGNRTVYLGNLPKGVKIEEICNAVRGGLLQSIKLLDDRHVCFVTFIDPTAAAQFYAMSSL 514

Query: 629 EPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFR 688
               +     KVGWG H G L  ++ALAV+ GASRNVY+   ++   D   + P F E  
Sbjct: 515 YGFTIQRQRCKVGWGKHSGPLPNALALAVSNGASRNVYLGNIDFE-ADSKKEQPIFNE-- 571

Query: 689 EKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHG 748
                     LR  F  +GE+EQIN+L +  CC++NF NI +AI  ++            
Sbjct: 572 --------TALRAIFQEYGEVEQINFLVEKKCCFINFTNINNAIFAMDKIKS-------- 615

Query: 749 SYQDRYKGLIIGYGKDRCGNV 769
                +K L I +GKDRCGNV
Sbjct: 616 --NPHFKSLKINFGKDRCGNV 634

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 95/201 (47%), Gaps = 22/201 (10%)

Query: 572 RTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPI 631
           RTVYLGNI P    +++ + VR G+++  K    K   F++               ++ +
Sbjct: 224 RTVYLGNIPPSLTIKELLDHVRSGVVEEAKILPEKMCAFISFVEESSALLFHSDAILKRL 283

Query: 632 VLHGNVLKVGWGHHPGDLAQSIA-LAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFREK 690
            +    +KVGWG  P  L  SIA   +  GA+RNVY+         K  K+P        
Sbjct: 284 NIDNRDIKVGWGK-PTVLDPSIASRIINDGATRNVYIGQGNNDRSSKENKEPL------- 335

Query: 691 YELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSY 750
               ++E+LR+D   +GEI+ I  + +    +V+F +I +AIK+V     A    F   Y
Sbjct: 336 ----TEEKLREDLKEYGEIDSIKIIPEKDIAFVHFSSIATAIKVVSTL--AQKNPF---Y 386

Query: 751 QDRYKGLIIGYGKDRCGNVNK 771
           Q++     I YGKDRC  + K
Sbjct: 387 QEKK----IFYGKDRCAFITK 403

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
           YPL184C
          Length = 593

 Score =  148 bits (373), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 84/201 (41%), Positives = 110/201 (54%), Gaps = 21/201 (10%)

Query: 569 LGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSI 628
           LGNRTVYLGN+    + EDICN +R G+LQ+IK    +HVCFVT              SI
Sbjct: 412 LGNRTVYLGNLPNDIRIEDICNTIRCGLLQNIKLLSDRHVCFVTFIDPVSAAQFYAMSSI 471

Query: 629 EPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFR 688
              VL     KVGWG H G L+  + LAV+ GASRNVY+   ++               R
Sbjct: 472 YGFVLQKKRCKVGWGKHSGPLSNPLTLAVSNGASRNVYIGNIDFTAD---------GTKR 522

Query: 689 EKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHG 748
           E+Y   S   LR+ FS +GE+EQIN+L   +CC+VN+ NI +AI  ++     +N  F  
Sbjct: 523 ERYFTDS--NLRRIFSEYGEVEQINFLYSKNCCFVNYTNINNAISAIDKI--KNNPTF-- 576

Query: 749 SYQDRYKGLIIGYGKDRCGNV 769
                 K L I +GKDRCGN+
Sbjct: 577 ------KNLKINFGKDRCGNI 591

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 101/203 (49%), Gaps = 13/203 (6%)

Query: 572 RTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPI 631
           RTVYLGNI P     D+ + VR G+++ +K    K   F++               ++ +
Sbjct: 168 RTVYLGNIPPTLTASDLLDHVRSGVIEEVKILPEKMCAFISFLDENSSLLFHSDAILKRL 227

Query: 632 VLHGNVLKVGWGHHPGDLAQSIALAV-TIGASRNVYVS-LPEYAFKDKFIKDPEFQEFRE 689
            + G  +K+GWG  P  L+  IA +V T GA+RN+++  L       +   D       +
Sbjct: 228 NIDGKDIKIGWG-KPSPLSPIIATSVATDGATRNIFIGQLNTTDHNKQKDNDATIYHGSD 286

Query: 690 KYE-LPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHG 748
            +E + ++E+LR+D   +G+I+ I    +    +V+F +I SAIK+V + + ++      
Sbjct: 287 DFEDIMTEEKLRKDLEEYGDIDCIKIFKEKGFAFVHFTSILSAIKVVNNLSNSN------ 340

