Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0D01342g8.845ON1270127061640.0
KLTH0C03762g8.845ON1206129830100.0
Kwal_27.102328.845ON1209130929020.0
ABL121C8.845ON1285137027200.0
KLLA0D01452g8.845ON144594726250.0
TDEL0B005308.845ON1301117226240.0
ZYRO0G14278g8.845ON1250114425030.0
KAFR0B039508.845ON1246100119250.0
Suva_13.4688.845ON1418107618450.0
YMR280C (CAT8)8.845ON1433111118310.0
Smik_13.4938.845ON1433108618060.0
NCAS0C003908.845ON116492717820.0
Skud_13.4528.845ON143295318020.0
KNAG0J002508.845ON123793117500.0
NDAI0K003908.845ON1495107017160.0
Ecym_46168.845ON157771817200.0
CAGL0M03025g8.845ON125496416000.0
Kpol_1016.201.277ON1086842241e-17
KAFR0A014801.277ON725582169e-17
TPHA0I028201.277ON1044672114e-16
AFR096W1.277ON852482106e-16
KLLA0F14322g1.277ON717542079e-16
Skud_10.1251.277ON833682071e-15
Smik_10.1531.277ON829852071e-15
ZYRO0G15136g1.277ON1027542062e-15
KLTH0D03564g1.277ON862652042e-15
Ecym_63401.277ON952482043e-15
YJL089W (SIP4)1.277ON829842043e-15
SAKL0D05654g1.277ON919482034e-15
Suva_6.1611.277ON832642008e-15
Kwal_26.7397singletonOFF201481869e-15
TDEL0D014501.277ON945481954e-14
NDAI0G055301.277ON1186541936e-14
CAGL0L03377g1.277ON1209481928e-14
KNAG0B018401.277ON1072491873e-13
TBLA0D054201.277ON757481802e-12
NCAS0A094101.277ON932451587e-10
TPHA0F013802.231ON8902261345e-07
TBLA0G026102.231ON1000741321e-06
TDEL0C056801.128ON6911651311e-06
KLLA0E13993gsingletonON678441292e-06
KLLA0C10923g5.235ON775541292e-06
NCAS0D025405.235ON890651283e-06
TDEL0C044802.231ON8522691231e-05
NDAI0F012206.279ON960451231e-05
SAKL0C02024gsingletonON898481212e-05
KLLA0F04609g2.231ON916331212e-05
SAKL0G11902g5.235ON906481212e-05
YPL248C (GAL4)6.279ON881471212e-05
KNAG0D006906.279ON875511202e-05
Smik_6.4526.279ON878471202e-05
Kpol_1018.306.279ON881511202e-05
NDAI0A087907.17ON1059341202e-05
Kpol_495.213.109ON1085711202e-05
KAFR0J017102.231ON848331202e-05
NDAI0B038502.231ON930451193e-05
NCAS0B065502.231ON906331193e-05
Smik_9.392.231ON1012381193e-05
NCAS0D041906.279ON890451193e-05
ZYRO0E08272g6.279ON794471183e-05
Skud_9.372.231ON9542231184e-05
Suva_9.592.231ON926381184e-05
YIL130W (ASG1)2.231ON964331184e-05
KAFR0F014901.128ON6581821174e-05
NCAS0G011006.279ON935451175e-05
KNAG0E017602.231ON902371175e-05
Kpol_1039.112.231ON9921781175e-05
Ecym_7440na 1ON898421175e-05
KLTH0G09108g2.231ON782331175e-05
Kwal_23.47542.231ON812331176e-05
SAKL0E08998g2.231ON823331176e-05
CAGL0G08844g2.231ON847411166e-05
KNAG0B051205.235ON888441166e-05
SAKL0A02860g6.279ON745451167e-05
YGL013C (PDR1)4.113ON1068741167e-05
KLTH0D07260g2.547ON979501158e-05
KLLA0C03201g1.128ON6503281159e-05
Smik_7.2774.113ON1069701151e-04
KNAG0E002107.17ON948511141e-04
KAFR0J006905.235ON864441141e-04
CAGL0I07755g3.109ON1053711141e-04
NDAI0I023505.235ON889441131e-04
Suva_16.596.279ON895451131e-04
KLTH0D02222gna 2ON847501131e-04
TPHA0H019806.279ON993471132e-04
TDEL0E039105.235ON862441132e-04
TBLA0G018006.279ON1154451132e-04
Suva_10.945.235ON906441122e-04
Kwal_23.29055.235ON881481122e-04
KLTH0E14454gna 1ON902451122e-04
KLTH0G07898g5.235ON866481122e-04
Smik_1.137.17ON1046851122e-04
ZYRO0A10956g5.235ON855441112e-04
TDEL0E00160singletonON631471103e-04
TPHA0N002307.17ON1232331113e-04
Suva_15.773.109ON1029621113e-04
TPHA0A045403.109ON1178761113e-04
Smik_12.775.235ON903781103e-04
NDAI0I007406.279ON1033471103e-04
YJL206C1.128ON7582491103e-04
KLLA0C18953gna 3ON7032081103e-04
ZYRO0E06270g2.565ON912461104e-04
SAKL0C03938g1.128ON780331094e-04
Smik_2.438na 4ON469421084e-04
KLTH0H16170gna 5ON619331094e-04
SAKL0A09856g2.547ON1020691094e-04
CAGL0M12298g7.17ON994461094e-04
Skud_10.101.128ON8332451094e-04
KAFR0C049807.17ON951411095e-04
KAFR0F010406.279ON834471085e-04
Ecym_31126.75ON11442091085e-04
YBR297W (MAL33)na 4ON468411075e-04
KAFR0F034104.113ON995371086e-04
ADR403C7.17ON970671086e-04
Ecym_53972.231ON826371086e-04
SAKL0B06732gna 1ON878451086e-04
YLR014C (PPR1)5.235ON904441086e-04
AER370W2.231ON801331086e-04
ACL093C2.651ON10104251086e-04
Skud_1.107.17ON1040851086e-04
TBLA0D006307.389ON1077511086e-04
KLTH0G15180g6.75ON10962151087e-04
Smik_18.8singletonON775381077e-04
Suva_6.2851.128ON7862441077e-04
KLLA0A02585gna 6ON370371068e-04
Smik_11.2402.654ON9762551078e-04
CAGL0J07150g7.17ON1022571078e-04
TBLA0A012101.380ON1422301078e-04
TBLA0E007007.17ON1274761078e-04
CAGL0F07909g3.109ON1049701078e-04
YAL051W (OAF1)7.17ON1047851060.001
KLTH0B00352gsingletonON934431060.001
TDEL0H043407.17ON989481060.001
Skud_12.825.235ON899441060.001
TPHA0N004407.56ON757731060.001
NDAI0B016802.547ON924901060.001
TPHA0A06090singletonON847401060.001
NCAS0A088401.380ON1478701060.001
YOL089C (HAL9)3.109ON1030821060.001
NDAI0D00900singletonON865331050.001
AER183Cna 1ON879421050.001
TBLA0C040504.113ON1207361060.001
KLTH0E00440gsingletonON6881871050.001
KLTH0B10076gsingletonON6881871050.001
KLTH0H02684g6.279ON749451050.001
KAFR0I002307.17ON1045331050.001
SAKL0A00704gna 7ON718581040.001
KLTH0H11704gna 8ON11853661050.001
Suva_1.147.17ON1045461050.001
KLTH0E03256gsingletonON6741501040.002
SAKL0H24860gna 9ON971651040.002
CAGL0B03421g1.380ON1355501040.002
CAGL0A00451g4.113ON1107421040.002
SAKL0D14520g7.17ON983331040.002
SAKL0B04620gna 6ON362371020.002
Suva_8.3877.56ON759831040.002
Smik_11.2102.547ON1169731040.002
KLLA0D12672g6.279ON865451040.002
NDAI0F00110singletonON508331030.002
Kpol_538.427.17ON1088421040.002
Kwal_34.15751na 5ON628411030.002
NCAS0I002707.17ON944341030.002
ZYRO0C18150g1.128ON571381030.002
Skud_15.546na 10ON542461030.002
SAKL0C09944g3.109ON1061611030.002
ZYRO0E05412g1.380ON1244481030.002
KLLA0F22990g1.380ON1253481030.002
Suva_8.436na 10ON545521020.002
ZYRO0C00726g7.17ON1035461030.002
KLLA0F09559gsingletonON658791030.002
Skud_11.1902.547ON1171731030.002
SAKL0H00682gna 11ON922461030.002
SAKL0D01100g4.113ON940421030.003
SAKL0D00264g8.879ON848291020.003
Skud_15.643.109ON1032591030.003
Ecym_50177.17ON978331020.003
YKL015W (PUT3)2.654ON9791641020.003
KAFR0C039002.654ON8182391020.003
ACL058Wna 9ON817871010.003
TBLA0G00490singletonON918651020.003
KNAG0I005601.128ON6631871010.003
TBLA0C062306.60ON795331010.004
Smik_15.561na 10ON546471010.004
Suva_11.2132.654ON9852531010.004
Skud_2.427na 4ON468381000.004
Kwal_26.81092.547ON970501010.004
NCAS0A035804.113ON1113371010.004
TBLA0A007302.654ON10371741010.004
Smik_10.251.128ON7722291010.004
ADR404Cna 12ON875461010.004
KLLA0A09119g4.113ON1082691010.004
YOR162C (YRR1)6.60ON810771010.004
YOR380W (RDR1)na 10ON546371000.004
Suva_7.2684.113ON1000701010.004
SAKL0D14542gna 12ON946331010.004
TDEL0D051503.109ON996471000.005
Skud_7.2744.113ON1080381000.005
KAFR0B014502.547ON1088761000.005
Kwal_23.6537na 10ON552511000.005
TBLA0G011308.879ON1132341000.005
Suva_13.1862.565ON894611000.005
NDAI0H019907.17ON1161331000.005
Kpol_1008.137.512ON902771000.005
Ecym_2522na 7ON926441000.005
TBLA0A058601.128aON810681000.005
KAFR0C03730singletonON791501000.005
KNAG0E041507.17ON1136461000.006
Smik_17.27singletonON68833990.006
KLLA0C14212gna 11ON1040361000.006
KLLA0F02750g3.109ON1148611000.006
TPHA0F025406.60ON79347990.006
TBLA0A097606.75ON1530431000.006
Skud_15.5327.17ON100047990.006
NCAS0D04860singletonON70139990.006
CAGL0K05841g1.380ON137230990.006
KAFR0A031807.512ON84681990.007
YOR363C (PIP2)7.17ON99647990.007
NCAS0C002208.879ON83929990.007
CAGL0G09757g6.75ON1423234990.007
NCAS0A076107.17ON102273990.007
Kpol_260.25.59ON75660980.008
TPHA0G003807.512ON87376980.008
NCAS0A03070singletonON65633980.008
KAFR0I020301.380ON123330990.008
KLLA0A10329gna 13ON63939980.008
Smik_13.1832.565ON91146980.009
KNAG0I014501.380ON147630980.009
Kpol_467.11.380ON128930980.009
AFL160C6.279ON64847970.009
TPHA0H012405.59ON87739980.009
Ecym_27321.380ON119830980.010
NDAI0G052601.380ON158130980.010
TDEL0D00260singletonON647214970.010
AGR280C6.75ON1106293980.010
KLLA0F25630g2.547ON100772980.010
Smik_12.3576.75ON1288217980.011
ZYRO0G22550gsingletonON72437970.011
CAGL0F09229gna 14ON83533970.011
Smik_12.3271.380ON150380970.012
KNAG0A025508.423ON73038970.012
TDEL0G040906.61ON74346970.012
ZYRO0E05676g2.547ON106662970.012
YKL038W (RGT1)2.547ON117064970.012
KNAG0A02300singletonON72931970.012
KNAG0A071002.547ON128687970.012
Skud_3.181singletonON83150970.012
Ecym_8404na 9ON88568970.012
TBLA0G005106.60ON93537970.012
NCAS0C027308.423ON77539970.012
NDAI0D035504.113ON111842970.013
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0D01342g
         (1270 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} simil...  2378   0.0  
KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} simil...  1164   0.0  
Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR28...  1122   0.0  
ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON} ...  1052   0.0  
KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} simil...  1015   0.0  
TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.84...  1015   0.0  
ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa...   968   0.0  
KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {...   746   0.0  
Suva_13.468 Chr13 complement(809712..812654,812694..814007) [425...   715   0.0  
YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}...   709   0.0  
Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] ...   700   0.0  
NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845     691   0.0  
Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa] ...   698   0.0  
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...   678   0.0  
NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845    665   0.0  
Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {...   667   0.0  
CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]...   620   0.0  
Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON} (51828...    91   1e-17
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    88   9e-17
TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {...    86   4e-16
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    86   6e-16
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    84   9e-16
Skud_10.125 Chr10 (233921..236422) [2502 bp, 833 aa] {ON} YJL089...    84   1e-15
Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089...    84   1e-15
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    84   2e-15
KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly...    83   2e-15
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    83   3e-15
YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zi...    83   3e-15
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    83   4e-15
Suva_6.161 Chr6 complement(283370..284500,284547..284764,284948....    82   8e-15
Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OF...    76   9e-15
TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.2...    80   4e-14
NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON}            79   6e-14
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    79   8e-14
KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1....    77   3e-13
TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa] ...    74   2e-12
NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa] ...    65   7e-10
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    56   5e-07
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    55   1e-06
TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa] ...    55   1e-06
KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]...    54   2e-06
KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {...    54   2e-06
NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {O...    54   3e-06
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    52   1e-05
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    52   1e-05
SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {...    51   2e-05
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    51   2e-05
SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} simi...    51   2e-05
YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}  G...    51   2e-05
KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.2...    51   2e-05
Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C ...    51   2e-05
Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 b...    51   2e-05
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    51   2e-05
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    51   2e-05
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    51   2e-05
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    50   3e-05
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    50   3e-05
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    50   3e-05
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     50   3e-05
ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} simila...    50   3e-05
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    50   4e-05
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    50   4e-05
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    50   4e-05
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    50   4e-05
NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {O...    50   5e-05
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    50   5e-05
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    50   5e-05
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    50   5e-05
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    50   5e-05
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    50   6e-05
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    50   6e-05
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    49   6e-05
KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON}               49   6e-05
SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {...    49   7e-05
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    49   7e-05
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    49   8e-05
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    49   9e-05
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    49   1e-04
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    49   1e-04
KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5....    49   1e-04
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    49   1e-04
NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235     48   1e-04
Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}...    48   1e-04
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    48   1e-04
TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.2...    48   2e-04
TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.2...    48   2e-04
TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {...    48   2e-04
Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {O...    48   2e-04
Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C (...    48   2e-04
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    48   2e-04
KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} simila...    48   2e-04
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    48   2e-04
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    47   2e-04
TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON}                 47   3e-04
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    47   3e-04
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    47   3e-04
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    47   3e-04
Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {O...    47   3e-04
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    47   3e-04
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    47   3e-04
KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some...    47   3e-04
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    47   4e-04
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    47   4e-04
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    46   4e-04
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    47   4e-04
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    47   4e-04
CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa...    47   4e-04
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    47   4e-04
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    47   5e-04
KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {O...    46   5e-04
Ecym_3112 Chr3 (203876..207310) [3435 bp, 1144 aa] {ON} similar ...    46   5e-04
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    46   5e-04
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    46   6e-04
ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}...    46   6e-04
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    46   6e-04
SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {...    46   6e-04
YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON} ...    46   6e-04
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    46   6e-04
ACL093C Chr3 complement(178239..181271) [3033 bp, 1010 aa] {ON} ...    46   6e-04
Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W (R...    46   6e-04
TBLA0D00630 Chr4 complement(164651..167884) [3234 bp, 1077 aa] {...    46   6e-04
KLTH0G15180g Chr7 (1326581..1329871) [3291 bp, 1096 aa] {ON} sim...    46   7e-04
Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W (R...    46   7e-04
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    46   7e-04
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    45   8e-04
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    46   8e-04
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    46   8e-04
TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1....    46   8e-04
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    46   8e-04
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    46   8e-04
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    45   0.001
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    45   0.001
TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {O...    45   0.001
Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {O...    45   0.001
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    45   0.001
NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON} Anc_2.547     45   0.001
TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa] ...    45   0.001
NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON} Anc_...    45   0.001
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    45   0.001
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               45   0.001
AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON} N...    45   0.001
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    45   0.001
KLTH0E00440g Chr5 complement(42945..45011) [2067 bp, 688 aa] {ON...    45   0.001
KLTH0B10076g Chr2 (841024..843090) [2067 bp, 688 aa] {ON} some s...    45   0.001
KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {...    45   0.001
KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17...    45   0.001
SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON...    45   0.001
KLTH0H11704g Chr8 complement(1003625..1007182) [3558 bp, 1185 aa...    45   0.001
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    45   0.001
KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {...    45   0.002
SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]...    45   0.002
CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa] ...    45   0.002
CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar...    45   0.002
SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]...    45   0.002
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    44   0.002
Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W ...    45   0.002
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    45   0.002
KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]...    45   0.002
NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON}                 44   0.002
Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON...    45   0.002
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    44   0.002
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    44   0.002
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    44   0.002
Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...    44   0.002
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    44   0.002
ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON} simil...    44   0.002
KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON} uni...    44   0.002
Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W ...    44   0.002
ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar...    44   0.002
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    44   0.002
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    44   0.002
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    44   0.002
SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON...    44   0.003
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    44   0.003
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    44   0.003
Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to ...    44   0.003
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    44   0.003
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    44   0.003
ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; N...    44   0.003
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                44   0.003
KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}...    44   0.003
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    44   0.004
Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380...    44   0.004
Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 ...    44   0.004
Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W ...    43   0.004
Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {O...    44   0.004
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    44   0.004
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    44   0.004
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    44   0.004
ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}...    44   0.004
KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa] ...    44   0.004
YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON} ...    44   0.004
YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}  RDR1Tra...    43   0.004
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    44   0.004
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    44   0.004
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    43   0.005
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    43   0.005
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    43   0.005
Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa] ...    43   0.005
TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8....    43   0.005
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    43   0.005
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    43   0.005
Kpol_1008.13 s1008 (21147..23855) [2709 bp, 902 aa] {ON} (21147....    43   0.005
Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar...    43   0.005
TBLA0A05860 Chr1 (1449582..1452014) [2433 bp, 810 aa] {ON}             43   0.005
KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON}               43   0.005
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    43   0.006
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    43   0.006
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    43   0.006
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    43   0.006
TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.6...    43   0.006
TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]...    43   0.006
Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa] ...    43   0.006
NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON}               43   0.006
CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} simi...    43   0.006
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    43   0.007
YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON...    43   0.007
NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879       43   0.007
CAGL0G09757g Chr7 (930351..934622) [4272 bp, 1423 aa] {ON} some ...    43   0.007
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    43   0.007
Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON} co...    42   0.008
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       42   0.008
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               42   0.008
KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {...    43   0.008
KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conser...    42   0.008
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    42   0.009
KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON}              42   0.009
Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340) ...    42   0.009
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    42   0.009
TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.5...    42   0.009
Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} simila...    42   0.010
NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON} Anc_...    42   0.010
TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON}       42   0.010
AGR280C Chr7 complement(1266912..1270232) [3321 bp, 1106 aa] {ON...    42   0.010
KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} som...    42   0.010
Smik_12.357 Chr12 complement(638342..642208) [3867 bp, 1288 aa] ...    42   0.011
ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]...    42   0.011
CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {...    42   0.011
Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON} YLR25...    42   0.012
KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {O...    42   0.012
TDEL0G04090 Chr7 complement(744499..746730) [2232 bp, 743 aa] {O...    42   0.012
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    42   0.012
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    42   0.012
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    42   0.012
KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]...    42   0.012
Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W ...    42   0.012
Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}...    42   0.012
TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.6...    42   0.012
NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423     42   0.012
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    42   0.013
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    42   0.013
YLR278C Chr12 complement(699999..704024) [4026 bp, 1341 aa] {ON}...    42   0.013
SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa] ...    42   0.013
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    42   0.014
Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 b...    42   0.014
TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1....    42   0.014
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    42   0.014
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    42   0.015
CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {...    42   0.015
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    42   0.015
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    42   0.015
Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON} ...    42   0.015
KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa] ...    42   0.016
YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc...    42   0.016
NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON} Anc_2...    42   0.016
Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON...    41   0.017
Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337...    41   0.017
AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON} ...    42   0.017
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    42   0.017
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    42   0.017
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    41   0.018
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    41   0.018
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    41   0.018
Kwal_14.931 s14 complement(119423..122608) [3186 bp, 1061 aa] {O...    41   0.018
KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} simila...    41   0.019
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    41   0.020
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               41   0.020
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    41   0.020
Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W (...    41   0.021
Skud_12.335 Chr12 (592952..597391) [4440 bp, 1479 aa] {ON} YLR25...    41   0.021
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    41   0.021
Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON} (126243...    41   0.021
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    41   0.021
Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa] ...    41   0.021
Klac_YGOB_3960 Chr3 (291786..293297,293300..294220) [2433 bp, 81...    41   0.022
KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa] ...    41   0.022