Query: 749 SYQDRYKGLIIGYGKDRCGNVNK 771
            Y  + K   I YGKDRC  + K
Sbjct: 341 PYYSKKK---IYYGKDRCAFITK 360

>Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C
           (REAL)
          Length = 625

 Score =  144 bits (363), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 80/201 (39%), Positives = 108/201 (53%), Gaps = 21/201 (10%)

Query: 569 LGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSI 628
           LGNRTVYLG++    K E+ICN VRGG+LQ IK    ++VCFVT              S+
Sbjct: 441 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 500

Query: 629 EPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFR 688
               +     KVGWG H G L  ++ALAV+ GASRNVYV          F+ D    E  
Sbjct: 501 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDFVSDSLRDE-- 552

Query: 689 EKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHG 748
               + ++  LR  F  +GE+EQIN+L + +CC+VN+ NI++AI  ++            
Sbjct: 553 ---RIFTESNLRHVFQQYGEVEQINFLPEKNCCFVNYTNISNAILALDKIKS-------- 601

Query: 749 SYQDRYKGLIIGYGKDRCGNV 769
                +K L I +GKDRCGNV
Sbjct: 602 --NPYFKDLKINFGKDRCGNV 620

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 92/201 (45%), Gaps = 26/201 (12%)

Query: 572 RTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPI 631
           RTVYLGN+ P    +++ + VR G+++ +K    K   F++               ++ +
Sbjct: 214 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIISEKMCAFISFVDESAALLFHSDAILKRL 273

Query: 632 VLHGNVLKVGWGHHPGDLAQSIALAV-TIGASRNVYVSLPEYAFKDKFIKDPEFQEFREK 690
            +    +K+GWG  P  +   +A  + T GA+RNVY+         +   D E       
Sbjct: 274 NIGDRDIKIGWG-KPTRIDPIVAARISTDGATRNVYIG--------RMTIDGEESHL--- 321

Query: 691 YELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSY 750
               S+EQLR D   +GEI+ I  + +    +++F +I +AIK+V       N      Y
Sbjct: 322 ----SEEQLRIDLKEYGEIDCIKVIKEKGIAFIHFASILNAIKVVT------NLPIRNPY 371

Query: 751 QDRYKGLIIGYGKDRCGNVNK 771
              Y+   I YGKDRC  + K
Sbjct: 372 ---YQNKRIFYGKDRCAFITK 389

>Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {ON}
           YPL184C (REAL)
          Length = 596

 Score =  144 bits (362), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 80/201 (39%), Positives = 108/201 (53%), Gaps = 21/201 (10%)

Query: 569 LGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSI 628
           LGNRTVYLG++    K E+ICN VRGG+LQ IK    ++VCFVT              S+
Sbjct: 412 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 471

Query: 629 EPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFR 688
               +     KVGWG H G L  ++ALAV+ GASRNVYV   ++A  D    +  F E  
Sbjct: 472 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFA-SDSLNDERIFTE-- 528

Query: 689 EKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHG 748
                     LR  F  +GE+EQIN+L + +CC++N+ NI++AI  ++            
Sbjct: 529 --------NNLRSIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKS-------- 572

Query: 749 SYQDRYKGLIIGYGKDRCGNV 769
                +K L I +GKDRCGNV
Sbjct: 573 --NPYFKDLKINFGKDRCGNV 591

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 92/201 (45%), Gaps = 26/201 (12%)

Query: 572 RTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPI 631
           RTVYLGN+ P    +++ + VR G+++ +K    K   F++               ++ +
Sbjct: 185 RTVYLGNVPPHLTVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRL 244

Query: 632 VLHGNVLKVGWGHHPGDLAQSIALAVTI-GASRNVYVSLPEYAFKDKFIKDPEFQEFREK 690
            +    +K+GWG  P  +   +A  +T  GA+RNVY+       ++  +           
Sbjct: 245 NIGDRDIKIGWG-KPTRIDPIVAARITTDGATRNVYIGRMTVEGEESHL----------- 292

Query: 691 YELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSY 750
               S+EQLR D   +GEI+ I  + +    +++F +I +AIK+V       N      Y
Sbjct: 293 ----SEEQLRADLQEYGEIDCIKIIKEKGIAFIHFASILNAIKVVT------NLPIRNPY 342

Query: 751 QDRYKGLIIGYGKDRCGNVNK 771
              Y+   I YGKDRC  + K
Sbjct: 343 ---YQNKRIFYGKDRCAFITK 360

>YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON}
           MRN1RNA-binding protein proposed to be involved in
           translational regulation; binds specific categories of
           mRNAs, including those that contain upstream open
           reading frames (uORFs) and internal ribosome entry sites
           (IRES)
          Length = 612