Skud_15.326 Chr15 complement(588275..590731) [2457 bp, 818 aa] {...    41   0.022
NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON...    41   0.023
CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} simi...    41   0.023
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      41   0.023
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    41   0.023
KLLA0D05038g Chr4 (433653..435674) [2022 bp, 673 aa] {ON} simila...    41   0.024
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    41   0.024
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    41   0.024
Suva_10.376 Chr10 complement(660780..664688) [3909 bp, 1302 aa] ...    41   0.024
Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {O...    41   0.024
Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF} Y...    41   0.024
Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 ...    41   0.025
YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}  ...    40   0.025
Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa] {...    41   0.025
CAGL0D02904g Chr4 complement(302952..305615) [2664 bp, 887 aa] {...    41   0.025
Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {O...    41   0.025
TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON}               41   0.025
NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423     41   0.025
KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some s...    41   0.026
TDEL0B06260 Chr2 (1104557..1108300) [3744 bp, 1247 aa] {ON} Anc_...    41   0.026
SAKL0B01870g Chr2 (185897..188926) [3030 bp, 1009 aa] {ON} weakl...    41   0.026
KAFR0E02330 Chr5 (468300..470414) [2115 bp, 704 aa] {ON} Anc_5.5...    41   0.026
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    41   0.026
Smik_3.209 Chr3 (306620..309118) [2499 bp, 832 aa] {ON} YCR106W ...    41   0.027
Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa] {O...    41   0.027
TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa] ...    41   0.028
Skud_7.2 Chr7 (5094..6749) [1656 bp, 551 aa] {ON} YLR098C (REAL)       40   0.028
NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3....    40   0.030
Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337...    40   0.030
ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]...    40   0.031
NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON} Anc_8...    40   0.031
AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON} N...    40   0.032
Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}...    39   0.032
Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W...    40   0.032
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    40   0.032
Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {...    40   0.033
TBLA0G01100 Chr7 complement(279553..281454) [1902 bp, 633 aa] {O...    40   0.033
KAFR0G02450 Chr7 (508147..511353) [3207 bp, 1068 aa] {ON} Anc_6....    40   0.034
Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON} ...    40   0.034
Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa] {...    40   0.034
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    40   0.034
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    40   0.035
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    40   0.035
Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}...    40   0.035
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    40   0.036
YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}  ...    40   0.036
NDAI0I01940 Chr9 (450330..454112) [3783 bp, 1260 aa] {ON} Anc_6.75     40   0.036
Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON} ...    40   0.036
Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON} ...    40   0.036
TBLA0C01120 Chr3 complement(233451..237911) [4461 bp, 1486 aa] {...    40   0.037
KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {...    40   0.037
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    40   0.038
Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar t...    40   0.039
TPHA0N01100 Chr14 (231308..232501) [1194 bp, 397 aa] {ON} Anc_6....    40   0.043
KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {...    40   0.045
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    40   0.045
NDAI0C03450 Chr3 (789514..791844) [2331 bp, 776 aa] {ON} Anc_5.59      40   0.046
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    40   0.048
Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON} (69833...    40   0.048
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    40   0.049
ZYRO0G21626g Chr7 complement(1781790..1783031) [1242 bp, 413 aa]...    40   0.049
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    40   0.050
TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8....    40   0.050
Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W ...    40   0.053
Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W ...    40   0.056
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    40   0.056
Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W ...    40   0.057
KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8....    40   0.057
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    40   0.060
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    40   0.061
KLTH0A03498g Chr1 complement(301696..303915) [2220 bp, 739 aa] {...    40   0.062
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    40   0.063
KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.87...    40   0.063
Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa] {O...    40   0.063
KAFR0G01360 Chr7 complement(305620..308121) [2502 bp, 833 aa] {O...    40   0.064
KLLA0D11286g Chr4 complement(964642..966678) [2037 bp, 678 aa] {...    39   0.065
TPHA0E00880 Chr5 complement(177030..180164) [3135 bp, 1044 aa] {...    40   0.065
KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa] {...    39   0.066
SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weak...    39   0.066
KNAG0M00970 Chr13 (169393..172926) [3534 bp, 1177 aa] {ON} Anc_6...    40   0.067
Kwal_8.580 s8 (13266..15182) [1917 bp, 638 aa] {ON} [contig 311]...    39   0.067
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    39   0.068
ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}...    39   0.068
Kwal_47.18089 s47 complement(680481..682718) [2238 bp, 745 aa] {...    39   0.069
CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} simila...    39   0.069
SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]...    39   0.069
Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]...    39   0.071
Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa] {...    39   0.073
YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON} ...    39   0.073
CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa...    39   0.074
Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa] {...    39   0.075
KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {...    39   0.076
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    39   0.076
KLTH0E08778g Chr5 complement(795841..798462) [2622 bp, 873 aa] {...    39   0.078
TPHA0C02220 Chr3 (504550..506658) [2109 bp, 702 aa] {ON} Anc_8.4...    39   0.078
Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON...    39   0.079
Smik_15.342 Chr15 complement(595611..595820,595851..598070) [243...    39   0.081
KLLA0D10593g Chr4 complement(900326..903103) [2778 bp, 925 aa] {...    39   0.081
CAGL0L04576g Chr12 (528957..531554) [2598 bp, 865 aa] {ON} simil...    39   0.081
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    39   0.081
CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} simil...    39   0.081
YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON} ...    39   0.082
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    39   0.084
KLLA0F10373g Chr6 (957948..958994) [1047 bp, 348 aa] {ON} some s...    39   0.086
Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON...    39   0.089
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    39   0.093
KAFR0H01800 Chr8 complement(333664..336048) [2385 bp, 794 aa] {O...    39   0.093
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    39   0.094
SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON...    39   0.096
SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]...    39   0.097
CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly...    39   0.098
KAFR0G02520 Chr7 complement(522206..524722) [2517 bp, 838 aa] {O...    39   0.099
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    39   0.10 
YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1 e...    39   0.10 
Suva_10.364 Chr10 complement(637047..639170) [2124 bp, 707 aa] {...    39   0.10 
NCAS0E02620 Chr5 complement(523279..526626) [3348 bp, 1115 aa] {...    39   0.10 
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    39   0.10 
Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON...    39   0.10 
KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON}               39   0.11 
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    39   0.11 
ZYRO0B02574g Chr2 complement(204817..206541) [1725 bp, 574 aa] {...    39   0.11 
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    39   0.11 
SAKL0H01958g Chr8 complement(193079..195055) [1977 bp, 658 aa] {...    39   0.11 
KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]...    39   0.11 
Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON...    39   0.11 
KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} simila...    39   0.11 
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    39   0.11 
CAGL0L04400g Chr12 complement(513759..516722) [2964 bp, 987 aa] ...    39   0.12 
TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.2...    39   0.12 
KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON} Anc_6.1...    39   0.12 
Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}...    39   0.12 
Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297...    39   0.12 
TPHA0C02180 Chr3 complement(493972..496632) [2661 bp, 886 aa] {O...    39   0.12 
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    39   0.12 
TBLA0B07920 Chr2 complement(1877300..1879603) [2304 bp, 767 aa] ...    39   0.13 
KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar ...    39   0.13 
KAFR0D04590 Chr4 (900318..902840) [2523 bp, 840 aa] {ON} Anc_5.3...    39   0.13 
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    37   0.13 
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    39   0.13 
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    39   0.13 
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    39   0.14 
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    39   0.14 
Kpol_1031.47 s1031 (125242..127926) [2685 bp, 894 aa] {ON} (1252...    39   0.14 
NCAS0A00300 Chr1 (43991..46324) [2334 bp, 777 aa] {ON} Anc_1.26 ...    39   0.14 
ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595 ...    38   0.14 
Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar t...    38   0.15 
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    39   0.15 
SAKL0F11616g Chr6 complement(901066..902841) [1776 bp, 591 aa] {...    38   0.15 
CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {...    38   0.15 
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    39   0.15 
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    38   0.16 
Ecym_3395 Chr3 complement(750356..753481) [3126 bp, 1041 aa] {ON...    38   0.16 
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    38   0.16 
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    38   0.16 
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    38   0.17 
Skud_12.346 Chr12 complement(616734..618818) [2085 bp, 694 aa] {...    38   0.17 
Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172...    38   0.17 
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    38   0.18 
Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W...    38   0.18 
Ecym_2345 Chr2 (676841..678754) [1914 bp, 637 aa] {ON} similar t...    38   0.18 
KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conser...    38   0.19 
KLTH0B08580g Chr2 (697066..698970) [1905 bp, 634 aa] {ON} simila...    38   0.19 
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    38   0.19 
AGL099C Chr7 complement(516587..518830) [2244 bp, 747 aa] {ON} S...    38   0.19 
Ecym_4153 Chr4 complement(330831..333281) [2451 bp, 816 aa] {ON}...    38   0.19 
Kpol_345.3 s345 complement(7411..11517) [4107 bp, 1368 aa] {ON} ...    38   0.20 
TPHA0K01100 Chr11 (228134..231619) [3486 bp, 1161 aa] {ON} Anc_6...    38   0.20 
KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserv...    38   0.20 
Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON} (12074..1...    38   0.20 
Ecym_4686 Chr4 complement(1336279..1339581) [3303 bp, 1100 aa] {...    38   0.21 
NCAS0F00370 Chr6 complement(61819..65148) [3330 bp, 1109 aa] {ON...    38   0.21 
Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [conti...    38   0.21 
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    38   0.21 
YBR150C Chr2 complement(541209..544493) [3285 bp, 1094 aa] {ON} ...    38   0.21 
Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar t...    38   0.21 
Suva_8.216 Chr8 complement(389549..391894) [2346 bp, 781 aa] {ON...    38   0.22 
SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} simila...    38   0.23 
Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}...    38   0.23 
Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to ...    38   0.23 
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    38   0.24 
AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; N...    37   0.24 
KLLA0C04620g Chr3 complement(422705..426514) [3810 bp, 1269 aa] ...    38   0.24 
Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {O...    38   0.25 
TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON} Anc_8...    38   0.25 
Sklu_YGOB_gneas1 Chr3 complement(352893..354335) [1443 bp, 480 a...    37   0.26 
TDEL0G03970 Chr7 (720080..723187) [3108 bp, 1035 aa] {ON} Anc_6....    37   0.27 
TBLA0F03550 Chr6 complement(875734..876630) [897 bp, 298 aa] {ON...    37   0.27 
KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} simila...    37   0.27 
CAGL0H01507g Chr8 complement(147689..150073) [2385 bp, 794 aa] {...    37   0.27 
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    37   0.28 
YCR106W Chr3 (310958..313456) [2499 bp, 832 aa] {ON}  RDS1Putati...    37   0.29 
Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}...    37   0.29 
YLL054C Chr12 complement(32673..35204) [2532 bp, 843 aa] {ON} Pu...    37   0.29 
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    37   0.29 
Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172...    37   0.30 
Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON...    37   0.30 
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    37   0.30 
Kwal_14.1631 s14 (397794..399125) [1332 bp, 443 aa] {ON} YBR240C...    37   0.31 
Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}...    37   0.31 
AGR369W Chr7 (1412833..1415988) [3156 bp, 1051 aa] {ON} Syntenic...    37   0.32 
Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C (REAL)     37   0.32 
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    37   0.32 
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    37   0.32 
Kpol_1061.37 s1061 complement(102667..104616) [1950 bp, 649 aa] ...    37   0.32 
YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}  ...    37   0.32 
Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON} (44110....    37   0.32 
TDEL0C01880 Chr3 (332932..334554) [1623 bp, 540 aa] {ON} Anc_7.3...    37   0.32 
TPHA0F02630 Chr6 complement(583511..587299) [3789 bp, 1262 aa] {...    37   0.33 
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    37   0.33 
NCAS0F00310 Chr6 (49514..52084) [2571 bp, 856 aa] {ON}                 37   0.33 
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    37   0.33 
ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} simila...    37   0.34 
YER184C Chr5 complement(556296..558680) [2385 bp, 794 aa] {ON} P...    37   0.34 
TDEL0G04100 Chr7 complement(746975..749074) [2100 bp, 699 aa] {O...    37   0.34 
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    35   0.35 
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    37   0.35 
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    37   0.37 
Ecym_5183 Chr5 complement(385669..388101) [2433 bp, 810 aa] {ON}...    37   0.38 
KLLA0F20680g Chr6 (1924148..1926511) [2364 bp, 787 aa] {ON} weak...    37   0.40 
TDEL0E00300 Chr5 (64461..66374) [1914 bp, 637 aa] {ON}                 37   0.41 
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    37   0.42 
ZYRO0C18282g Chr3 (1431515..1433665) [2151 bp, 716 aa] {ON} cons...    37   0.43 
KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp, ...    37   0.43 
KLTH0A00484g Chr1 (42443..44149) [1707 bp, 568 aa] {ON} conserve...    37   0.44 
KLTH0E00176g Chr5 (8605..10311) [1707 bp, 568 aa] {ON} conserved...    37   0.45 
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    37   0.45 
KAFR0A04940 Chr1 (975356..978913) [3558 bp, 1185 aa] {ON} Anc_6....    37   0.45 
NDAI0F02050 Chr6 complement(503400..504740) [1341 bp, 446 aa] {O...    37   0.46 
Skud_7.646 Chr7 (1073386..1074795) [1410 bp, 469 aa] {ON} YPR196...    37   0.49 
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    37   0.50 
TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa] ...    37   0.50 
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    37   0.50 
NDAI0D02730 Chr4 (629970..633647) [3678 bp, 1225 aa] {ON} Anc_6....    37   0.51 
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    37   0.51 
ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic ho...    37   0.52 
Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON...    37   0.53 
KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}...    37   0.53 
KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3....    37   0.53 
SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON} conser...    37   0.54 
Skud_16.500 Chr16 (874371..876485) [2115 bp, 704 aa] {ON} YKL222...    37   0.55 
TPHA0L02050 Chr12 complement(423921..426563) [2643 bp, 880 aa] {...    37   0.57 
Kwal_26.6664 s26 complement(11094..12833) [1740 bp, 579 aa] {ON}...    36   0.60 
CAGL0L09383g Chr12 (1020856..1021956) [1101 bp, 366 aa] {ON} som...    36   0.61 
YML099C Chr13 complement(74398..77040) [2643 bp, 880 aa] {ON}  A...    36   0.61 
Ecym_3001 Chr3 (1150..3042) [1893 bp, 630 aa] {ON} similar to As...    36   0.62 
ZYRO0D14432g Chr4 complement(1222977..1226489) [3513 bp, 1170 aa...    36   0.65 
SAKL0G19404g Chr7 (1667193..1670582) [3390 bp, 1129 aa] {ON} sim...    36   0.65 
CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON...    36   0.65 
Kwal_56.23308 s56 complement(485779..487092) [1314 bp, 438 aa] {...    36   0.66 
ZYRO0B03278g Chr2 (269277..272996) [3720 bp, 1239 aa] {ON} simil...    36   0.66 
CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa...    36   0.68 
KLTH0A06644g Chr1 complement(553084..555270) [2187 bp, 728 aa] {...    36   0.69 
Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]...    36   0.71 
Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar t...    36   0.71 
SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {...    36   0.72 
AER291C Chr5 complement(1172383..1174374) [1992 bp, 663 aa] {ON}...    36   0.76 
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      36   0.76 
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    36   0.77 
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    36   0.77 
TBLA0A07010 Chr1 (1713923..1716046) [2124 bp, 707 aa] {ON}             36   0.85 
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    36   0.85 
KNAG0B02380 Chr2 complement(466392..469595) [3204 bp, 1067 aa] {...    36   0.86 
AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic ho...    36   0.87 
NCAS0H01240 Chr8 (235885..237312) [1428 bp, 475 aa] {ON} Anc_6.154     35   0.88 
SAKL0C03960g Chr3 (380387..383488) [3102 bp, 1033 aa] {ON} conse...    36   0.90 
Smik_4.68 Chr4 (133172..134758) [1587 bp, 528 aa] {ON} YDL170W (...    35   0.90 
KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654...    36   0.91 
Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098...    36   0.91 
ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic ...    36   0.94 
TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {...    36   0.94 
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    35   0.99 
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    35   1.0  
KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly...    35   1.0  
AFR722C Chr6 complement(1765861..1768293) [2433 bp, 810 aa] {ON}...    35   1.0  
ZYRO0D01650g Chr4 complement(131688..134270) [2583 bp, 860 aa] {...    35   1.0  
NCAS0B05110 Chr2 complement(951685..953485,953561..953643) [1884...    35   1.0  
Kwal_YGOB_gneas1 s33 complement(285483..287042) [1560 bp, 519 aa...    35   1.1  
NDAI0F04500 Chr6 complement(1093752..1096181) [2430 bp, 809 aa] ...    35   1.1  
KNAG0F02830 Chr6 (536483..538723) [2241 bp, 746 aa] {ON}               35   1.1  
KLLA0A09251g Chr1 (808253..810319) [2067 bp, 688 aa] {ON} simila...    35   1.1  
CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa] {...    35   1.1  
TBLA0E01900 Chr5 (462299..464821) [2523 bp, 840 aa] {ON} Anc_7.5...    35   1.1  
SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON} conser...    35   1.1  
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    35   1.1  
Skud_4.87 Chr4 (152240..153826) [1587 bp, 528 aa] {ON} YDL170W (...    35   1.1  
NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}...    35   1.2  
Smik_26.8 Chr26 (8892..9242) [351 bp, 117 aa] {ON} YER184C (REAL)      33   1.2  
TDEL0C01580 Chr3 complement(272178..275687) [3510 bp, 1169 aa] {...    35   1.2  
KLTH0F05258g Chr6 complement(462417..464825) [2409 bp, 802 aa] {...    35   1.2  
KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly...    35   1.2  
SAKL0B12518g Chr2 (1072142..1073932) [1791 bp, 596 aa] {ON} cons...    35   1.2  
KLLA0F02299g Chr6 (205549..208167) [2619 bp, 872 aa] {ON} conser...    35   1.2  
TBLA0C02060 Chr3 (486966..489920) [2955 bp, 984 aa] {ON} Anc_1.1...    35   1.2  
SAKL0G14256g Chr7 (1230063..1232306) [2244 bp, 747 aa] {ON} cons...    35   1.2  
Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar...    35   1.3  
SAKL0A08074g Chr1 (711985..715425) [3441 bp, 1146 aa] {ON} simil...    35   1.3  
KNAG0H01260 Chr8 (220201..222426) [2226 bp, 741 aa] {ON} Anc_3.2...    35   1.3  
KNAG0A04550 Chr1 (642548..645208) [2661 bp, 886 aa] {ON} Anc_8.4...    35   1.3  
YKL222C Chr11 complement(3503..5620) [2118 bp, 705 aa] {ON} Prot...    35   1.4  
Kpol_1061.19 s1061 (51386..54709) [3324 bp, 1107 aa] {ON} (51386...    35   1.4  
KLTH0H05720g Chr8 (505672..507006) [1335 bp, 444 aa] {ON} simila...    35   1.4  
KLTH0H00968g Chr8 (103482..105353) [1872 bp, 623 aa] {ON} simila...    35   1.4  
Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar t...    35   1.4  
KLLA0E18195g Chr5 complement(1622300..1625701) [3402 bp, 1133 aa...    35   1.4  
Ecym_7239 Chr7 (501580..504774) [3195 bp, 1064 aa] {ON} similar ...    35   1.5  
TBLA0H03910 Chr8 complement(943931..946234) [2304 bp, 767 aa] {O...    35   1.5  
ZYRO0G00308g Chr7 (20674..22623) [1950 bp, 649 aa] {ON} similar ...    35   1.6  
KLLA0F02387g Chr6 complement(213669..215852) [2184 bp, 727 aa] {...    35   1.6  
KLTH0C06776g Chr3 complement(586976..590140) [3165 bp, 1054 aa] ...    35   1.6  
KLLA0E20307g Chr5 (1806005..1809364) [3360 bp, 1119 aa] {ON} uni...    35   1.6  
TBLA0B07050 Chr2 (1669768..1671996) [2229 bp, 742 aa] {ON}             35   1.6  
TDEL0G00830 Chr7 complement(170169..172229) [2061 bp, 686 aa] {O...    35   1.6  
NCAS0B08200 Chr2 (1561174..1563801) [2628 bp, 875 aa] {ON} Anc_1...    35   1.6  
Kwal_27.10852 s27 complement(526456..529596) [3141 bp, 1046 aa] ...    35   1.6  
TPHA0M00150 Chr13 (29607..31919) [2313 bp, 770 aa] {ON}                35   1.7  
Suva_15.3 Chr15 complement(4971..6152) [1182 bp, 393 aa] {ON} YK...    35   1.7  
SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON} conse...    35   1.7  
Kpol_1042.7 s1042 (12882..15233) [2352 bp, 783 aa] {ON} (12882.....    35   1.7  
ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON} S...    35   1.7  
SAKL0A06072g Chr1 (551181..552518) [1338 bp, 445 aa] {ON} simila...    35   1.7  
NDAI0J00440 Chr10 complement(78052..80523) [2472 bp, 823 aa] {ON...    35   1.7  
Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421...    35   1.8  
NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56      35   1.8  
CAGL0I02552g Chr9 (227257..230274) [3018 bp, 1005 aa] {ON} weakl...    35   1.8  
Kwal_55.20674 s55 complement(515392..516147) [756 bp, 252 aa] {O...    34   1.9  
YDR207C Chr4 complement(865012..867522) [2511 bp, 836 aa] {ON}  ...    35   1.9  
YNR063W Chr14 (746943..748766) [1824 bp, 607 aa] {ON} Putative z...    35   2.0  
Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W (REAL)     34   2.1  
ZYRO0G00374g Chr7 complement(28649..30553) [1905 bp, 634 aa] {ON...    34   2.1  
Smik_23.3 Chr23 complement(4675..6111) [1437 bp, 478 aa] {ON} YB...    34   2.1  
Skud_14.399 Chr14 (715444..717267) [1824 bp, 607 aa] {ON} YNR063...    34   2.2  
KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} simila...    34   2.2  
TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.5...    34   2.3  
NDAI0E04190 Chr5 complement(944753..948466) [3714 bp, 1237 aa] {...    34   2.4  
ZYRO0C11880g Chr3 (929030..930943) [1914 bp, 637 aa] {ON} simila...    34   2.4  
ZYRO0E00638g Chr5 complement(44716..48036) [3321 bp, 1106 aa] {O...    34   2.5  
Suva_2.718 Chr2 complement(1260979..1262673) [1695 bp, 564 aa] {...    34   2.6  
YHR178W Chr8 (459299..461530) [2232 bp, 743 aa] {ON}  STB5Transc...    34   2.6  
Kwal_56.24566 s56 (1057546..1059813) [2268 bp, 755 aa] {ON} [con...    34   2.9  
TBLA0E01110 Chr5 (243534..246755) [3222 bp, 1073 aa] {ON} Anc_6....    34   3.0  
KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa] {O...    34   3.1  
Kwal_23.4016 s23 (529580..531466) [1887 bp, 628 aa] {ON} YKL015W...    34   3.1  
SAKL0F16522g Chr6 (1361716..1363842) [2127 bp, 708 aa] {ON} some...    34   3.3  
Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar t...    34   3.4  
TDEL0C05790 Chr3 (1045249..1047057) [1809 bp, 602 aa] {ON}             34   3.4  
Kpol_534.28 s534 (64772..66079) [1308 bp, 435 aa] {ON} (64772..6...    33   3.4  
Smik_12.341 Chr12 complement(613817..615922) [2106 bp, 701 aa] {...    33   3.8  
Kwal_14.819 s14 complement(63184..64890) [1707 bp, 568 aa] {ON} ...    33   3.8  
Kwal_23.3178 s23 (185722..187557) [1836 bp, 611 aa] {ON} YDR207C...    33   3.8  
KLLA0A03091g Chr1 (276333..277484) [1152 bp, 383 aa] {ON} some s...    33   3.8  
TPHA0C04280 Chr3 complement(922743..926132) [3390 bp, 1129 aa] {...    34   3.9  
KAFR0C03230 Chr3 complement(655300..656520) [1221 bp, 406 aa] {O...    33   3.9  
Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}...    33   3.9  
SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly s...    33   4.0  
TDEL0B04000 Chr2 (715716..716981) [1266 bp, 421 aa] {ON} Anc_6.1...    33   4.1  
KLTH0F03300g Chr6 complement(283918..285474) [1557 bp, 518 aa] {...    33   4.1  
KLTH0E06116g Chr5 complement(553784..556297) [2514 bp, 837 aa] {...    33   4.2  
SAKL0H13266g Chr8 (1138536..1140362) [1827 bp, 608 aa] {ON} some...    33   4.5  
NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa] {O...    33   4.7  
Skud_8.242 Chr8 (430739..432958) [2220 bp, 739 aa] {ON} YHR178W ...    33   4.8  
TDEL0D06620 Chr4 (1197405..1199084) [1680 bp, 559 aa] {ON}             33   4.9  
NDAI0G03660 Chr7 complement(881936..883471) [1536 bp, 511 aa] {O...    33   5.1  
Smik_8.262 Chr8 (436380..438584) [2205 bp, 734 aa] {ON} YHR178W ...    33   5.4  
SAKL0D12254g Chr4 complement(1013532..1017065) [3534 bp, 1177 aa...    33   5.5  
TBLA0D04050 Chr4 (1007986..1009809) [1824 bp, 607 aa] {ON} Anc_8...    33   5.9  
Suva_2.701 Chr2 complement(1233963..1236344) [2382 bp, 793 aa] {...    33   6.0  
Skud_6.15 Chr6 complement(24031..25701) [1671 bp, 556 aa] {ON} Y...    33   6.1  
Suva_15.378 Chr15 (665572..667815) [2244 bp, 747 aa] {ON} YHR178...    33   6.3  
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    33   6.5  
SAKL0H00616g Chr8 (73754..75934) [2181 bp, 726 aa] {ON} some sim...    33   6.5  
SAKL0F16588g Chr6 complement(1369763..1371610) [1848 bp, 615 aa]...    33   7.3  
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    33   7.5  
AGL083W Chr7 (550291..552861) [2571 bp, 856 aa] {ON} Syntenic ho...    33   8.0  
YFL052W Chr6 (28232..29629) [1398 bp, 465 aa] {ON} Putative zinc...    32   8.5  
Kpol_534.29 s534 (66570..67142,67144..67155,67158..68246) [1674 ...    32   8.9  
Skud_6.7 Chr6 (12394..13791) [1398 bp, 465 aa] {ON} YPR196W (REAL)     32   9.0  
Smik_4.453 Chr4 complement(820614..823172) [2559 bp, 852 aa] {ON...    32   9.7  

>SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} similar to
            uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
            similar to YMR280C uniprot|P39113 Saccharomyces
            cerevisiae YMR280C CAT8 Zinc cluster transcriptional
            activator
          Length = 1270

 Score = 2378 bits (6164), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1160/1270 (91%), Positives = 1160/1270 (91%)

Query: 1    MSKRERETFAPRIIRTLGXXXXXXXXXXXXXXXXXXXXXXXXXXXVPHVAANNTTMSPTP 60
            MSKRERETFAPRIIRTLG                           VPHVAANNTTMSPTP
Sbjct: 1    MSKRERETFAPRIIRTLGSQSLSGLNPFSSSNPSSLSQSPATSSTVPHVAANNTTMSPTP 60

Query: 61   LNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKI 120
            LNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKI
Sbjct: 61   LNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKI 120

Query: 121  SDKLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKEEQLHLVSKYSNKRTSEISENE 180
            SDKLSRRAFPRGY                     CDLKEEQLHLVSKYSNKRTSEISENE
Sbjct: 121  SDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKEEQLHLVSKYSNKRTSEISENE 180

Query: 181  DEQILQQLSAANGGSLRVSSTNLYLLNKTTPGDQQDEEDQMSSKTTVDCNGVGCNHSHQP 240
            DEQILQQLSAANGGSLRVSSTNLYLLNKTTPGDQQDEEDQMSSKTTVDCNGVGCNHSHQP
Sbjct: 181  DEQILQQLSAANGGSLRVSSTNLYLLNKTTPGDQQDEEDQMSSKTTVDCNGVGCNHSHQP 240

Query: 241  NIHDKPVSTNLNDPTSISFEQNEAPGLPAVKALTSMANHEHSVQLATLVALSVPRSTEEI 300
            NIHDKPVSTNLNDPTSISFEQNEAPGLPAVKALTSMANHEHSVQLATLVALSVPRSTEEI
Sbjct: 241  NIHDKPVSTNLNDPTSISFEQNEAPGLPAVKALTSMANHEHSVQLATLVALSVPRSTEEI 300

Query: 301  LLIPQLLARIGQVHGLTSKQSLYTASLLASLKESIPLTLPTNVDMLKSTNLWEVDDVIQF 360
            LLIPQLLARIGQVHGLTSKQSLYTASLLASLKESIPLTLPTNVDMLKSTNLWEVDDVIQF
Sbjct: 301  LLIPQLLARIGQVHGLTSKQSLYTASLLASLKESIPLTLPTNVDMLKSTNLWEVDDVIQF 360

Query: 361  FQTVFKFDIQAESSTTSQDHLIATEIDGLVSDFFSQWYNFIPILDKDEFYNYYNKFKTDL 420
            FQTVFKFDIQAESSTTSQDHLIATEIDGLVSDFFSQWYNFIPILDKDEFYNYYNKFKTDL
Sbjct: 361  FQTVFKFDIQAESSTTSQDHLIATEIDGLVSDFFSQWYNFIPILDKDEFYNYYNKFKTDL 420

Query: 421  MDPNFFDDEKNLFNKRNKSISYKIFGCILLIICQMGLISKVKAENLPATNKYSQLMAYYD 480
            MDPNFFDDEKNLFNKRNKSISYKIFGCILLIICQMGLISKVKAENLPATNKYSQLMAYYD
Sbjct: 421  MDPNFFDDEKNLFNKRNKSISYKIFGCILLIICQMGLISKVKAENLPATNKYSQLMAYYD 480

Query: 481  IVVRQLMMNPYFNLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRC 540
            IVVRQLMMNPYFNLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRC
Sbjct: 481  IVVRQLMMNPYFNLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRC 540

Query: 541  PSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDD 600
            PSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDD
Sbjct: 541  PSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDD 600

Query: 601  QKVNLAGQMIALEGRVSMLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHENALDN 660
            QKVNLAGQMIALEGRVSMLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHENALDN
Sbjct: 601  QKVNLAGQMIALEGRVSMLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHENALDN 660

Query: 661  WRRGLPQQLKFELDVNGTINMDEFNHLKQLDTSGNMYSKENKSLMVLYFMAKCMIHLPVV 720
            WRRGLPQQLKFELDVNGTINMDEFNHLKQLDTSGNMYSKENKSLMVLYFMAKCMIHLPVV
Sbjct: 661  WRRGLPQQLKFELDVNGTINMDEFNHLKQLDTSGNMYSKENKSLMVLYFMAKCMIHLPVV 720

Query: 721  AKRPLVNDPEQSPESSTPSNNCGDRSSSSYVLLQQATNTLLNVFTSLRNVYPPIPINVSR 780
            AKRPLVNDPEQSPESSTPSNNCGDRSSSSYVLLQQATNTLLNVFTSLRNVYPPIPINVSR
Sbjct: 721  AKRPLVNDPEQSPESSTPSNNCGDRSSSSYVLLQQATNTLLNVFTSLRNVYPPIPINVSR 780

Query: 781  TKTRFSLLSARGSLEYTKGGALFQDNKAXXXXXXXXXXXXXXXXXPGTLSWHSLKLLDMS 840
            TKTRFSLLSARGSLEYTKGGALFQDNKA                 PGTLSWHSLKLLDMS
Sbjct: 781  TKTRFSLLSARGSLEYTKGGALFQDNKALLLDLVKELEVDKKLELPGTLSWHSLKLLDMS 840

Query: 841  ISLILQPANTKPEKLEKMLQRKLNYYNKLTNRRSNLGGGRSASSPGGNSKRKLDENQGSA 900
            ISLILQPANTKPEKLEKMLQRKLNYYNKLTNRRSNLGGGRSASSPGGNSKRKLDENQGSA
Sbjct: 841  ISLILQPANTKPEKLEKMLQRKLNYYNKLTNRRSNLGGGRSASSPGGNSKRKLDENQGSA 900

Query: 901  EPPKLTPASSKGDTPPDKKIKLEDTGFVPVRAVSQHSQSDSEKFENFQPPVAPQNSIAEA 960
            EPPKLTPASSKGDTPPDKKIKLEDTGFVPVRAVSQHSQSDSEKFENFQPPVAPQNSIAEA
Sbjct: 901  EPPKLTPASSKGDTPPDKKIKLEDTGFVPVRAVSQHSQSDSEKFENFQPPVAPQNSIAEA 960

Query: 961  FHLDPVLNNNPFSNTDLNAFFNTNNGNVPAALRSGGSLFXXXXXXXXXXXXXXXXXXXXX 1020
            FHLDPVLNNNPFSNTDLNAFFNTNNGNVPAALRSGGSLF                     
Sbjct: 961  FHLDPVLNNNPFSNTDLNAFFNTNNGNVPAALRSGGSLFNIAATAAASGNNANSTAPSNT 1020

Query: 1021 XXEGLFKVPSNGDFLKDYYNVPGAXXXXXXXXXXXXXXXXGKPQLNGSSAHSGTQAQNND 1080
              EGLFKVPSNGDFLKDYYNVPGA                GKPQLNGSSAHSGTQAQNND
Sbjct: 1021 LNEGLFKVPSNGDFLKDYYNVPGASSSQLNLLFLNNNASNGKPQLNGSSAHSGTQAQNND 1080

Query: 1081 NNGFGFAVDASWGLAPLLEWSPAGKPVDPGTCNANENSIILDTSAANMESEMATGGRLHS 1140
            NNGFGFAVDASWGLAPLLEWSPAGKPVDPGTCNANENSIILDTSAANMESEMATGGRLHS
Sbjct: 1081 NNGFGFAVDASWGLAPLLEWSPAGKPVDPGTCNANENSIILDTSAANMESEMATGGRLHS 1140

Query: 1141 NTRSYTDAKNLDIVPTLPSSKXXXXXXHRLQKGASQQPRSASIPTRKQSLCESNPTTATG 1200
            NTRSYTDAKNLDIVPTLPSSK      HRLQKGASQQPRSASIPTRKQSLCESNPTTATG
Sbjct: 1141 NTRSYTDAKNLDIVPTLPSSKQQQQQQHRLQKGASQQPRSASIPTRKQSLCESNPTTATG 1200

Query: 1201 SRDDGVLTMGTRNHRGPRRRWNSTTGQNTRTQLATMNTPQSERSKSQNIGEPGSTEDSLH 1260
            SRDDGVLTMGTRNHRGPRRRWNSTTGQNTRTQLATMNTPQSERSKSQNIGEPGSTEDSLH
Sbjct: 1201 SRDDGVLTMGTRNHRGPRRRWNSTTGQNTRTQLATMNTPQSERSKSQNIGEPGSTEDSLH 1260

Query: 1261 DLFRWQNSGL 1270
            DLFRWQNSGL
Sbjct: 1261 DLFRWQNSGL 1270

>KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P39113 Saccharomyces cerevisiae YMR280C CAT8 Zinc
            cluster transcriptional activator
          Length = 1206

 Score = 1164 bits (3010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 648/1298 (49%), Positives = 831/1298 (64%), Gaps = 120/1298 (9%)

Query: 1    MSKRERETFAPRIIRTLGXXXXXXXXXXXXXXXXXXXXXXXXXXXVPHVAANNTTMSPTP 60
            M +RE E+F PR IRTLG                                    ++SPT 
Sbjct: 1    MGERENESFGPRFIRTLGSQSISVINPLSSQPSSISQSPAQPKANTNTQTTATASISPT- 59

Query: 61   LNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKI 120
                      SVT        +SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK+
Sbjct: 60   ---------ASVTP-------SSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKV 103

Query: 121  SDKLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKEEQLHLVSKYSNKRTSEISENE 180
            SDKLSRRAFPRGY                     CDLK+EQ+HLV KYS+ +  E S  E
Sbjct: 104  SDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKDEQMHLVYKYSSNKRPEPSSTE 163

Query: 181  DEQILQQLSAANGGSLRVSSTNLYLLNKTTPGDQQDEEDQMSSKTTVDCNGVGCNHSHQP 240
            +EQ+L+QLS++NGGSLRVSSTNLYLLNKT+P   +  E+         C G+ CNH+  P
Sbjct: 164  EEQMLEQLSSSNGGSLRVSSTNLYLLNKTSPAGHEVPENH-------KCQGIDCNHTSHP 216

Query: 241  NIHDKPVSTNLNDPTSISFEQNEAPGLPAVKALTSMANHEHSVQLATLVALSVPRSTEEI 300
            ++H+KPVST L+DPT+ISFEQ+EAPGLPAVKAL+SMANHE+S QLA LVALSVPRSTEEI
Sbjct: 217  HLHEKPVSTTLSDPTTISFEQHEAPGLPAVKALSSMANHEYSTQLACLVALSVPRSTEEI 276

Query: 301  LLIPQLLARIGQVHGLTSKQSLYTASLLASLKESIPLTLPTN--VDMLKSTNLWEVDDVI 358
            L IPQLLAR+GQVHGLTSKQ LYTASLLASLKE     +PT   +  LK T+LWE+DD +
Sbjct: 277  LFIPQLLARLGQVHGLTSKQCLYTASLLASLKEPSQAVVPTTDGLTELKCTSLWEIDDPM 336

Query: 359  QFFQTVFKFDIQAESSTTSQDHLIATEIDGLVSDFFSQWYNFIPILDKDEFYNYYNKFKT 418
            +FF+   KF++ +++     + L  +EI+ L+S +F + +  IP+L+++EFY YYNKFK 
Sbjct: 337  RFFKDSCKFNLGSDNDV---ELLSISEIEDLISIYFEECHALIPVLNENEFYKYYNKFKE 393

Query: 419  DL-MDPNFFDDEKNLFNKRNKSISYKIFGCILLIICQMGLISKVKAENLPATNKYSQLMA 477
             L +DPNFF    + F  R+KSISYKIF CILL++CQ+G++SKVK E LPA +K+S++MA
Sbjct: 394  SLTVDPNFFGKANSSFAHRSKSISYKIFACILLVVCQLGIMSKVKREQLPAKSKFSRIMA 453