 Score =  143 bits (360), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 108/201 (53%), Gaps = 21/201 (10%)

Query: 569 LGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSI 628
           LGNRTVYLG++    K E+ICN VRGG+LQ IK    ++VCFVT              S+
Sbjct: 428 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 487

Query: 629 EPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFR 688
               +     KVGWG H G L  ++ALAV+ GASRNVYV          F+ D    E  
Sbjct: 488 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDFVGDSLRDE-- 539

Query: 689 EKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHG 748
               + ++  LR  F  +GE+EQIN+L + +CC++N+ NI++AI  ++            
Sbjct: 540 ---RVFTESNLRHIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKS-------- 588

Query: 749 SYQDRYKGLIIGYGKDRCGNV 769
                +K L I +GKDRCGNV
Sbjct: 589 --NPYFKDLKINFGKDRCGNV 607

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 92/201 (45%), Gaps = 26/201 (12%)

Query: 572 RTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPI 631
           RTVYLGN+ P    +++ + VR G+++ +K    K   FV+               ++ +
Sbjct: 201 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFVSFIDESAALLFHSDAILKRL 260

Query: 632 VLHGNVLKVGWGHHPGDLAQSIALAV-TIGASRNVYVSLPEYAFKDKFIKDPEFQEFREK 690
            +    +K+GWG  P  +   +A  + T GA+RNVY+       ++  +           
Sbjct: 261 NIGDRDIKIGWG-KPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHL----------- 308

Query: 691 YELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSY 750
               S+EQLR D   +GEI+ I  + +    +++F +I +AIK+V       N      Y
Sbjct: 309 ----SEEQLRVDLEEYGEIDCIKIIKEKGIAFIHFASILNAIKVVT------NLPIRNPY 358

Query: 751 QDRYKGLIIGYGKDRCGNVNK 771
              Y+   I YGKDRC  + K
Sbjct: 359 ---YQNKRIFYGKDRCAFITK 376

>Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {ON}
           YPL184C (REAL)
          Length = 614

 Score =  142 bits (359), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 80/201 (39%), Positives = 108/201 (53%), Gaps = 21/201 (10%)

Query: 569 LGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSI 628
           LGNRTVYLG++    K E+ICN VRGG+LQ IK    ++VCFVT              S+
Sbjct: 430 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 489

Query: 629 EPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFR 688
               +     KVGWG H G L  ++ALAV+ GASRNVYV   +Y   D    +  F E  
Sbjct: 490 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDYV-SDSVRDERIFTE-- 546

Query: 689 EKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHG 748
                    +LR  F  +GE+EQIN+L + +CC++N+ NI++AI  ++            
Sbjct: 547 --------GKLRGIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKS-------- 590

Query: 749 SYQDRYKGLIIGYGKDRCGNV 769
                +K L I +GKDRCGNV
Sbjct: 591 --NPYFKDLKINFGKDRCGNV 609

 Score = 75.1 bits (183), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 91/201 (45%), Gaps = 26/201 (12%)

Query: 572 RTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTXXXXXXXXXXXXXXSIEPI 631
           RTVYLGN+ P    +++ + VR G+++ +K    K   F++               ++ +
Sbjct: 203 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRL 262

Query: 632 VLHGNVLKVGWGHHPGDLAQSIALAV-TIGASRNVYVSLPEYAFKDKFIKDPEFQEFREK 690
            +    +K+GWG  P  +   +A  + T GA+RNVY+       ++  +           
Sbjct: 263 NIGDRDIKIGWG-KPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHL----------- 310

Query: 691 YELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSY 750
               S EQLR D   +GEI+ I  + +    +++F +I +AIK+V       N      Y
Sbjct: 311 ----SGEQLRADLEEYGEIDCIKIIKEKGVAFIHFASILNAIKVVT------NLPIRNLY 360

Query: 751 QDRYKGLIIGYGKDRCGNVNK 771
              Y+   I YGKDRC  + K
Sbjct: 361 ---YQNKRIFYGKDRCAFITK 378

>ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR242C
           (SSP2)
          Length = 376

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 40/72 (55%), Gaps = 11/72 (15%)

Query: 697 EQLRQDFSNFGEIEQIN-YLDDGHCCWVNFMNITSAIKLVE---DANGADNKKFHGSYQD 752
           ++L++DFS FG I  I+  +    C  +NF +I SA+  ++   +AN   N+K+  S+  
Sbjct: 303 QELKKDFSQFGNILDISPMISRKLCVQINFYDIKSAMDALQSYKNANSPLNRKYAESW-- 360

Query: 753 RYKGLIIGYGKD 764
                 IGYGKD
Sbjct: 361 -----TIGYGKD 367

>KAFR0A03830 Chr1 complement(779143..780267) [1125 bp, 374 aa] {ON}
           Anc_8.670 YOR242C
          Length = 374

 Score = 39.7 bits (91), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 5/65 (7%)

Query: 701 QDFSNFGEIEQIN-YLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSYQDRYKGLII 759
           +DF  FG I+++   +    C  VN+ NI SA+K +E      N + H  Y   YK   I
Sbjct: 305 EDFGQFGRIQEVTPIISRKLCVAVNYYNILSALKAIESYEDP-NSELHRKY---YKSWAI 360

Query: 760 GYGKD 764
            +GKD
Sbjct: 361 WFGKD 365

>ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {ON}
           similar to uniprot|Q96US5 Saccharomyces cerevisiae
           YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 389

 Score = 39.3 bits (90), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 5/68 (7%)

Query: 698 QLRQDFSNFGEIEQIN-YLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSYQDRYKG 756
           +++QDF  FGEI +I   +    C  +NF N+ SA+K +++     N   H +Y   +  
Sbjct: 317 EIKQDFGTFGEILEITPVVSRKLCISINFFNMESAMKAMKEYENP-NSDLHKAY---FNN 372

Query: 757 LIIGYGKD 764
             I YGKD
Sbjct: 373 WAIWYGKD 380

>NDAI0E01190 Chr5 (237093..238169) [1077 bp, 358 aa] {ON} Anc_8.670
           YOR242C
          Length = 358

 Score = 38.1 bits (87), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 5/69 (7%)

Query: 697 EQLRQDFSNFGEIEQINYLDDGH-CCWVNFMNITSAIKLVEDANGADNKKFHGSYQDRYK 755
           +++R DF  FGEI  I+ L     C ++ F +I SA++++E A    + + H  Y +++ 
Sbjct: 285 KRIRSDFECFGEIVDISPLISRRPCLYIQFYDIYSAVRVLE-AYEDRHSRIHQQYFEKWS 343

Query: 756 GLIIGYGKD 764
              I YGKD
Sbjct: 344 ---IYYGKD 349

>Smik_15.426 Chr15 complement(738453..739568) [1116 bp, 371 aa] {ON}
           YOR242C (REAL)
          Length = 371

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 38/72 (52%), Gaps = 13/72 (18%)

Query: 698 QLRQDFSNFGEIEQIN-YLDDGHCCWVNFMNITSAIKLVED----ANGADNKKFHGSYQD 752
           +L +DF NFGEI +I   +    C  + F +I+SA++ +E+     +G +NK F      
Sbjct: 299 ELEKDFQNFGEILEITPIVSRKLCVSIFFYDISSAMRAMEEYEQKGSGLNNKYF------ 352

Query: 753 RYKGLIIGYGKD 764
             K   I YGKD
Sbjct: 353 --KTWTIWYGKD 362

>Kwal_26.8763 s26 complement(934672..935952) [1281 bp, 426 aa] {ON}
           YOR242C (SSP2) - involved in sporulation [contig 67]
           FULL
          Length = 426

 Score = 36.2 bits (82), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 11/72 (15%)

Query: 697 EQLRQDFSNFGEIEQIN-YLDDGHCCWVNFMNITSAIKLVED---ANGADNKKFHGSYQD 752
           + LRQDF NFG I +I+  +    C  V F +++S+I  +E     N   NKK+   +  
Sbjct: 351 KDLRQDFENFGNIVEISPMISRKLCLCVTFYDVSSSIGALESFEKPNSYLNKKYGRDWS- 409

Query: 753 RYKGLIIGYGKD 764
                 I YG+D
Sbjct: 410 ------IAYGRD 415

>YOR242C Chr15 complement(788742..789857) [1116 bp, 371 aa] {ON}
           SSP2Sporulation specific protein that localizes to the
           spore wall; required for sporulation at a point after
           meiosis II and during spore wall formation; SSP2
           expression is induced midway in meiosis
          Length = 371

 Score = 35.8 bits (81), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 5/69 (7%)

Query: 697 EQLRQDFSNFGEIEQIN-YLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSYQDRYK 755
           ++L +DF NFGE+ +I   +    C  + F +I+SA++ +E+      +K    Y   +K
Sbjct: 298 QELEKDFQNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEEY----EQKGSYLYNKYFK 353

Query: 756 GLIIGYGKD 764
              I YGKD
Sbjct: 354 TWTIWYGKD 362

>Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON}
           YOR242C (REAL)
          Length = 370