Query: 478  YYDIVVRQLMMNPYFNLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRL 537
            YY+  +  L +NPYF++K+TS+++LQ  SL LFYFLN+GEVSSVY+LRG +VSM+QQLRL
Sbjct: 454  YYNNAILALKLNPYFSVKTTSVKTLQLMSLLLFYFLNVGEVSSVYELRGTIVSMAQQLRL 513

Query: 538  HRCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVAD 597
            HRCPSAVLG  GS +SK++QG+RR+LFWGIYYLDVFSALQLGVPRLLKDHEIECALP+++
Sbjct: 514  HRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSALQLGVPRLLKDHEIECALPISE 573

Query: 598  NDDQKVNLAGQMIALEGRVSMLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHENA 657
            N    V+LA Q+I LEG+VS  SLS++RF+K+LGNILDSIFKRGM++S+ +Q++L+HENA
Sbjct: 574  NGHPGVSLADQVIRLEGQVSEFSLSLLRFSKILGNILDSIFKRGMTSSIAQQVALIHENA 633

Query: 658  LDNWRRGLPQQLKFELDVNGTINMDEFN---HLKQLDTSGNMYSKENKSLMVLYFMAKCM 714
            LD+WRRGLP+ L FELDVNGTINM+E N   H K+  ++    S +N++LMVLYF+ KC+
Sbjct: 634  LDSWRRGLPKNLTFELDVNGTINMEELNSGSHWKKDYSTAP--SCDNRTLMVLYFLVKCL 691

Query: 715  IHLPVVAKRPLVNDPEQSPESST----PSNNCGDRSSSSYVLLQQATNTLLNVFTSLRNV 770
            +HLPV+A +PL+    +    +T     +++  DRSSSSYVLLQQATNT L+V +SL++ 
Sbjct: 692  VHLPVLAAKPLLGGASEVDTDATLAFDDASSGADRSSSSYVLLQQATNTFLSVQSSLKSR 751

Query: 771  YPPIPINVSRTKTRFSLLSARGSLEYTKGGALFQDNKAXXXXXXXXXXXXXXXXXPGTLS 830
            + P+ +N+ R K RF+LLSARG LEYTKGGALFQ NKA                 PG+LS
Sbjct: 752  HLPLALNLPRIKARFALLSARGILEYTKGGALFQGNKALLLDVVKELETTKRLEIPGSLS 811

Query: 831  WHSLKLLDMSISLILQPANTKPEKLEKMLQRKLNYYNKLTNRRSNLGGGRSASSPGGNSK 890
            WHSL LLDM++SLI+QP +TK  KL+K+L+ KL+YYNKL  R +N+   +         +
Sbjct: 812  WHSLILLDMAVSLIMQPPHTKAGKLDKLLEAKLSYYNKLMGRSANVASTK---------R 862

Query: 891  RKLDENQGSAEPPKLTPASSKGDTPPDKKIKLEDT---GFVPVRAVSQHSQSDSEKFENF 947
            +K ++N   +   KLTP SS   +P +K++KLE T   G  PV  V    Q +    E++
Sbjct: 863  KKEEDNTSLSNATKLTPLSSDSSSPSEKRVKLEHTDKVGETPV-GVENTGQPNGNTQEHY 921

Query: 948  QPPVA----PQNSIAEAFHLDPVLNNNPFSNTDLNAFFNTNNGNVPAALRSGGSLFXXXX 1003
                +    P +++AEAFHLDPVLNNNPFSN DL AFF+T+NG +P  L  G S+     
Sbjct: 922  AATWSNQNQPHSTVAEAFHLDPVLNNNPFSNGDLTAFFSTDNG-MP-NLSGGASMLNMVG 979

Query: 1004 XXXXXXXX--------XXXXXXXXXXXEGLFKVPSNGDFLKDYYNVPGAXXXXXXXXXXX 1055
                                       +GLF+VPSNGDFLKDYY VPGA           
Sbjct: 980  VDQAHSTAGNDAQNTVNANSQQSTLFNDGLFRVPSNGDFLKDYYRVPGASSSQLNLMLMG 1039

Query: 1056 XXXXXGKPQLNGSSAHSGTQAQNNDNN-GFGFAVDASWGLAPLLEWSP--AGKPVDPGTC 1112
                      +GS+     Q Q N  + GFGF VDAS GLAPLL WSP  A +P+   + 
Sbjct: 1040 SGS-------SGSNQRQAKQQQTNTTDPGFGFTVDASLGLAPLLAWSPEAAQEPIAETSD 1092

Query: 1113 NANENSIILDTSAANMESEMATGGRLHSNTRSYTDAKNLDIVPTLPSSKXXXXXXHRLQK 1172
            +   N      S    +S   T G L +      D+       T P+S+           
Sbjct: 1093 HDTRND-----SGLRRKSGAETAGVLVAGHSQLADSS------TDPASQ----------- 1130

Query: 1173 GASQQPRSASIPTRKQSLCESNPTTATGSRDDGVLTMGTRNHRGPRRRWNSTTGQNTRTQ 1232
               QQ R  S           +      S +D  +TM TR HRGPRRRWNSTTG      
Sbjct: 1131 ---QQRRVGSY---------DHTYAQDQSVEDSAITMPTRPHRGPRRRWNSTTG------ 1172

Query: 1233 LATMNTPQSERSKSQNIGEPGSTEDSLHDLFRWQNSGL 1270
             A   TP S+R ++    E   T+++L DLFRWQNSG 
Sbjct: 1173 -AAAITPNSDRPRNAPASE---TDENLQDLFRWQNSGF 1206

>Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR280C
            (CAT8) - Zinc-cluster protein involved in activating
            gluconeogenic genes; related to Gal4p [contig 39] FULL
          Length = 1209

 Score = 1122 bits (2902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 657/1309 (50%), Positives = 826/1309 (63%), Gaps = 139/1309 (10%)

Query: 1    MSKRERETFAPRIIRTLGXXXXXXXXXXXXXXXXXXXXXXXXXXXVPHVAANNTTMSPTP 60
            M +RE E+F PR IRTLG                             + AA N   S +P
Sbjct: 1    MGERENESFGPRFIRTLGSQSLSGTNPLSSQPSSISQSPAQPRTN--NSAAPNAARSISP 58

Query: 61   LNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKI 120
                       VTS   T    SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK+
Sbjct: 59   -----------VTSATPT----SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKV 103

Query: 121  SDKLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKEEQLHLVSKYSNKRTSEISENE 180
            SDKLSRRAFPRGY                     CDLK+EQ+HLVSKYS+ +  E S  E
Sbjct: 104  SDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKDEQMHLVSKYSSNKRHEPSSTE 163

Query: 181  DEQILQQLSAANGGSLRVSSTNLYLLNKTTPGDQQDEEDQMSSKTTVDCNGVGCNHSHQP 240
            + ++L+QLS ++GGSLRVSSTNLYLLNKTTP  Q   E          C G+GCNH+  P
Sbjct: 164  EGRMLEQLSNSDGGSLRVSSTNLYLLNKTTPAVQDGSELH-------KCQGLGCNHASHP 216

Query: 241  NIHDKPVSTNLNDPTSISFEQNEAPGLPAVKALTSMANHEHSVQLATLVALSVPRSTEEI 300
            ++H+KPVST+L+DP +ISFEQNEAPGLPAVKAL +MANHE+S QLA LVALSVPRST+EI
Sbjct: 217  HLHEKPVSTSLSDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEI 276

Query: 301  LLIPQLLARIGQVHGLTSKQSLYTASLLASLKESIPLTLPTNVDM--LKSTNLWEVDDVI 358
            L IPQLLAR+GQVHGLTSKQ LY+ASLLA+LKES   +   + D   LK  +LWE+DD +
Sbjct: 277  LFIPQLLARLGQVHGLTSKQCLYSASLLAALKESSQTSFQGSPDYKDLKDKSLWEIDDCM 336

Query: 359  QFFQTVFKFDIQAESSTTSQDHLIATEIDGLVSDFFSQWYNFIPILDKDEFYNYYNKFKT 418
             FF+T  KF++   +S+   + L  +EI+ L+S +F + +  IP+L++ EFY YYNKFK+
Sbjct: 337  TFFKTGCKFNL---TSSKDAECLTISEIEELISIYFGECHALIPVLNEAEFYKYYNKFKS 393

Query: 419  DLM-DPNFFDDEKNLFNKRNKSISYKIFGCILLIICQMGLISKVKAENLPATNKYSQLMA 477
            +L  DP FF      F +R+KSISYKIF CILL+ICQ GL++KVK E LP  NK+S LM+
Sbjct: 394  NLTTDPEFFKTSTPSFAQRSKSISYKIFACILLVICQFGLMAKVKREQLPTKNKFSLLMS 453

Query: 478  YYDIVVRQLMMNPYFNLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRL 537
            YY   +  L  NPYF++K+TSIQ+LQ  SL LFY+LN+GEVSSVY++RG VVSM+QQLRL
Sbjct: 454  YYSNALLALKTNPYFSVKNTSIQTLQLLSLLLFYYLNVGEVSSVYEIRGTVVSMAQQLRL 513

Query: 538  HRCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVAD 597
            HRCPSAVLG  GS +SK++QG+RR+LFWGIYYLDVF ALQLGVPRLLKDHEIECALP+++
Sbjct: 514  HRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALPISE 573

Query: 598  NDDQKVNLAGQMIALEGRVSMLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHENA 657
            +    V+LA Q+I LEG+VS LSLS++RF+K+LGNILDSIFKRGM++S  +Q++L+HENA
Sbjct: 574  HAHAGVSLADQVIKLEGQVSELSLSLLRFSKILGNILDSIFKRGMTSSAAQQVALIHENA 633

Query: 658  LDNWRRGLPQQLKFELDVNGTINMDEFNHLKQ--LDTSGNMYSKENKSLMVLYFMAKCMI 715
            LDNWRRGLP+ L FELDVNGTI ++E     Q   D + N  S + K LM+LYF+ KC++
Sbjct: 634  LDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQDFTKNA-SSDKKILMLLYFLVKCLV 692

Query: 716  HLPVVAKRPLVNDPEQSPESSTPSNNCG----DRSSSSYVLLQQATNTLLNVFTSLRNVY 771
            HLPV+A +PL+    +  + +TP+ +      DRSSSSYVLLQQATNT L+V +  +  +
Sbjct: 693  HLPVLAAKPLLGGSSEPDKDATPAFDDASSGADRSSSSYVLLQQATNTFLSVQSCFKTRH 752

Query: 772  PPIPINVSRTKTRFSLLSARGSLEYTKGGALFQDNKAXXXXXXXXXXXXXXXXXPGTLSW 831
             P+ I++ R K RF+LLSARG LEYTKGGALFQDNKA                 PG+LSW
Sbjct: 753  LPLAIDLPRIKARFALLSARGILEYTKGGALFQDNKALLLEVVKELEASKKLELPGSLSW 812

Query: 832  HSLKLLDMSISLILQPANTKPEKLEKMLQRKLNYYNKLTNRRSNLGGGRSASSPGGNSKR 891
            HSL LLDM+  LI+QP  TK +KL+K+L+ +LNYYNKL  R          S+   N KR
Sbjct: 813  HSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMGR----------STLTSNGKR 862

Query: 892  KLDENQGSAEPPKLTPASSKGDTPPDKKIKLE---DTGFVPVRAVSQHSQSD--SEKFEN 946
            K +EN  +++  KLTP SS+ +TP DK+IK+E    +G VP  + S H   D  ++KF  
Sbjct: 863  KNEENDATSKVSKLTPLSSEYNTPSDKRIKVESIGSSGNVPSNSESVHHFDDIQNDKFST 922

Query: 947  FQPPVAPQ-NSIAEAFHLDPVLNNNPFSNTDLNAFFNTNNGNVPAALRSGGSLFXXXXXX 1005
              P   PQ N+IAEAFHLDPVLN NPFSN DL AFFN++NG +P  +  G S+       
Sbjct: 923  NWPSNNPQPNAIAEAFHLDPVLNGNPFSNGDLTAFFNSDNG-IP-QIGGGSSVLNLAGIG 980

Query: 1006 XXXXXXXXX----------XXXXXXXXEGLFKVPSNGDFLKDYYNVPGAXXXXXXXXXXX 1055
                                       +GLF+VPSNGDFLKDYY +PGA           
Sbjct: 981  AANSNELNNNNNEAAGGGPRKVATTVNDGLFRVPSNGDFLKDYYRIPGASSS-------- 1032

Query: 1056 XXXXXGKPQLN------GSSAHSGTQAQNNDNN----GFGFAVDASWGLAPLLEWSP-AG 1104
                    QLN      G++  +     N  NN    GFGF VDAS GLAPLL WSP A 
Sbjct: 1033 --------QLNLMFMGPGNTGANQNAPNNQKNNFTVPGFGFTVDASLGLAPLLAWSPEAP 1084

Query: 1105 KPVDPGTCNANENSIILDTSAANMESEMATGGRLHSNTRSYTDAKNLDIVPTLPSSKXXX 1164
            +P  P           +  +A   +S+  +  RL S T   +D       PT   S+   
Sbjct: 1085 QPSMPE----------IAQNADRRDSDPLSRTRLPSATIPASD-------PTHVISQDSN 1127

Query: 1165 XXXHRLQKGASQQPRSAS---IPTRKQSLCESNPTTATGSRDDGVLTMGTRNHRGPRRRW 1221
                R      +Q RS S   +  + QSL            DD  +T+ TR+HRGPRRRW
Sbjct: 1128 NVHLR------EQYRSNSFNQLYAQDQSL------------DDTAITIPTRSHRGPRRRW 1169

Query: 1222 NSTTGQNTRTQLATMNTPQSERSKSQNIGEPGSTEDSLHDLFRWQNSGL 1270
            NS+ G        T+ TP S+R ++    E  S  ++  DLFRWQNSG 
Sbjct: 1170 NSSNG-------TTVITPNSDRPRNPPSSE--SENENYKDLFRWQNSGF 1209

>ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YMR280C
            (CAT8)
          Length = 1285

 Score = 1052 bits (2720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 639/1370 (46%), Positives = 798/1370 (58%), Gaps = 192/1370 (14%)

Query: 3    KRERETFAPRIIRTLGXXXXXXXXXXXXXXXXXXXXXXXXXXXVPHVAANNTTMSPTPLN 62
            ++E++ + PRIIRTLG                                    T   +P  
Sbjct: 5    RKEKDGYGPRIIRTLGSQALGGAGGSSRASSVSQSPG----------GPEGATGGASPAA 54

Query: 63   SNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 122
            +    TGT ++S      + +NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD
Sbjct: 55   APQSTTGTPLSS-----LTPTNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 109

Query: 123  KLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKEEQLHLVSKY-------------S 169
            KLSRRAFPRGY                     CDLKEEQL LVSKY             +
Sbjct: 110  KLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKEEQLRLVSKYGCASAPATSSSSAN 169

Query: 170  NKRTSEISENEDEQILQQLSAANGGSLRVSSTNLYLLNKTT-------PGDQQDEEDQMS 222
             K  S+ +  EDEQILQQLS ++GG+LRVSSTNLYLLNK T       P  Q     Q+ 
Sbjct: 170  KKGDSDHTTLEDEQILQQLSNSDGGALRVSSTNLYLLNKKTAAFPLVQPVQQNLSPTQLR 229

Query: 223  SKTTVDCNGVGCNHSHQPNIHD-------KPVS-------------TNLNDPTSISFEQN 262
            S           + +   ++ D        PV+             TNLNDPTSISFEQ+
Sbjct: 230  SNPYTRATLSPSHVAEADHVTDLRKGLPANPVAISSSVGQVPPYPFTNLNDPTSISFEQD 289

Query: 263  EAPGLPAVKALTSMANHEHSVQLATLVALSVPRSTEEILLIPQLLARIGQVHGLTSKQSL 322
            +APGLPAVKAL+S+A+HE S QLA LVA+S+PR+TEEIL +PQLLARIGQ+HG TSKQ L
Sbjct: 290  QAPGLPAVKALSSLASHEESSQLAALVAVSIPRTTEEILFVPQLLARIGQMHGFTSKQCL 349

Query: 323  YTASLLASLKESIPLTLPTNVDMLKSTNLWEVDDVIQFFQTVFKFDIQAESS-------- 374
            YTAS+LASLKE  P    + ++ LK+ NLWE+D+V  F     + DI+  SS        
Sbjct: 350  YTASVLASLKEITPRKTSSILEQLKAKNLWEIDNVDTFLLEGLQIDIRRGSSGDFNLENP 409

Query: 375  ----------TTSQDH--------LIATEIDGLVSDFFSQWYNFIPILDKDEFYNYYNKF 416
                       T   H        L   EI+ L+  FF  WY+ IPI D+ EF +Y+ KF
Sbjct: 410  NGYKLENEYHQTKDAHPELQELTPLTFQEIEELIQLFFDDWYSLIPIFDRSEFESYWVKF 469

Query: 417  KTDLMDPNFFDDEKNLFNKRNKSISYKIFGCILLIICQMGLISKVKAENLPATNKYSQLM 476
            K ++  P FF     LF++R+KSISYKIF C+LL +CQMGL+SKVK E     ++ + LM
Sbjct: 470  KDNVSTPGFFTSGDTLFDRRHKSISYKIFACLLLTVCQMGLMSKVKRERHERGDRLNNLM 529

Query: 477  AYYDIVVRQLMMNPYFNLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLR 536
             YYD  +  ++MNPYF+  STSIQSLQ  SL LFYFLN+G+VS+VY+LRGKVVS++QQLR
Sbjct: 530  TYYDRAISHVIMNPYFSSSSTSIQSLQLLSLLLFYFLNVGDVSNVYELRGKVVSLTQQLR 589

Query: 537  LHRCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVA 596
            LHRCPSAVLG +GS V K QQGERR+LFWG+YYLDVFS+LQLGVPRL+KDHEIECALPV+
Sbjct: 590  LHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVS 649

Query: 597  DNDDQKVNLAGQMIALEGRVSMLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHEN 656
             +DD  VNLAGQMIALEG++S  SLS+IRF+KVLGN+LDSIFKRGM+ S+TKQ++LVHEN
Sbjct: 650  SDDDNHVNLAGQMIALEGKMSPFSLSIIRFSKVLGNVLDSIFKRGMTESMTKQVALVHEN 709

Query: 657  ALDNWRRGLPQQLKFELDVNGTINMDEFNHLKQLDTSGNMYSKENKSL-MVLYFMAKCMI 715
            ALDNWR  LP  L+F+LDVNGTINM++ N LK+   + +   K N ++ M LYF+AK MI
Sbjct: 710  ALDNWRHALPDNLRFQLDVNGTINMEDLNQLKRDYLNKDTALKLNNAIFMALYFLAKIMI 769

Query: 716  HLPVVAKRPLVNDPEQSPESSTPSNNCGDRSSSSYVLLQQATNTLLNVFTSLRNVYPPIP 775
            HLPVVA +P+++ P+   +++ P +   DRSSSSYVLLQQATNT LNV +S+ ++Y P+P
Sbjct: 770  HLPVVATKPIIDKPQPVVDTNIPGSQI-DRSSSSYVLLQQATNTFLNVLSSVSSLYLPLP 828

Query: 776  INVSRTKTRFSLLSARGSLEYTKGGALFQDNKAXXXXXXXXXXXXXXXXXPGTLSWHSLK 835
            +N++RTKTRF L+SARGSLEYTKGGALFQDNK                  PGT+SWHSLK
Sbjct: 829  LNITRTKTRFGLVSARGSLEYTKGGALFQDNKNLLLDLLKDLEADKKLNMPGTISWHSLK 888

Query: 836  LLDMSISLILQPANTKPEKLEKMLQRKLNYYNKLTNRRSNLGGGRSASSPGGNSKRKLDE 895
            LLDM+++LILQP NTKPEK EK+LQ+K+NYYNKL +  S+LG   S  +PG  + RK + 
Sbjct: 889  LLDMAVNLILQPPNTKPEKQEKLLQKKINYYNKLID--SHLGPTASLPTPGQTAPRKPEP 946

Query: 896  NQGSAEPPKLTPASSK---GD------TPP--DKKIKLE------DTGFVPVRAVSQ--- 935
                  P K  P SSK   GD       PP  +KK+KLE       T   P+ A+ +   
Sbjct: 947  AHARPIPEKEKPPSSKRHRGDDNAAASMPPLLEKKVKLEAPASNMPTPPAPISALHEDVP 1006

Query: 936  -----HSQSDSEKFENFQPPVAPQ--------NSIAEAFHLDPVLNNNPFSNTDLNAFFN 982
                 H  ++S           P+        N+I EAF LDP+L   PFSNTDL +FF 
Sbjct: 1007 RVLDGHLGANSS-LAVLAAKHEPEGSLHSSAGNAITEAFQLDPILQPTPFSNTDLPSFFG 1065

Query: 983  TNNGNVPAALR--SGGSLFXXXXXXXXXXXXXXXXXXXXXXXEGLFKVPSNGDFLKDYYN 1040
             +    P  L+    G                          + LFKVPSNGDFLKDYY+
Sbjct: 1066 VDQYAAPPELQPFPAGYAAPDKVPQAAAQGPSATAGPPLSSKDSLFKVPSNGDFLKDYYS 1125

Query: 1041 -VPGAXXXXXXXXXXXXXXXXGKPQLNGSSAHSGTQAQNNDNNGFGFAVDASWGLAPLLE 1099
             +  A                  PQ + + +  G Q Q     G+GF VDAS GLAPLL 
Sbjct: 1126 GMSSAQLNSLFTAPDRRDVRPRAPQPDRAPS-DGLQQQ----PGYGFVVDASLGLAPLLA 1180

Query: 1100 WSPAGKPVDPGTCNANENSIILDTSAANMESEMATGGRLHSNTRSYTDAKNLDIVPTLPS 1159
            WSP  +P D          ++LD   A + S            RS+T    L  +PTL  
Sbjct: 1181 WSP--RPAD---------DLLLDDKGAKLAS-----------ARSFTHVNKLSSIPTL-- 1216

Query: 1160 SKXXXXXXHRLQKGASQQPRSASIPTRKQSLCESNPTTATGSRDDGVLTMGTRNHRGPRR 1219
                           S QP  AS P  K  L +  P      +DDG+LT+  R+ RGPRR
Sbjct: 1217 --------------MSTQPPPASAPHAK--LGQPAPP----DQDDGILTIPPRDQRGPRR 1256

Query: 1220 RWNSTTGQNTRTQLATMNTPQSERSKSQNIGEPGSTEDSLHDLFRWQNSG 1269
             WNS   Q                          + +DS+ DLFRWQNSG
Sbjct: 1257 LWNSALNQARPA---------------------AALDDSISDLFRWQNSG 1285

>KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} similar to
            uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
            similar to YMR280C uniprot|P39113 Saccharomyces
            cerevisiae YMR280C CAT8 Zinc cluster transcriptional
            activator
          Length = 1445

 Score = 1015 bits (2625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/947 (56%), Positives = 643/947 (67%), Gaps = 83/947 (8%)

Query: 85   YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXXX 144
            YRVAQACDRCR+KK RCDGKRPQC+QCAAVGFECKISDKLSRRAFPRGY           
Sbjct: 177  YRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYTETLEERVREL 236

Query: 145  XXXXXXXXXXCDLKEEQLHLVSKYSNKRTS---EISENEDEQILQQLSAANGGSLRVSST 201
                      CDLKEEQLHLVSKYSN +     EI   E+EQIL +LS  NGGSLRVSST
Sbjct: 237  EAENRRLVALCDLKEEQLHLVSKYSNSKDENGVEIPSTEEEQILHELSKTNGGSLRVSST 296

Query: 202  NLYLLNK-TTPGDQQDEEDQMSSKTTVDCNGVGCN------HSHQPNIHDK-PVSTNL-- 251
            NLYLLNK  +PGD    E   SS+ ++    V          S + ++ D  P  TN   
Sbjct: 297  NLYLLNKKASPGDDSHIE---SSEPSIPVRKVAITAPSPRIMSPRNSVADSDPSQTNTGN 353

Query: 252  ----------------NDPTSISFEQNEAPGLPAVKALTSMANHEHSVQLATLVALSVPR 295
                             DP  ISFEQNEAPGLPA+KAL+S++ ++   QLATLVA+SVPR
Sbjct: 354  NDHIHSNNNNHNQNNSTDPYGISFEQNEAPGLPALKALSSLSKYKQGTQLATLVAVSVPR 413

Query: 296  STEEILLIPQLLARIGQVHGLTSKQSLYTASLLASLKESIPLTLPTNVDMLKSTNLWEVD 355
            +TEEIL +PQLLARIGQ+HG TSKQ +YTAS+LASLKE+   ++P  +++LK+ NLWE+D
Sbjct: 414  TTEEILFVPQLLARIGQIHGFTSKQCIYTASVLASLKENNISSIPPELEVLKNHNLWEID 473

Query: 356  DVIQFFQTVFKFDIQAESSTT-SQDHLIATEIDGLVSDFFSQWYNFIPILDKDEFYNYYN 414
            DV+ F++ VFK D    ++   S  HL   E++ L+  FF  WY  IP+ DK+EF +YY 
Sbjct: 474  DVLHFWKNVFKLDFMTHTAVDHSSTHLNFAEVEELMQLFFQDWYELIPLFDKNEFNSYYE 533

Query: 415  KFKTDLMDPNFF-DDEKNLFNKRNKSISYKIFGCILLIICQMGLISKVKAENLPATNKYS 473
            KFK ++ DPNFF   +  +FN R +SISYKIF C+L+II QMG++SK+K + +  + K S
Sbjct: 534  KFKLNVTDPNFFVRKDDTVFNNRTRSISYKIFSCLLIIIVQMGMLSKIKRDKI-TSGKLS 592

Query: 474  QLMAYYDIVVRQLMMNPYFNLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQ 533
             LM YYD ++  + +NPYFN ++TSIQ LQ  S+ LFY LN+G++SS+Y+LRGKVVSMSQ
Sbjct: 593  TLMKYYDKLMTHIWINPYFNSRNTSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQ 652

Query: 534  QLRLHRCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECAL 593
            QLRLHRCPSAVLGG+GS VSK QQGERRILFW IYYLDVFSALQLGVPRLLKD EIECAL
Sbjct: 653  QLRLHRCPSAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECAL 712

Query: 594  PVADNDDQKVNLAGQMIALEGRVSMLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISLV 653
            PV  +DD++VNLAGQMIALEG+VS  SLSVIRFAKV+GNILDS FKRGM+ SLTKQ +LV
Sbjct: 713  PVTSDDDRQVNLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRGMTTSLTKQAALV 772

Query: 654  HENALDNWRRGLPQQLKFELDVNGTINMDEFNHLKQLDTS----GNMYSKENKSLMVLYF 709
            HENALDNWR GL + L F+LDVNGTINMDEFN  KQ   S       ++  +  LM LYF
Sbjct: 773  HENALDNWRHGLQKDLFFQLDVNGTINMDEFNQQKQYSKSLSPRTAAFTHNSLVLMTLYF 832

Query: 710  MAKCMIHLPVVAKRPLVNDPEQSPESSTPSNNCGDRSSSSYVLLQQATNTLLNVFTSLRN 769
            MAKCMIHLPVVA +PLV +  Q+P  +   N   DRS SSYVLLQQATNTLLNV T+L +
Sbjct: 833  MAKCMIHLPVVATKPLVAEAIQTPTDNQTENGSVDRSLSSYVLLQQATNTLLNVLTALNS 892

Query: 770  VYPPIPINVSRTKTRFSLLSARGSLEYTKGGALFQDNKAXXXXXXXXXXXXXXXXXPGTL 829
            +Y P+PIN++RTKTRF L SARGSLEYTKGGALFQDNKA                 PG  
Sbjct: 893  IYLPLPINLARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDLVKELETDKKLELPGNT 952

Query: 830  SWHSLKLLDMSISLILQPANTKPEKLEKMLQRKLNYYNKLTNRRSNLGGGRSASSPGGNS 889
            SWHSLKL D+SI+LILQP N+ PEK EKM+Q+K+NYYNKL  +            P    
Sbjct: 953  SWHSLKLFDLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQ------------PTVAV 1000

Query: 890  KRKLDENQGSAEPPKLTPASSKGDTPPDKKIKLED-----------TGFVPVRAVSQHSQ 938
            KRK D        PK T  +S       KK+K+ED           TG       S+   
Sbjct: 1001 KRKRD--------PKATENTS-------KKVKVEDDHSQDNLHNITTGETTDTVHSEELV 1045

Query: 939  SDSEKFENFQPPVAPQN--SIAEAFHLDPVLNNNPFSNTDLNAFFNT 983
             D  K  N    V P+N  +I EAF +DPVLN N FSNTDL   FN+
Sbjct: 1046 KDVPKELN----VYPENYTTIEEAFQMDPVLNTNLFSNTDLKTLFNS 1088

 Score = 65.9 bits (159), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 77/287 (26%), Positives = 105/287 (36%), Gaps = 65/287 (22%)

Query: 1023 EGLFKVPSNGDFLKDYY------------------NVPGAXXXXXXXXXXXXXXXXGKPQ 1064
            + LFKVPSNGDFLKDYY                    P                      
Sbjct: 1180 DSLFKVPSNGDFLKDYYINNMSNTGLSNLHTSSVNKGPSLSQLGSLFMSSGSGTNLPYSN 1239

Query: 1065 LNGSSAH-SGT----QAQNNDNNGFGFAVDASWGLAPLLEWSPAGKPVDPGTCNANE--- 1116
            + G S H SG     Q      +GF FA DAS GLAPLL WSP  KP    + N N+   
Sbjct: 1240 VRGESKHPSGVNLNKQRAQPAMDGFSFAADASLGLAPLLAWSPDAKP-QLNSNNGNDGLN 1298

Query: 1117 --NSIILDTSAANMESEMATGGRLHSNTRSYTDAKNLDIVPT--LPSSKXXXXXXHRLQK 1172
                I+L++   +  +      + H     +  + N   +P     S+       H+   
Sbjct: 1299 PATGIVLESGDNDSTNASVVQLQQHQQQTHHPPSHNSSSIPMGKQSSTSDRQNSHHQDNV 1358

Query: 1173 GASQQPRSASIPT--------RKQSLCESNPTTATGSRDDGV---LTMGTRNHRGPRRRW 1221
            G+     S +IP         + Q L   N T  + +   G     ++ + N RGPRRRW
Sbjct: 1359 GSFHSMHSPTIPEQTSAQGLHQHQMLGMPNSTLNSDTNTGGANVTNSISSTNRRGPRRRW 1418

Query: 1222 NSTTGQNTRTQLATMNTPQSERSKSQNIGEPGSTED-SLHDLFRWQN 1267
            N+    +                      +P S  D S+ DL RWQN
Sbjct: 1419 NNAASSS----------------------DPNSAGDSSVSDLLRWQN 1443

>TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.845
            YMR280C
          Length = 1301

 Score = 1015 bits (2624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 599/1172 (51%), Positives = 739/1172 (63%), Gaps = 109/1172 (9%)

Query: 70   TSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAF 129
            TSV S A+     SN RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC+ISDKLSRRAF
Sbjct: 86   TSVNSAAN-----SNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAF 140

Query: 130  PRGYXXXXXXXXXXXXXXXXXXXXXCDLKEEQLHLVSKY-SNKRTSEISENEDEQILQQL 188
            PRGY                     CD+KE+Q+HLVS + +NK+  +I  N DEQ+LQ+L
Sbjct: 141  PRGYTETLEERVRELEAENRRLVALCDIKEQQIHLVSHFPTNKK--KIGGN-DEQMLQEL 197

Query: 189  SAANGGSLRVSSTNLYLLNKTTPGDQ----QDEEDQMSSKTTVD-----CNGVGCNHSHQ 239
            + AN G LR+SSTNL+LLNK   G Q     + +D M+           C+ + CN+   
Sbjct: 198  TGANNGRLRISSTNLFLLNKARDGKQPATISNGDDHMTKPDHEHTGKHRCDELDCNNK-- 255

Query: 240  PNIHDKPVSTNLNDPTSISFEQNEAPGLPAVKALTSMANHEHSVQLATLVALSVPRSTEE 299
              +H KPVSTNLNDPT+ISFEQNEAPGLPAVKALTSMA  E S QLATLVALSVPRSTEE
Sbjct: 256  --LHSKPVSTNLNDPTAISFEQNEAPGLPAVKALTSMATREQSTQLATLVALSVPRSTEE 313

Query: 300  ILLIPQLLARIGQVHGLTSKQSLYTASLLASLKESIP---LTLPTNVDMLKSTNLWEVDD 356
            IL IPQLLARI Q+HG TSKQ LY+ SLLASLK ++P   L     +D LK+TNLWEVD+
Sbjct: 314  ILFIPQLLARIIQIHGFTSKQCLYSVSLLASLKNNLPGPQLVKWDELDYLKTTNLWEVDN 373

Query: 357  VIQFFQTVFKFDIQAESSTTSQDHLIAT--EIDGLVSDFFSQWYNFIPILDKDEFYNYYN 414
            + +FF    KF+I     +   + L  +  EID LV+ FF  W   IPILDK+EF++YY+
Sbjct: 374  LDKFFHETLKFNILRPGVSDDGESLGLSIKEIDELVNLFFDSWAVHIPILDKEEFFSYYD 433

Query: 415  KFKTDL-MDPNFFDDEKNLFNKRNKSISYKIFGCILLIICQMGLISKVKAENL-PATNKY 472
            K K D+   P  F +  + F +RNK ISYKIF CIL  +CQMGL++KVK E +  A + Y
Sbjct: 434  KLKKDISTQPGLFQEGPSNFARRNKIISYKIFACILFTVCQMGLLTKVKGEKITSADSPY 493

Query: 473  SQLMAYYDIVVRQLMMNPYFNLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMS 532
             +L +YY   +  + +NPYF + +TS+QSLQF SL LFYF+N G VS++Y+LRG+VVSM+
Sbjct: 494  VKLTSYYHRAISLIYLNPYFGVLTTSLQSLQFLSLLLFYFVNTGNVSAIYELRGRVVSMA 553

Query: 533  QQLRLHRCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECA 592
            QQLRLHRCPSAVLGG+GS ++K +QG+RR+LFWGIYYLDVFSALQLGVPRL+KD EIECA
Sbjct: 554  QQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECA 613

Query: 593  LPVADNDDQKVNLAGQMIALEGRVSMLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISL 652
            LPVA+NDD++V+LAGQMI LEGRVS  SL++IRFAKVLGNILD++FKRGM+ S++K+++L
Sbjct: 614  LPVAENDDREVSLAGQMIRLEGRVSQFSLAIIRFAKVLGNILDTVFKRGMTESVSKKLAL 673

Query: 653  VHENALDNWRRGLPQQLKFELDVNGTINMDEFNHLKQLDTSGNMYSKENKSLMVLYFMAK 712
            +HENALDNWRRGLP +L FE++VNGTINMD+FN +KQ   +  + + E   L+V YF+AK
Sbjct: 674  IHENALDNWRRGLPAELIFEIEVNGTINMDKFNEMKQ--NNATVENVEQMVLLVSYFLAK 731

Query: 713  CMIHLPVVAKRPL--VNDP------EQSPESSTPSNNCGDRSSSSYVLLQQATNTLLNVF 764
            CMIHLPVVA RPL   +DP      E+        +N   RSSSSYVLLQQATNT+LNV 
Sbjct: 732  CMIHLPVVATRPLPSSDDPNSDIKEEEEVNDKNGESNFAIRSSSSYVLLQQATNTMLNVL 791

Query: 765  TSLRNVYPPIPINVSRTKTRFSLLSARGSLEYTKGGALFQDNKAXXXXXXXXXXXXXXXX 824
             SL+++Y P+P NV+RTK RF+LLSARGSLEY KGGALF DNKA                
Sbjct: 792  ESLKSIYLPLPFNVARTKARFALLSARGSLEYIKGGALFLDNKALLLDVVKSIEEDRKLE 851

Query: 825  XPGTLSWHSLKLLDMSISLILQPANTKPEKLEKMLQRKLNYYNKLTNR--------RSNL 876
             PG +SWH LKLLDM+ISL+LQP NTK EKL+++L++KLNYY+++  R        R   
Sbjct: 852  IPGVISWHGLKLLDMTISLLLQPPNTKVEKLDRLLKKKLNYYSRVMGRPILKTSSLRQEA 911

Query: 877  GGGRSASSPGGNSKRKLDENQGSAEPPKLTPASSKGD-TPPDKKIKLEDTGFVPVRAVSQ 935
             G R  SS    S+   +EN        LTP SSK D +P +KKIKLED       A+  
Sbjct: 912  NGKRRNSSDDKLSRSGTEEN---FRATNLTPISSKSDGSPVEKKIKLEDESSDTSNALVD 968

Query: 936  HSQSDSEKFENFQP--PVAPQNSIAEAFHLDPVLNNNPFSNTDLNAFFNTNNGNVPAALR 993
             S +D       QP  P + Q +IAEA HLDPVLNNN  S  DL AFF    GN+PAA  
Sbjct: 969  KSYTDDLSSSANQPQVPASTQTAIAEALHLDPVLNNNILSVADLAAFF---GGNMPAAGG 1025

Query: 994  SGGSLFX----------XXXXXXXXXXXXXXXXXXXXXXEGLFKVPSNGDFLKDYYNVPG 1043
            +  S +                                 +GLF+VPSN DFL D Y   G
Sbjct: 1026 NQHSSYTNQNDFAPKHMRKEKEPAAFSDLAHKKSSVTGVDGLFRVPSNADFLMDEYYPSG 1085

Query: 1044 AXXXXXXXXXXXX---------XXXXGK-----PQLNGSSAHSGTQAQN----------- 1078
                                      GK        N    H  T   +           
Sbjct: 1086 TSHINLTLFNNNANNHDDTFGLSDGHGKDTGVNTNFNVKGGHQSTNHSHLTNFNDRLQGN 1145

Query: 1079 --------NDNNG--FGFAVDASWGLAPLLEWSPAGKPVDPGTCNANENS-IILDTSAAN 1127
                    N N+G  F FAVDAS GLAPLL+WSP          +A++ S IILD+S   
Sbjct: 1146 QLGFTNSGNMNSGSDFNFAVDASLGLAPLLDWSPEMHTHGKTVSHASDRSGIILDSSIPQ 1205

Query: 1128 MESEMATGGRLHSNTRSYTDAKNLDIVPTLPS 1159
             E  ++T     + T+S         VPTL S
Sbjct: 1206 SEDALSTLADRVNKTQSVP-------VPTLAS 1230

>ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa]
            {ON} similar to uniprot|Q75DZ4 Ashbya gossypii ABL121C
            ABL121Cp and similar to YMR280C uniprot|P39113
            Saccharomyces cerevisiae YMR280C CAT8 Zinc cluster
            transcriptional activator
          Length = 1250

 Score =  968 bits (2503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/1144 (49%), Positives = 711/1144 (62%), Gaps = 158/1144 (13%)

Query: 78   TPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYXXXX 137
            +PA + N RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD+LSRRAFPRGY    
Sbjct: 91   SPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGYTETL 150