 Score = 35.8 bits (81), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 5/69 (7%)

Query: 697 EQLRQDFSNFGEIEQIN-YLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSYQDRYK 755
           ++L +DF NFGE+ +I   +    C  + F +I+SA++ +E+      +K    Y   +K
Sbjct: 297 QELEKDFQNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEEY----EQKGSYLYNKYFK 352

Query: 756 GLIIGYGKD 764
              I YGKD
Sbjct: 353 TWTIWYGKD 361

>KLTH0D11088g Chr4 complement(906439..907707) [1269 bp, 422 aa] {ON}
           some similarities with uniprot|Q96US5 Saccharomyces
           cerevisiae YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 422

 Score = 35.4 bits (80), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 5/69 (7%)

Query: 697 EQLRQDFSNFGEIEQIN-YLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSYQDRYK 755
           + LR+DF  FGEI +I+  +    C  V+F ++ SAI  +E + G  +   H  Y    +
Sbjct: 348 KDLRKDFEQFGEISEISPMISRKLCVSVSFYDVRSAINALE-SFGEPDSFMHKKYN---R 403

Query: 756 GLIIGYGKD 764
              + YG+D
Sbjct: 404 DWTMAYGRD 412

>Skud_15.409 Chr15 complement(727725..728840) [1116 bp, 371 aa] {ON}
           YOR242C (REAL)
          Length = 371

 Score = 35.0 bits (79), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 9/71 (12%)

Query: 697 EQLRQDFSNFGEIEQIN-YLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSYQDR-- 753
           ++L +DF NFGE+ +I   +    C  + F +I+SA++ +E+          GSY +   
Sbjct: 298 QELEKDFRNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEEYGQ------KGSYINTKY 351

Query: 754 YKGLIIGYGKD 764
           +K   I YGKD
Sbjct: 352 FKAWTIWYGKD 362

>KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.40
           YFL029C
          Length = 363

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 5/65 (7%)

Query: 154 PPQLNAPPMTHKRKTHLRHETNSQPSSEPYVINFKILPKGDDEYMTRSLLLSNVNASIKL 213
           P   NAPP  HKR+  +  + N    S+ Y++        DDE      LL  V   + L
Sbjct: 36  PVDFNAPPHNHKRELKILQDFNKIEESDKYIVKLLDYKLVDDEL---QFLLPFV--PLTL 90

Query: 214 HDFIT 218
           HDF++
Sbjct: 91  HDFMS 95

>KLLA0F11275g Chr6 (1038770..1039927) [1158 bp, 385 aa] {ON} weakly
           similar to uniprot|Q96US5 Saccharomyces cerevisiae
           YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 385

 Score = 32.3 bits (72), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 58/121 (47%), Gaps = 10/121 (8%)

Query: 645 HPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLRQDFS 704
           HP D  + I    + GA R +   + +Y+ K K I   E       Y+L   +Q+  DF+
Sbjct: 265 HP-DFCKDIQNFDSTGARRCLI--MKKYSRKHKSIS-TELNSKSHIYDLDI-QQIIDDFN 319

Query: 705 NFGEIEQIN-YLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSYQDRYKGLIIGYGK 763
            FG++ +++  +    C  ++F +I SAI+ +     + N   +G Y   +K   I YGK
Sbjct: 320 QFGQVLEVSPLISRKICLQISFHDIRSAIEAMRSYETS-NSYINGKY---FKDWSIWYGK 375

Query: 764 D 764
           D
Sbjct: 376 D 376

>TPHA0D01210 Chr4 complement(253331..254425) [1095 bp, 364 aa] {ON}
           Anc_8.670 YOR242C
          Length = 364

 Score = 32.0 bits (71), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 36/69 (52%), Gaps = 5/69 (7%)

Query: 697 EQLRQDFSNFGEIEQIN-YLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSYQDRYK 755
           E++R+DF  FG I  I   +    C  +++ NI +A+  ++ A      +FH  Y + + 
Sbjct: 291 EEVRKDFFQFGNIVDITPIVSRKVCLSISYYNIKAAMDAMK-AYDDPYSEFHKKYSEEW- 348

Query: 756 GLIIGYGKD 764
             ++ YGKD
Sbjct: 349 --VVWYGKD 355

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 106,152,310
Number of extensions: 4353415
Number of successful extensions: 11315
Number of sequences better than 10.0: 82
Number of HSP's gapped: 11493
Number of HSP's successfully gapped: 186
Length of query: 1082
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 962
Effective length of database: 39,721,479
Effective search space: 38212062798
Effective search space used: 38212062798
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 71 (32.0 bits)