Query: 138  XXXXXXXXXXXXXXXXXCDLKEEQLHLVSKYSNKRTSEISENEDEQILQQLSAANGGSLR 197
                             CD+KE+Q+HL   +S + +      +DE++L++L +ANGGSL 
Sbjct: 151  EERVRELEAENRRLVALCDIKEQQIHL---FSQQHSPGGRRKDDERMLRELQSANGGSLN 207

Query: 198  VSSTNLYLLNKTTPGDQQDEEDQMSSKTTVD------CNGVGCNHSHQPNIHDKPVSTNL 251
            +SSTNLYLLN  +   Q  +  Q   + T        C+G+ C       +H KPVSTNL
Sbjct: 208  ISSTNLYLLNTGSHQRQGPQGPQQQEQLTQQKRQPHVCDGLCC----AGKLHVKPVSTNL 263

Query: 252  NDPTSISFEQNEAPGLPAVKALTSMANHEHSVQLATLVALSVPRSTEEILLIPQLLARIG 311
            NDPTS+SFEQ+EAPGLPAV+ALTS+A  E S QLATLVALSVPRSTEEIL IPQLLARI 
Sbjct: 264  NDPTSVSFEQSEAPGLPAVQALTSVATREQSNQLATLVALSVPRSTEEILFIPQLLARIR 323

Query: 312  QVHGLTSKQSLYTASLLASLKESIP---LTLPTNVDMLKSTNLWEVDDVIQFFQTVFKFD 368
            Q++G TSKQ LYT SLL+SLK S+P   L     ++ L STNLWE+DD+ QFF  +FKF 
Sbjct: 324  QIYGFTSKQCLYTVSLLSSLKSSLPEPHLVKHEPLETLASTNLWEMDDLEQFFAEIFKFK 383

Query: 369  IQAESSTTSQD--HLIATEIDGLVSDFFSQWYNFIPILDKDEFYNYYNKFKTDLMDPNFF 426
            ++++S ++ +    L  +EI+ L+S FF      IPIL KDEFY+Y+N+FK +++    F
Sbjct: 384  LESKSPSSYKGGAQLNLSEIEELISIFFEHSSIHIPILVKDEFYHYFNQFKENVLQNLEF 443

Query: 427  DDEK----NLFNKRNKSISYKIFGCILLIICQMGLISKVKAENLPATNKYSQLMAYYDIV 482
                     L  +R K ISYKIFGCI+L++CQ+GL+SK+KAENL AT+K+ +L +YY   
Sbjct: 444  LKTPLQGPALTARRGKIISYKIFGCIILMLCQLGLLSKIKAENLGATSKHHRLASYYHKA 503

Query: 483  VRQLMMNPYFNLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPS 542
            +  + MNPYF + STS+QSLQF SL LFYFLNIG VS++Y+LRG+VVSM+QQLRLHRCPS
Sbjct: 504  ISLVYMNPYFGVLSTSLQSLQFLSLVLFYFLNIGNVSAIYELRGRVVSMAQQLRLHRCPS 563

Query: 543  AVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQK 602
            AVLGG GS ++K +QG+RR+LFWGIYYLDVFSALQLGVPRL+KD EIECALPVADNDD+ 
Sbjct: 564  AVLGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVADNDDRT 623

Query: 603  VNLAGQMIALEGRVSMLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHENALDNWR 662
            VNLAGQ I LEG+V+  SL++IRF+KVLGNILDSIFKRGM+ S+TKQ+SL+HENALDNWR
Sbjct: 624  VNLAGQQIRLEGQVTNYSLAIIRFSKVLGNILDSIFKRGMTESITKQVSLIHENALDNWR 683

Query: 663  RGLPQQLKFELDVNGTINMDEFNHLKQLDTSGNMYSKENKSLMVLYFMAKCMIHLPVVAK 722
             GLP++L FELDVNGTIN+DEFN LKQ++ +  +   EN +L+V+YF+AKCMIHLPVVA 
Sbjct: 684  HGLPKELIFELDVNGTINIDEFNRLKQMNVT--VERSENMTLLVMYFLAKCMIHLPVVAT 741

Query: 723  RPL-VNDPEQSPESSTPSNN----------------CGDRSSSSYVLLQQATNTLLNVFT 765
            RPL  ND   + E+S  ++N                  DRSSSSYVLLQQATNT+LNV  
Sbjct: 742  RPLPTNDSNDTGETSNATSNGNNVRARDPSTERNQAAADRSSSSYVLLQQATNTMLNVLE 801

Query: 766  SLRNVYPPIPINVSRTKTRFSLLSARGSLEYTKGGALFQDNKAXXXXXXXXXXXXXXXXX 825
            SL+ ++ P+P+N+SRTK RF+LLSARGSLEYTKGGALF DNK+                 
Sbjct: 802  SLKTLFLPLPLNISRTKARFALLSARGSLEYTKGGALFLDNKSLLLDVIKDLEEDRKLDL 861

Query: 826  PGTLSWHSLKLLDMSISLILQPANTKPEKLEKMLQRKLNYYNKLTNRRSNLGGGRSASSP 885
            PG +SW+SLKLLDMSI+L+LQP NT+  KL+++L++KLNYYN+L  R +           
Sbjct: 862  PGVISWNSLKLLDMSINLLLQPPNTEVGKLDRLLKKKLNYYNRLMGRPTV---------- 911

Query: 886  GGNSKRKLDENQGSAEPPKLTPASSKG--DTPPDKKIKLEDTGF-VPVRAVSQHSQSDSE 942
                     + + +++   LTPASSK   DTP  K+IK+E+T   + V    QH Q+ + 
Sbjct: 912  ---------KQEPASKGHDLTPASSKDEEDTPAAKRIKIEETSIPLAVPQQQQHMQAPA- 961

Query: 943  KFENFQPPVAPQN------------------------------SIAEAFHLDPVLNNN-P 971
                   PV  Q                               + AEA  LDPVLN+N  
Sbjct: 962  -------PVMVQEKQQPQPQPQPQPQPQPQLQPQPQQLQLPQTAFAEALQLDPVLNSNVS 1014

Query: 972  FSNTDLNAFFNTNNGNVPAALRSG--GSLFXXXXXXXXXXXXXXXXXXXXXXXEGLFKVP 1029
            F N              P  L  G                              GLFKVP
Sbjct: 1015 FQNAP------------PTTLYDGPHDQPHQYQHHAQTQPQDPHLDTRSSDKLHGLFKVP 1062

Query: 1030 SNGDFLKD-------------------------YYNVPGAXXXXXXXXXXXXXXXXGKPQ 1064
            S  DFL D                         Y N PG+                    
Sbjct: 1063 STADFLMDDSANSQLNFLLGTTELGVLDPSQPSYTNNPGSGSAIGINNMPSGLNLSNLFD 1122

Query: 1065 LNGSSAH-----SGTQAQNNDNNGFGFAVDASWGLAPLLEWSPAGKPVDPGTCNANENSI 1119
            L GS+       + TQA   ++ GF FAVDAS GLAPLL W+P            + N I
Sbjct: 1123 LEGSTDQPPTNTNATQATQANSGGFNFAVDASLGLAPLLAWTP------------DHNGI 1170

Query: 1120 ILDT 1123
            +LD 
Sbjct: 1171 VLDV 1174

>KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {ON}
           Anc_8.845 YMR280C
          Length = 1246

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/1001 (44%), Positives = 590/1001 (58%), Gaps = 142/1001 (14%)

Query: 81  SASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYXXXXXXX 140
           S+SNYRV QACDRCRSKKTRCDG++PQCSQCAAVGFECK+SDKL R+A+PRGY       
Sbjct: 22  SSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESIEER 81

Query: 141 XXXXXXXXXXXXXXCDLKEEQLHLVSKYSNKRTSE-------ISENEDEQILQQLSAA-- 191
                         CDLKE+Q+ LV+KYS+ +++        I  N D      +     
Sbjct: 82  VRELEAENRRLLALCDLKEQQISLVAKYSSNKSNILPTDRCIIELNSDSDCTNNIKGELN 141

Query: 192 -----------NGGSLRVSSTNLYLLNKTTP------GDQQDEEDQM------------- 221
                      N   L +S TNLYLLN+T        G++  +++Q              
Sbjct: 142 KDRQNDVTTIPNSLPLNISQTNLYLLNQTQKKAELNNGNKMFQQNQSNVSTSSSSSPFFA 201

Query: 222 ------------SSKTTVD------------------------CNGVGCNHSHQPNIHDK 245
                        S TTV                         C+G+ C       +H +
Sbjct: 202 NKLNSNGTIRSPESNTTVSPLESHTKNLKSNIRNNNTTTTTHVCDGICCTDK----LHPQ 257

Query: 246 PVSTNLNDPTSISFEQNEAPGLPAVKALTSMANHEHSVQLATLVALSVPRSTEEILLIPQ 305
           PV+TN NDPTSISFEQ+EAPGL A KAL S+ N E + QLA LV+LSVPRSTEEIL IPQ
Sbjct: 258 PVATNYNDPTSISFEQSEAPGLVAAKALKSINNQEEATQLAILVSLSVPRSTEEILFIPQ 317

Query: 306 LLARIGQVHGLTSKQSLYTASLLASL-------KESIPLTLPTNVDMLKSTNLWEVDDVI 358
           LLA+I QVHG TSKQ LYT SLL+SL       K    +    N  +LK+TN+W+++D+ 
Sbjct: 318 LLAKIRQVHGFTSKQCLYTVSLLSSLKNSLPSPKSDFLMDNSQNSLLLKNTNIWQINDLN 377

Query: 359 QFFQTVFKFDIQAESSTTSQDHLIATEIDGLVSDFFSQWYNFIPILDKDEFYNYYNKFKT 418
            FF  + KF+I  +S T++   L   +ID L + +F+ W N IP+L+++EF+N YN FK 
Sbjct: 378 VFFTDLLKFNISNDSKTSTL--LSFDDIDDLTNLYFNHWSNLIPVLNEEEFFNRYNNFKI 435

Query: 419 DLMDPNFFDDEKNLFNKRNKSISYKIFGCILLIICQMGLISKVKAENLPATNKYSQLMAY 478
                +F        N+ N    YK FGC L+++CQMGL+ K+K     + N   +++ Y
Sbjct: 436 QCQ--SFIQG-----NQSNNLRDYKFFGCFLMVMCQMGLLIKLKEH--KSNNSLFKILTY 486

Query: 479 YDIVVRQLMMNPYFNLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLH 538
           Y  +   L  NP ++  +TSI+S+Q  +L LFY LN+G +  +Y+LRG ++SM+ QLRLH
Sbjct: 487 YHQLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGNIEQIYELRGNIISMAHQLRLH 546

Query: 539 RCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADN 598
           RCPSAVL G+GS + K +Q  RR+LFW IYYLDVFS+LQLGVPRLLKD+EIECALPV DN
Sbjct: 547 RCPSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKDYEIECALPV-DN 605

Query: 599 DDQKVNLAGQMIALEGRVSMLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHENAL 658
                 + G  I LEG VS +SL++ RFAKVLGNI+DSIFKR MS S+++Q++L+HENAL
Sbjct: 606 TTTMDAIDGTSIKLEGTVSQISLTLFRFAKVLGNIVDSIFKRNMSTSISRQVALIHENAL 665

Query: 659 DNWRRGLPQQLKFELDVNGTINMDEFNHLKQLDTSGNMYSKENKSLMVLYFMAKCMIHLP 718
           DNWR  LP+Q +F+LDVNGTIN+++      LDT     + +   L+V YF+AKCMIHLP
Sbjct: 666 DNWRSRLPEQFQFKLDVNGTINLND------LDTE----NSDTIFLIVFYFLAKCMIHLP 715

Query: 719 VVAKRPLVNDPEQSPESSTPSNNCGDRSSSSYVLLQQATNTLLNVFTSLRNVYPPIPINV 778
           V + +  + D      +    N   DR S+SYV LQQ+TNT+LN    +R+ Y P+P NV
Sbjct: 716 VCSTKVDLEDKVTETGNDVIYN---DRFSTSYVSLQQSTNTMLNALRMIRDKYLPMPFNV 772

Query: 779 SRTKTRFSLLSARGSLEYTKGGALFQDNKAXXXXXXXXXXXXXXXXXPGTLSWHSLKLLD 838
           SRT TRF+L+SA+GSL+Y KGG+LF DNK                  PG +SWHSLKLLD
Sbjct: 773 SRTLTRFTLISAKGSLDYIKGGSLFIDNKKLLLDCVQDIEANRKLDLPGIISWHSLKLLD 832

Query: 839 MSISLILQPANTKPEKLEKMLQRKLNYYNKL----------TNRRSNLGGGRSASSPGGN 888
           ++++L LQ +NTKPEK+EK+LQ+KLNYYNKL            +R+N   G +   P   
Sbjct: 833 LTLNLFLQNSNTKPEKIEKLLQKKLNYYNKLMGKPLVKNLPIQKRTNQNKGNNNDEPSRK 892

Query: 889 SKRKLDENQGSAEPPKLTPASSKGDTPPDKKIKLEDTGFVPVRAVSQHSQSDSEKFENFQ 948
             +K  EN  ++  P                I +++ G  P  A    ++++S       
Sbjct: 893 KVKKELENDINSLHP----------------ILIDNEGVTPSDAAPLINKTNSNT---NN 933

Query: 949 PPVAPQNSIAEAFHLDPVLNNN--PFSNTDLNAFFNTNNGN 987
           P V  QN  AEA  +DP+LN++   FSN DL   FN++  N
Sbjct: 934 PVVTTQNEFAEALQVDPILNSDYYQFSNLDLATLFNSDKLN 974

>Suva_13.468 Chr13 complement(809712..812654,812694..814007) [4257 bp,
            1418 aa] {ON} YMR280C (REAL)
          Length = 1418

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/1076 (42%), Positives = 606/1076 (56%), Gaps = 134/1076 (12%)

Query: 5    ERETFAPRIIRTLGXXXXXXXXXXXXXXXXXXXXXXXXXXXVPHVAANNTTMSPTPLNSN 64
            +R+   PRIIRTLG                            PH A N       P  S 
Sbjct: 6    DRQGLEPRIIRTLGSQTLGTTN-------------------APHKALN---TEANPNFSE 43

Query: 65   NMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKL 124
            N+     + + + TP S   YR+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC+ISDKL
Sbjct: 44   NIKEAL-IKTNSPTPLSTPIYRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKL 102

Query: 125  SRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKEEQLHLVSKYSNKRTSEISENEDEQI 184
             R+A+P+GY                     CD+KE+Q++LVS+  ++  + +     +  
Sbjct: 103  LRKAYPKGYTESLEERVRELEAENKRLLALCDIKEQQINLVSQ--SRPPTSLDNTVSDNF 160

Query: 185  LQQLSAANGGSLRVSSTNLYLLNKTTPGDQQDEE-DQMSSKTTVD--------------C 229
             Q L  A    L +SSTN+YLLN+T     Q+ + D   S +T+               C
Sbjct: 161  KQDLKDA---PLNLSSTNIYLLNQTVNKQLQNGKIDTNRSDSTMGLLATSPPLPQKDHVC 217

Query: 230  NGVGCNHSHQPNIHDKPVSTNLNDPTSISFEQNEAPGLPAVKALTSMANHEHSVQLATLV 289
            +GV C +    N+H KP ST+LNDPT+ISFEQNEAPGLPAVKAL SM  H+ S QLATLV
Sbjct: 218  DGVSCTN----NLHAKPTSTSLNDPTAISFEQNEAPGLPAVKALKSMTTHQRSTQLATLV 273

Query: 290  ALSVPRSTEEILLIPQLLARIGQVHGLTSKQSLYTASLLASLKESIP---LTLPTN---- 342
            +LS+PRSTEEIL IPQLL RI Q+ G  SKQ LYT SLL+SLK  +P   L L +     
Sbjct: 274  SLSIPRSTEEILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPKLLLSSTSTKI 333

Query: 343  --------VDMLKSTNLWEVDDVIQFFQTVFKFDI--------QAESSTTSQDHLIATEI 386
                    ++  ++T+L E  D+ +F  ++ KFDI        + +++ +  D L   EI
Sbjct: 334  KENDDSKFLNTFETTSLAEFGDLKKFLISL-KFDINSFSNQQPEVQNNKSDNDLLSLNEI 392

Query: 387  DGLVSDFFSQWYNFIPILDKDEFYNYYNKFKTDLMDPNFFDDEKNLFNKRNKSISYKIFG 446
              L+  FF  W N + IL+ D F  Y+N F  +++     + +K    K + + +++IF 
Sbjct: 393  KELLHLFFKFWSNQVSILNNDHFLLYFNNF-VEVIKALPLELKKTNGTKTHATTNHQIFA 451

Query: 447  CILLIICQMGLISKVKAENLPAT------NKYSQLMAYYDIVVRQLMMNPYF-NLKSTSI 499
              LLI+ QMGL+ KVK E +  T      +K+++LM YY  V   +  NPYF N+ +TS+
Sbjct: 452  LKLLIMLQMGLLIKVKREKIKDTVPGNQNSKFAKLMVYYHQVSSIIPKNPYFLNMSTTSL 511

Query: 500  QSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAV-SKAQQG 558
             SLQ  SL  FYFLN+G++ ++Y LRG++VSMSQQLRLHRCPSAVL  + + V  + +Q 
Sbjct: 512  PSLQLLSLTSFYFLNVGDIPAIYGLRGRIVSMSQQLRLHRCPSAVLSVHSNPVLQRFEQS 571

Query: 559  ERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADN--DDQ------KVNLAGQMI 610
            ERR+LFW +YY+DVF++LQLGVPRLLKD +IECALP++D   +DQ      K     + I
Sbjct: 572  ERRLLFWAVYYIDVFASLQLGVPRLLKDFDIECALPISDVEFEDQLASENEKTKNKTKKI 631

Query: 611  ALEGRVSMLSLSVIRFAKVLGNILDSIFKRG-MSASLTKQISLVHENALDNWRRGLPQQL 669
             L+G+VS  SL +IRFAK+LGNILDSIFKRG M   +T +++LVHENALDNWR  LP+  
Sbjct: 632  QLQGQVSSFSLQIIRFAKILGNILDSIFKRGMMDERVTSEVALVHENALDNWRNQLPEMY 691

Query: 670  KFELDVNGTINMDEFNHLKQLDTSGNMYSK-----ENKSLMVLYFMAKCMIHLPVVAKRP 724
             F++ VNGT+N+D+       +T      K     E   L++ YF+AK MIHLPV+A +P
Sbjct: 692  YFQITVNGTVNLDDIRANNSRNTEAKFDRKDIICFEKNVLLLFYFLAKSMIHLPVIATKP 751

Query: 725  LVNDPEQSPE-------SSTPSNNCGD-------------RSSSSYVLLQQATNTLLNVF 764
            L    + S +       + T S N  D             R+SSSY++LQQATN  L +F
Sbjct: 752  LPKTVDNSTKKKHSMFNNDTKSINNQDHSVVDVDMTSPAIRTSSSYIILQQATNATLTLF 811

Query: 765  TSLRNVYPPIPINVSRTKTRFSLLSARGSLEYTKGGALFQDNKAXXXXXXXXXXXXXXXX 824
             S+ +VY P+P+NVSRT  RFSLL ARGSLEYTKGGALF DNK                 
Sbjct: 812  QSINSVYLPLPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLD 871

Query: 825  XPGTLSWHSLKLLDMSISLILQPANTKPEKLEKMLQRKLNYYNKL-------TNRRSNLG 877
             PG  SWH+LKL DM+I+L+L+  N K E+L+K L++KLNYYN+L       T     L 
Sbjct: 872  LPGVASWHTLKLFDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPPTTTTSSEPLF 931

Query: 878  GGRSASSPGGNSKRKLDENQGSAEPPKLTPASSKGDTPPDKKIKLEDTGFVPVRAVSQHS 937
              +S ++P   S+  + + +            + G+T  DK    ED   V  R   + S
Sbjct: 932  SSQSKNTPANGSRSSIVKRENPENEYLYGDGINNGNTDMDKP-STEDARNVNKRLKHEKS 990

Query: 938  QSDSEKFENFQPPVAPQNSIAEAFHLDPVLNNN-------PFSNTDLNAFFNTNNG 986
             S S   +N       +N     F  D   N +        FSNTDL A F    G
Sbjct: 991  ISQSIDDDNMS-----RNQNGSKFQQDSKKNMSTSNLFPFSFSNTDLTALFTNPEG 1041

 Score = 40.4 bits (93), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 82/192 (42%), Gaps = 32/192 (16%)

Query: 1084 FGFAVDASWGLAPLLEWSP--AGKPVDPGTCNANENSIILDTSAANMESEMATGGRLHSN 1141
            + + VDAS GLAPLL  +P  +       T N ++NSIILD +  N +S+     R HSN
Sbjct: 1251 YDYIVDASLGLAPLLVDTPDISNTNTTSTTSNRSKNSIILDPTF-NDDSD-----RSHSN 1304

Query: 1142 TRSYTDAKNLDIVPTLPSSKXXXXXXHR--LQKGASQQPRSASIPTRKQSLCESNPTTAT 1199
             R   +  +  +  ++ SS       ++  L  G   +    S    K +  E   T +T
Sbjct: 1305 AREVLNPTDSILSQSVISSISPRTTSNQRSLSSGNYSKSNGNSRKNSKNAKGEQLDTPST 1364

Query: 1200 GSRDDGVLTMGTRNHRGPRRRWNSTTGQNTRTQLATMNTPQSERSKSQNIGEP---GSTE 1256
              +     +  + +HRGPRR                   P   R  + +   P   GS  
Sbjct: 1365 LFKMKRTSSSSSTSHRGPRR-------------------PPKHRYGTDHPKSPSDVGSNT 1405

Query: 1257 DSLHDLFRWQNS 1268
            D+L DLF+WQN+
Sbjct: 1406 DNLPDLFQWQNA 1417

>YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}
            CAT8Zinc cluster transcriptional activator necessary for
            derepression of a variety of genes under non-fermentative
            growth conditions, active after diauxic shift, binds
            carbon source responsive elements
          Length = 1433

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/1111 (41%), Positives = 619/1111 (55%), Gaps = 171/1111 (15%)

Query: 5    ERETFAPRIIRTLGXXXXXXXXXXXXXXXXXXXXXXXXXXXVPHVAANNTTMSPTPLNSN 64
            +R+   PR+IRTLG                            P ++   ++    P  S 
Sbjct: 7    DRQGLEPRVIRTLGSQALSG----------------------PSISNRTSSSEANPHFSK 44

Query: 65   NMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKL 124
            N+     + + + TP S   YR+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC+ISDKL
Sbjct: 45   NVKEAM-IKTASPTPLSTPIYRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKL 103

Query: 125  SRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKEEQLHLVSKYSNKRTSEISENEDEQI 184
             R+A+P+GY                     CD+KE+Q+ LVS+   + +++ + N + + 
Sbjct: 104  LRKAYPKGYTESLEERVRELEAENKRLLALCDIKEQQISLVSQSRPQTSTDNTINGNFK- 162

Query: 185  LQQLSAANGGSLRVSSTNLYLLNKTTPGDQQ----DEEDQMSSKTTVD-----------C 229
               L  A    L +SSTN+YLLN+T     Q    D ++  S+ + +            C
Sbjct: 163  -HDLKDA---PLNLSSTNIYLLNQTVNKQLQNGKMDGDNSGSAMSPLGAPPPPPHKDHLC 218

Query: 230  NGVGC-NHSHQPNIHDKPVSTNLNDPTSISFEQNEAPGLPAVKALTSMANHEHSVQLATL 288
            +GV C NH     +H KP ST+LNDPT+ISFEQ+EAPGLPAVKAL SM  H+ S QLATL
Sbjct: 219  DGVSCTNH-----LHVKPTSTSLNDPTAISFEQDEAPGLPAVKALKSMTTHQRSTQLATL 273

Query: 289  VALSVPRSTEEILLIPQLLARIGQVHGLTSKQSLYTASLLASLKESIP---LTLPTN--- 342
            V+LS+PRSTEEIL IPQLL RI Q+ G  SKQ LYT SLL+SLK  +P   L  P+    
Sbjct: 274  VSLSIPRSTEEILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPRLLAPSTSTK 333

Query: 343  ----------------VDMLKSTNLWEVDDVIQFFQTVFKFDI-----QAESSTTSQDH- 380
                            V   +STNL E  D+ +F  ++ KF+I     Q+E     QD  
Sbjct: 334  LKEKDEDKKLDDDSAFVKRFQSTNLSEFVDLKKFLISL-KFNINSFSKQSEKPANDQDDE 392

Query: 381  -LIATEIDGLVSDFFSQWYNFIPILDKDEFYNYYNKFKTDLMDPNFFDDEKNLFNKRNKS 439
             L  TEI  L+  FF  W N +PIL+ D F  Y+N F   +   +  + E N   K   +
Sbjct: 393  LLSLTEIKELLHLFFKFWSNQVPILNNDHFLIYFNNFVEVVKHLSTENLETNNTTKSTVT 452

Query: 440  ISYKIFGCILLIICQMGLISKVKAENLPAT------NKYSQLMAYYDIVVRQLMMNPYF- 492
             +++IF   LL++ QMGL+ K+K E +  T       KY++LMAYY  +   +  NPYF 
Sbjct: 453  TNHEIFALKLLMMLQMGLLVKIKMEKIKYTVPKNPKAKYARLMAYYHQLSLIIPKNPYFL 512

Query: 493  NLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAV 552
            N+ +TS+ SLQ  SL  FY+LN+G++S++Y +RG++VSM+QQLRLHRCPSAVL  + + V
Sbjct: 513  NMSTTSLPSLQLLSLASFYYLNVGDISAIYGVRGRIVSMAQQLRLHRCPSAVLSVHSNPV 572

Query: 553  -SKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVAD--------NDDQKV 603
              K +Q ERR+LFW IYY+DVF++LQLGVPRLLKD +IECALP++D         +++K 
Sbjct: 573  LQKFEQSERRLLFWAIYYVDVFASLQLGVPRLLKDFDIECALPISDVEYKDQLSMENEKA 632

Query: 604  NLAGQMIALEGRVSMLSLSVIRFAKVLGNILDSIFKRG-MSASLTKQISLVHENALDNWR 662
            +   + I L+G+VS  SL +IRFAK+LGNILDSIFKRG M   +T +++LVHENALDNWR
Sbjct: 633  DKKAKKIQLQGQVSSFSLQIIRFAKILGNILDSIFKRGMMDERITSEVALVHENALDNWR 692

Query: 663  RGLPQQLKFELDVNGTINMDEFNHLKQLDTSGNMYSK-----ENKSLMVLYFMAKCMIHL 717
              LP+   F++ VNGT+N+DE     Q +T      K     E K L++ YF+AK MIHL
Sbjct: 693  NQLPEMYYFQITVNGTVNLDEIRATNQRNTETKFDKKDIILFEKKILLLFYFLAKSMIHL 752

Query: 718  PVVAKRPL---VNDPEQSPESSTPSNNCGD-----------------RSSSSYVLLQQAT 757
            PV+A +PL   V++  +  +S   +++ G                  R+SSSY++LQQAT
Sbjct: 753  PVIATKPLPKNVDNATKKKQSMFNNDSKGATNQDHMILDVDMTSPAIRTSSSYIILQQAT 812

Query: 758  NTLLNVFTSLRNVYPPIPINVSRTKTRFSLLSARGSLEYTKGGALFQDNKAXXXXXXXXX 817
            N  L +F ++ ++Y P+P+NVSRT  RFSLL ARGSLEYTKGGALF DNK          
Sbjct: 813  NATLTIFQAINSMYLPLPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDI 872

Query: 818  XXXXXXXXPGTLSWHSLKLLDMSISLILQPANTKPEKLEKMLQRKLNYYNKLTNRRSNLG 877
                    PG  SWH+LKL DMSI+L+L+  N K E+L+K L++KLNYYN+L      +G
Sbjct: 873  ENDRLLDLPGIASWHTLKLFDMSINLLLKAPNVKVERLDKFLEKKLNYYNRL------MG 926

Query: 878  GGRSASSP-----GGNSKRKLDENQGSAEPPKLTP--------------ASSKGDTP--- 915
               + ++      G  SK  L+  Q +    +  P               S  G +P   
Sbjct: 927  LPPATTTSLKPLFGSQSKNSLENRQRTPNVKRENPEHEYLYGNDSNNNNNSEAGHSPMTN 986

Query: 916  ---PDKKIKLEDTGFVPVRAVSQHSQSDSEKFENFQPPVAPQNSIAEAFHLDPVLNNNPF 972
                +K++K E       R       S  E   NFQ       S +  F          F
Sbjct: 987  TTNGNKRLKYEKDA---KRNAKDGGISKGENAHNFQNDTKKNMSTSNLFPFS-------F 1036

Query: 973  SNTDLNAFF---------NTNNGNVPAALRS 994
            SNTDL A F         NTNNGNV    R+
Sbjct: 1037 SNTDLTALFTHPEGPNCTNTNNGNVDVCNRA 1067

 Score = 35.4 bits (80), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 88/200 (44%), Gaps = 48/200 (24%)

Query: 1084 FGFAVDASWGLAPLLEWSP--AGKPVDPGTCNANENSIILDTSAANMESEMATGGRLHSN 1141
            + + VDAS GLAPLL  +P  +       T N ++NSIILDT+      ++         
Sbjct: 1266 YDYIVDASLGLAPLLVDTPDISNTNTTSTTSNRSKNSIILDTT---FNDDL--------- 1313

Query: 1142 TRSYTDAKNLDIVPTLPSSKXXXXXXHRLQKGASQQPRSASIPTRKQSLCESNPTTATGS 1201
             RS  +A+ + + PT              +  ++Q+  S+   ++  S  + N  +ATG+
Sbjct: 1314 DRSRMNAREV-LNPTDSILSQGMVSSVSTRNTSNQRSLSSGNDSKGDSSSQENSKSATGN 1372

Query: 1202 RDDGVLTM---------GTRNHRGPRR----RWNSTTGQNTRTQLATMNTPQSERSKSQN 1248
            + D   T+          + +HRGPRR    R+N  T ++  +   + NT          
Sbjct: 1373 QLDTPSTLFQMRRTSSGPSASHRGPRRPQKNRYN--TDRSKSSGGGSSNT---------- 1420

Query: 1249 IGEPGSTEDSLHDLFRWQNS 1268
                    D++ DLF+WQN+
Sbjct: 1421 --------DNVSDLFQWQNA 1432

>Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] {ON}
            YMR280C (REAL)
          Length = 1433

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/1086 (41%), Positives = 619/1086 (56%), Gaps = 156/1086 (14%)

Query: 5    ERETFAPRIIRTLGXXXXXXXXXXXXXXXXXXXXXXXXXXXVPHVAANNTTMSPTPLNSN 64
            +R+   PR+IRTLG                            P+++ N T  S    +S+
Sbjct: 7    DRQGLEPRVIRTLGSQALSG----------------------PNIS-NRTLSSEANSHSS 43

Query: 65   NMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKL 124
                   + + + TP S   YR+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC+ISDKL
Sbjct: 44   ENTKDAMIKTTSPTPLSTPIYRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKL 103

Query: 125  SRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKEEQLHLVSKYSNKRTSEISENEDEQI 184
             R+A+P+GY                     CD+KE+Q+ LVS+  ++  + +    +   
Sbjct: 104  LRKAYPKGYTESLEERVRELEAENKRLLALCDIKEQQISLVSQ--SRPPTSMDNTANGSF 161

Query: 185  LQQLSAANGGSLRVSSTNLYLLNKTTPGDQQD-EEDQMSSKTTVD--------------C 229
             Q+L  A    L +SSTN+YLLN+T     Q+ + D  +S T ++              C
Sbjct: 162  KQELKDA---PLNLSSTNIYLLNQTVNKQLQNGKMDSDNSNTVMNSLAAAPLPPQKDHVC 218

Query: 230  NGVGC-NHSHQPNIHDKPVSTNLNDPTSISFEQNEAPGLPAVKALTSMANHEHSVQLATL 288
            +G+ C NH     +H KP ST+LNDPT+ISFEQ+EAPGLPAVKAL  M  H+ S QLATL
Sbjct: 219  DGISCTNH-----LHVKPTSTSLNDPTAISFEQDEAPGLPAVKALKLMTTHQRSTQLATL 273

Query: 289  VALSVPRSTEEILLIPQLLARIGQVHGLTSKQSLYTASLLASLKESIP---LTLPTNVDM 345
            V+LS+PRSTEEIL IPQLL RI Q+ G  SKQ LYT SLL+SLK  +P   L  P+    
Sbjct: 274  VSLSIPRSTEEILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPRLLPPSTSTK 333

Query: 346  LK-------------------STNLWEVDDVIQFFQTVFKFDIQA---ESSTTSQDH--- 380
            LK                   +TNL E  D+  F  ++ KFDI +   +S     DH   
Sbjct: 334  LKEKGEDKILDDDSAFFKKFQTTNLSEFVDLKGFLVSL-KFDIDSFSKQSENLPNDHDNE 392

Query: 381  -LIATEIDGLVSDFFSQWYNFIPILDKDEFYNYYNKFKTDLMDPNFFDDEKNLFNKRNKS 439
             L  TEI  L+  FF  W N +PIL+ D F  Y+N F   + D +  + + N+ N    +
Sbjct: 393  LLSLTEIKELLHLFFKFWSNQVPILNNDHFLLYFNNFVEVVKDLSSANLKTNVTNTSIVT 452

Query: 440  ISYKIFGCILLIICQMGLISKVKAENLPAT------NKYSQLMAYYDIVVRQLMMNPYF- 492
             ++++F   L ++  MGL+ K+K E +  T      +KY++LMAYY  +   +  NPYF 
Sbjct: 453  TNHELFALKLSMMLLMGLLVKIKMEKIKYTVPKNPNSKYARLMAYYHQLSLIIPKNPYFL 512

Query: 493  NLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAV 552
            N+ +TS+ SLQ  SL  FY+LN+G++S++Y +RG++VSM+QQLRLHRCPSAVL  + + V
Sbjct: 513  NMSTTSLPSLQLLSLASFYYLNVGDISAIYGVRGRIVSMAQQLRLHRCPSAVLSVHSNPV 572

Query: 553  -SKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADND--DQ------KV 603
              K +Q ERR+LFW IYY+DVF++LQLGVPRLLKD +IECALP++D +  DQ      K 
Sbjct: 573  LQKFEQSERRLLFWAIYYVDVFASLQLGVPRLLKDFDIECALPISDVEYKDQLFMENKKT 632

Query: 604  NLAGQMIALEGRVSMLSLSVIRFAKVLGNILDSIFKRG-MSASLTKQISLVHENALDNWR 662
            N   + I L+G+VS  SL +IRFAK+LGNILDSIFKRG M   +T +++LVHENALDNWR
Sbjct: 633  NKKAKKIQLQGQVSSFSLQIIRFAKILGNILDSIFKRGMMDERITSEVALVHENALDNWR 692

Query: 663  RGLPQQLKFELDVNGTINMDEF--NHLKQLDT---SGNMYSKENKSLMVLYFMAKCMIHL 717
              LP+   F++ VNGT+N+DE   N  K ++T     ++   E K L++ YF+AK MIHL
Sbjct: 693  SQLPKMYYFQITVNGTVNLDEIRVNDSKNIETRFEKKDIILFEKKILLLFYFLAKSMIHL 752

Query: 718  PVVAKRPL---VNDPEQSPESSTPSNNCGD-----------------RSSSSYVLLQQAT 757
            PV+A +PL   +++  +  +S   +++ G                  R+SSSY++LQQAT
Sbjct: 753  PVIATKPLPKNIDNGTKKKQSVFSNDSKGSNDQDHMIVDVDMTSPAIRTSSSYIILQQAT 812

Query: 758  NTLLNVFTSLRNVYPPIPINVSRTKTRFSLLSARGSLEYTKGGALFQDNKAXXXXXXXXX 817
            N  L +F ++  +Y P+P+NVSRT  RFSLL ARGSLEYTKGGALF DNK          
Sbjct: 813  NATLMIFQTINWMYIPLPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDI 872

Query: 818  XXXXXXXXPGTLSWHSLKLLDMSISLILQPANTKPEKLEKMLQRKLNYYNKL-------T 870
                    PGT SWH+LKL DM+I+L+L+  N K E+L+K L++KLNYYN+L       T
Sbjct: 873  ENDRLLDLPGTASWHTLKLYDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPLATT 932

Query: 871  NRRSNLGGGRSASSPGGNSKRKL--------------DENQGSAEPPKLTPASSKGDTPP 916
                 + G +S  SP    ++ +              D+N+ +   P  +P  +  +   
Sbjct: 933  TSIKPILGSQSKDSPETRPRKSIVKRENPEYEYLYGKDDNKKNNSGPDQSPIENTSNG-- 990

Query: 917  DKKIKLE-DTGFVPVRAVSQHSQSDSEKFENFQPPVAPQNSIAEAFHLDPVLNNNPFSNT 975
             K++K E DT     R V   S   S+  ENFQ       S +  F          FSNT
Sbjct: 991  SKRLKYETDTK----RGVDTGSIFKSQNAENFQHNNKKTMSTSNLFPFS-------FSNT 1039

Query: 976  DLNAFF 981
            DL A F
Sbjct: 1040 DLTALF 1045

>NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845
          Length = 1164

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/927 (43%), Positives = 550/927 (59%), Gaps = 112/927 (12%)

Query: 83  SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXX 142
           SN R+AQACDRCRSKKTRCDGKRPQCSQCA VGFECKISDKL R++FPRGY         
Sbjct: 73  SNLRIAQACDRCRSKKTRCDGKRPQCSQCAIVGFECKISDKLQRKSFPRGYTET------ 126

Query: 143 XXXXXXXXXXXXCDLKEEQLHLVSKYSNKRTSEISENEDEQIL-----QQLSAANGGSLR 197
                         L+E+   L             ENE+ ++L      +L +    ++ 
Sbjct: 127 --------------LEEKVREL-------------ENENRRLLAICQFNKLQSQKNDTID 159

Query: 198 VSSTN--LYLLNKTTPGDQQDEEDQMSSKTTVDCNGVGCNHSHQPNIHDKPVSTNLNDPT 255
            S+T   +Y +   +      E D  S+ TT  C    CN+    ++H KPVST    P 
Sbjct: 160 NSTTQEEVYSIRSNSASSTAIETD--SNITT--CLDTNCNNDTHNHLHMKPVST--KPPQ 213

Query: 256 S-ISFEQNEAPGLPAVKALTSMANHEHSVQLATLVALSVPRSTEEILLIPQLLARIGQVH 314
           + ISFEQNEAPGL AVKAL SMANHE S QLATLVAL++PRST+EIL IPQLL++I Q  
Sbjct: 214 NIISFEQNEAPGLSAVKALKSMANHEQSTQLATLVALAIPRSTDEILFIPQLLSKIRQNF 273

Query: 315 GLTSKQSLYTASLLASLKESI--PLTLPTNVDM-------LKSTNLWEVDDVIQFFQTVF 365
           G TSK  LYT SLL+SLK ++  P  +  N++M       LK TNLW+ DD+ QF     
Sbjct: 274 GFTSKHCLYTVSLLSSLKPNLPPPKMIANNLEMTKKLLNQLKITNLWKFDDLSQFINQYL 333

Query: 366 KFDIQAESSTTSQDHLIATEIDGLVSDFFSQWYNFIPILDKDEFYNYYNKFKTDLMDPNF 425
           K D    +   S D L   E+D L++ FF  W + IPI++K+EF + YN FK DL     
Sbjct: 334 KLD--PLNQKNSNDLLNQIEMDELINFFFQDWNDIIPIINKEEFLSNYNAFKLDLK---- 387

Query: 426 FDDEKNLFNKRNKSISYKIFGCILLIICQMGLISKVKAENLPATN--KYSQLMAYYDIVV 483
            + E++  +  N  ++YKIFGCIL+++CQMGL++K+KA N  ++       +MAYY  ++
Sbjct: 388 -NSERDKLSS-NLKMNYKIFGCILVLMCQMGLLTKIKATNGKSSPNIHLKSIMAYYHQLI 445

Query: 484 RQLMMNPYFNLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSA 543
             L +N +F + + SI  L+   L LFY LN+G++S++Y+LRG+++SMSQQLRLHRCPSA
Sbjct: 446 ANLPINNFFQIATISIPQLKLYVLILFYNLNVGDISAIYELRGRIISMSQQLRLHRCPSA 505

Query: 544 VLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKV 603
           VL G+   ++K  Q  RRILFW IY LD  S+LQLGVPRLLKD+EIECALP+   D ++ 
Sbjct: 506 VLSGSSLTMNKLDQSNRRILFWTIYSLDALSSLQLGVPRLLKDYEIECALPITMEDKER- 564

Query: 604 NLAGQMIALEGRVSMLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHENALDNWRR 663
                 I LEG VS  SL++ RF+K+LGNILD IFKR M+ S+TK +SL+HENALD WR 
Sbjct: 565 --DKTKIKLEGTVSPFSLAIFRFSKILGNILDMIFKRNMTESMTKSVSLIHENALDQWRY 622

Query: 664 GLPQQLKFELDVNGTINMDEFNHLKQLDTSGNMYSKENKSLMVLYFMAKCMIHLPVVAKR 723
            LP+ L F+L++ G+I++   N + Q +++     K+N  LM  YF A  MIHLPVVA R
Sbjct: 623 DLPEDLTFKLNIQGSIDL---NVMHQGNSTP---GKKNLILMFFYFFAVSMIHLPVVAAR 676

Query: 724 PLVNDPEQSPESSTPSNNCGDRSSSSYVLLQQATNTLLNVFTSL----RNVYPPIPINVS 779
           PL              N   DRSSSSY+ LQ A NT+LNV   L    +N Y P+PIN+S
Sbjct: 677 PL-----------DVKNAMPDRSSSSYIALQHAINTMLNVLELLNNQPKNYYLPVPINMS 725

Query: 780 RTKTRFSLLSARGSLEYTKGGALFQDNKAXXXXXXXXXXXXXXXXXPGTLSWHSLKLLDM 839
           R + R +L+S+RG L+Y KGGALF DNK                  PG +SWHSLKL D+
Sbjct: 726 RLQIRSALISSRGMLDYIKGGALFLDNKTLLLQVIKNLERDRTLDLPGVVSWHSLKLFDL 785

Query: 840 SISLILQPANTKPEKLEKMLQRKLNYYNKLTNRRSNLGGGRSASSPGGNSKRKLDENQGS 899
           +I+L +Q +N K EKL+K+L++K NYYNKL  +        + ++   + KRK +  + S
Sbjct: 786 TITLFIQNSNIKLEKLDKILEKKSNYYNKLMGK----PTSNNTNNNISSKKRKQETIEIS 841

Query: 900 AEPPKLTPASSKGDTPPDKKIKLEDTGFVPVRAVSQHSQSDSEKFENFQPPVAPQNSIAE 959
              P   P            ++   +  +P + +  ++ +                 +A+
Sbjct: 842 TPSPTSPPLKKMSKKSKSPILQ---STILPSQTLQNYNNNIQN-------------QLAD 885

Query: 960 AFHLDPVLNNNP--FSNTDLNAFFNTN 984
           A   DP+LN+N   FSN DL+ +F  N
Sbjct: 886 ALQFDPILNSNSYNFSNFDLSNYFQPN 912

>Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa]
           {ON} YMR280C (REAL)
          Length = 1432

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/953 (44%), Positives = 575/953 (60%), Gaps = 123/953 (12%)

Query: 5   ERETFAPRIIRTLGXXXXXXXXXXXXXXXXXXXXXXXXXXXVPHVAANNTTMS--PTPLN 62
           +R+   PRIIRTLG                           VP     N T+S    P  
Sbjct: 6   DRQGLEPRIIRTLGSQTLSGST-------------------VP-----NRTLSSEANPHF 41

Query: 63  SNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 122
           S N+   T V + + TP S   YR+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC+ISD
Sbjct: 42  SENIKEAT-VNTTSPTPLSTPIYRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISD 100

Query: 123 KLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKEEQLHLVSKYSNKRTSEISENEDE 182
           KL R+A+P+GY                     CD+KE+Q+ LVS+  ++ ++ +  N D 
Sbjct: 101 KLLRKAYPKGYTESLEERVRELEAENKRLLALCDIKEQQISLVSQ--SRPSTSLDSNVDG 158

Query: 183 QILQQLSAANGGSLRVSSTNLYLLNKTTPGD-QQDEEDQMSSKTTVD------------- 228
              ++L  A    L +SSTN+YLLN+T     Q  + D  +S   +D             
Sbjct: 159 NCKKELKDA---PLNLSSTNIYLLNQTVNKQLQSGKMDNDNSDAAIDSLAASPSPPPKDH 215

Query: 229 -CNGVGCNHSHQPNIHDKPVSTNLNDPTSISFEQNEAPGLPAVKALTSMANHEHSVQLAT 287
            C+GV C +     +H KP ST+L+DPT+ISFEQNEAPGLPAVKAL SM  H+ S QLAT
Sbjct: 216 VCDGVSCTNR----LHVKPTSTSLSDPTAISFEQNEAPGLPAVKALKSMTTHQRSTQLAT 271

Query: 288 LVALSVPRSTEEILLIPQLLARIGQVHGLTSKQSLYTASLLASLKESIP---LTLPTN-- 342
           LV+LS+PRSTEEIL IPQLL RI Q+ G  SKQ LYT SLL+SLK  +P   + LP+   
Sbjct: 272 LVSLSIPRSTEEILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPSILLPSTST 331

Query: 343 -----------------VDMLKSTNLWEVDDVIQFFQTVFKFDI-------QAESSTTSQ 378
                            +   +ST+L E  D+ +F  ++ KFDI       + +++    
Sbjct: 332 NSKEKNEDKTPNDDSAFLKTFQSTSLSEFVDLKKFLISL-KFDIDSFSKQPEKQANGHDS 390

Query: 379 DHLIATEIDGLVSDFFSQWYNFIPILDKDEFYNYYNKFKTDLMDPNFFDDEKNLFNKRNK 438
           D L  TEI  L+  FF  W N +PIL+ D F  Y+N F   + D +    + N   K N 
Sbjct: 391 DLLSLTEIKELLHLFFKFWSNQVPILNNDHFLLYFNNFVEIIKDFSLISTKANSTTKNNV 450

Query: 439 SISYKIFGCILLIICQMGLISKVKAENLPAT------NKYSQLMAYYDIVVRQLMMNPYF 492
           + +++IF   LL++ QMGL+ K+K + +  T       KY +LM+YY  +   +  NPYF
Sbjct: 451 TTNHEIFTLKLLMMLQMGLLIKIKKDKIKDTVPRNSNAKYIRLMSYYHQISLIIPKNPYF 510

Query: 493 -NLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSA 551
            N+ +TS+ SLQ  SL  FY+LN+G++S++Y +RG++VSM+QQLRLHRCPSAVL  + + 
Sbjct: 511 LNMSTTSLPSLQLLSLASFYYLNVGDISAIYGIRGRIVSMAQQLRLHRCPSAVLSVHSNP 570

Query: 552 V-SKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVAD--------NDDQK 602
           V  K +Q ERR+LFW IYY+DVF++LQLGVPRLLKD +IECALP++D         +++K
Sbjct: 571 VLQKFEQSERRLLFWAIYYVDVFASLQLGVPRLLKDFDIECALPISDVEYKDQLSMENEK 630

Query: 603 VNLAGQMIALEGRVSMLSLSVIRFAKVLGNILDSIFKRG-MSASLTKQISLVHENALDNW 661
           +    + I L+G+VS  SL +IRFAK+LGNILDSIFKRG M   ++ +++LVHENALDNW
Sbjct: 631 MKNKAKKIQLQGQVSSFSLQIIRFAKILGNILDSIFKRGMMDERISSEVALVHENALDNW 690

Query: 662 RRGLPQQLKFELDVNGTINMDEF--NHLKQLDT---SGNMYSKENKSLMVLYFMAKCMIH 716
           R  LP+   F++ VNGT+N+DE   N+ + ++T   + ++   E K L++ YF+AK MIH
Sbjct: 691 RNQLPEMYYFKITVNGTVNLDEIRANNSRDIETPFETKDIILFEKKILLLFYFLAKSMIH 750

Query: 717 LPVVAKRPL---VNDPEQSPESSTPSNNCGD-----------------RSSSSYVLLQQA 756
           LPV+A +PL   V++  +  +S   +++ G                  R+SSSY++LQQA
Sbjct: 751 LPVIATKPLSKNVDNVMKKKQSMFNNDSKGTNNHDHMAVDVDMTSPAIRTSSSYIILQQA 810

Query: 757 TNTLLNVFTSLRNVYPPIPINVSRTKTRFSLLSARGSLEYTKGGALFQDNKAXXXXXXXX 816
           TN  L +F S+  +Y P+P+NVSRT  RFSLL ARGSLEYTKGGALF DNK         
Sbjct: 811 TNATLTIFQSINWMYLPLPLNVSRTLVRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKD 870

Query: 817 XXXXXXXXXPGTLSWHSLKLLDMSISLILQPANTKPEKLEKMLQRKLNYYNKL 869
                    PG  SWH+LKL DM+I+L+L+  N K E+L+K L++KLNYYN+L
Sbjct: 871 IENDRLLELPGIASWHTLKLFDMTINLLLKAPNVKVERLDKFLEKKLNYYNRL 923

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 82/199 (41%), Gaps = 46/199 (23%)

Query: 1084 FGFAVDASWGLAPLLEWSP--AGKPVDPGTCNANENSIILDTSAANMESEMATGGRLHSN 1141
            + + VDAS GLAPLL  +P  +       T N ++NSIILD++  +         R H+N
Sbjct: 1265 YDYIVDASLGLAPLLVDTPDISNTNTTSTTSNRSKNSIILDSTFND------DLDRSHTN 1318

Query: 1142 TRSYTDAKNLDIVPTLPSSKXXXXXXHRLQKGASQQPRSASIPTRKQSLCESNPTTATGS 1201
             R   +  +  +   + SS          +    Q+  S+   ++     + NP  A   
Sbjct: 1319 AREVLNHADSILSQGIMSSIST-------RTADIQRSSSSGNDSKSNGYSQKNPKNANNG 1371

Query: 1202 RDDGVLTM---------GTRNHRGPRRRWNSTTGQNTRTQLATMNTPQSER-SKSQNIGE 1251
            + D   T+          + +HRGPRR                   PQ  R S  Q+ G 
Sbjct: 1372 QLDAPSTLFQMRRTSSGPSTSHRGPRR-------------------PQKHRYSTDQSKGF 1412

Query: 1252 PG--STEDSLHDLFRWQNS 1268
             G  S  D+L DLF+WQN+
Sbjct: 1413 SGGSSNADNLPDLFQWQNA 1431

>KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.845
            YMR280C
          Length = 1237

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/931 (42%), Positives = 547/931 (58%), Gaps = 111/931 (11%)

Query: 86   RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXXXX 145
            R +QACDRCR KK +CD KRPQCS CA+VGFECK+SDKL+R +FPRGY            
Sbjct: 171  RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYTESLEERIRELE 230

Query: 146  XXXXXXXXXCDLKEEQLHLVSKYSNKRTSEISENEDEQILQQLSAANGGSLRVSSTNLYL 205
                      DLKE+QL  +              ED Q +  + A    S +  + N+Y 
Sbjct: 231  SENRRLLAMNDLKEQQLFKIP-------------EDIQSVVDVDAELNSSNQ--TKNMY- 274

Query: 206  LNKTTPGDQQDEEDQMSSKTTVDCNGVGCNHSHQPNIHDKPVSTN--LNDPTSISFEQNE 263
                                T  C+G+ C  +    +H +PV+TN  LNDPTS+SFEQNE
Sbjct: 275  -------------------ATHVCDGICCQDT---KLHSRPVATNFNLNDPTSVSFEQNE 312

Query: 264  APGLPAVKALTSMANHEHSVQLATLVALSVPRSTEEILLIPQLLARIGQVHGLTSKQSLY 323
            APGL A +A+  ++NHE S QLA LV+LS+PRSTEEIL IPQLLA+I QV G TSKQ LY
Sbjct: 313  APGLMAARAIDQISNHEQSTQLAILVSLSIPRSTEEILFIPQLLAKIRQVFGFTSKQCLY 372

Query: 324  TASLLASLKESIP-----------LTLPTNVDMLKSTNLWEVDDVIQFFQTVFKFDIQAE 372
            T SLL+SLK+ +P           L   +N D+L S NLW ++++  FFQ V K +I  +
Sbjct: 373  TVSLLSSLKDDLPPPNLLKNSKMILQNSSNFDILTSVNLWHLENLSNFFQNVLKLNILPD 432

Query: 373  SS---TTSQDHLIATEIDGLVSDFFSQWYNFIPILDKDEFYNYYNKFKTDLMDPNFFDDE 429
                   + DHL  +EID LV+ +F  W + IPI ++ EF + Y  FK DLM  +     
Sbjct: 433  DDDHLKKNDDHLALSEIDELVALYFKYWSDSIPIFNEKEFNSNYRVFKADLMKLS----- 487

Query: 430  KNLFNKRNKSISYKIFGCILLIICQMGLISKVKAENLP-ATNKYSQLMAYYDIVVRQLMM 488
            KN  +     ++ KIFGC+L +ICQMG++  +K +N    + K+ +L++YY  ++  L  
Sbjct: 488  KNGPSSLENILNIKIFGCLLTVICQMGIL--IKYKNFKNKSPKFEKLLSYYHHLMYVLPK 545

Query: 489  NPYFNLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGN 548
            N YF + +TSI+++Q  SL LFY LN G++  +YDLRG ++SM+QQLRLHRCPSAVL G+
Sbjct: 546  NSYFGVITTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGS 605

Query: 549  GSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQ 608
            GS + + +QG RR LFW IYYLDVF +LQLGVPRL+KDHEIECALP++        + G 
Sbjct: 606  GSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDG- 664

Query: 609  MIALEGRVSMLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHENALDNWRRGLPQQ 668
             + LEG +S  SLSV+R AKVLGNILDSIFKR MS S+T+Q+  +HENALD+WR  LP++
Sbjct: 665  -VQLEGTMSEFSLSVVRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTKLPKK 723

Query: 669  LKFELDVNGTINMDEFNHLKQLDTSGNMYSKENKSLMVLYFMAKCMIHLPV-VAKRPLVN 727
             +F+L+ NG ++++  NH             EN  L++L+F+ K MI++P+  A   L N
Sbjct: 724  YQFKLNANGMVDLEHLNH-------------ENLILVLLFFLVKSMIYMPLSSAITELAN 770

Query: 728  DPEQSPESSTPSNNCGDRSSSSYVLLQQATNTLLNVFTSLRNVYPPIPINVSRTKTRFSL 787
            +P+         N+       S+  LQQ+ N LL+VF ++ N Y P+P+N SRT TRF+L
Sbjct: 771  NPKV-------KNDYYMNHKVSHTSLQQSINALLSVFKNINNQYLPLPLNSSRTMTRFAL 823

Query: 788  LSARGSLEYTKGGALFQDNKAXXXXXXXXXXXXXXXXXPGTLSWHSLKLLDMSISLILQP 847
            +SA+GSLEY KGG LF+DNK                  PG + WHSLKLLD++++L L  
Sbjct: 824  VSAKGSLEYKKGGLLFEDNKVLLLSVIQEIEKDRKLELPGIIPWHSLKLLDLAVNLFLLG 883

Query: 848  ANTKPEKLEKMLQRKLNYYNKLTNRRSNLGGGRSASSPGGNSKRKLDENQGSAEPPKLTP 907
                 +KLEK LQ+K+NYYNK+      +G     S P   +KRK  +         L  
Sbjct: 884  PTINSDKLEKFLQKKINYYNKI------MGKPLITSLPSSKTKRKQSKED-------LFT 930

Query: 908  ASSKGDTPPDKKIKLEDTGFVP--VRAVSQHSQSDSEKFENFQPPVAPQNSIAEAFHLDP 965
            A+ K       ++   +    P  V+ + +  Q ++ +        + Q++  EA  LDP
Sbjct: 931  ANKKRKQQVKTELSTLEVKREPQQVQLLKREGQGNTTE--------STQSAFVEALQLDP 982

Query: 966  VLNNNP--FSNTDLNAFFNTN-NGNVPAALR 993
            +LN N   FS TDL+ FF +N NG+VP   R
Sbjct: 983  ILNANIYNFSGTDLSNFFISNQNGDVPRESR 1013

>NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845
          Length = 1495

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/1070 (39%), Positives = 588/1070 (54%), Gaps = 170/1070 (15%)

Query: 62   NSNNMGTGTSVTSGADTPASASNY--RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 119
            NS++  T     S + T +++ NY  R++QACDRCRSKKTRCDGKRPQCSQCA VGFECK
Sbjct: 77   NSSSTDTKDDSVSISITDSTSGNYSKRISQACDRCRSKKTRCDGKRPQCSQCAIVGFECK 136

Query: 120  ISDKLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKEEQLHLVSKYS----NKR--- 172
            +SDKL R+++PRGY                      +LK+ QL + S  S    NK+   
Sbjct: 137  VSDKLQRKSYPRGYTETLEEKIRELQTENKRLLAIYNLKQNQLSVSSSSSSTSPNKKGNG 196

Query: 173  -----------TSEISE-NED-------EQILQQ--LSAANGGSLR------VSSTNLYL 205
                       TS I++ NE+       ++I+Q   +   N  S+         +T+   
Sbjct: 197  NDCAVQSNSTSTSAINDTNENGSNETAMKEIIQSQLIPLTNINSVHDPIQNNDDNTHTDC 256

Query: 206  LNKTTPGDQQDEEDQMSSKTTVDCNGVGCNHSHQPNIHDKPVSTNLNDPTSISFEQNEAP 265
             N T      D  +  S+ TT   NG     ++  ++H KPVSTN N   SISFEQNEAP
Sbjct: 257  CNHTIKTINPDNNNNYSTHTT---NGKLHRDTNDHHLHPKPVSTNSNGLNSISFEQNEAP 313

Query: 266  GLPAVKALTSMANHEHSVQLATLVALSVPRSTEEILLIPQLLARIGQVHGLTSKQSLYTA 325
            GL  VKAL SM N E + QLATLV+L++PRSTEEIL IPQ+LA++ Q  G TSK  LYT 
Sbjct: 314  GLSTVKALKSMVNDEKNTQLATLVSLAIPRSTEEILFIPQILAKVRQNFGFTSKHCLYTV 373

Query: 326  SLLASLKE---------SIPLTLPTNVDMLKSTNLWEVDDVIQFFQTVFKFDIQAES--- 373
            SLL+SLK          S       N++ LK+TNLW+ + + QFF    K D    S   
Sbjct: 374  SLLSSLKSFLSNSNNSISAASADNKNLETLKNTNLWKFNALFQFFTAFLKLDFLDSSLEK 433

Query: 374  ---------------STTSQDH---LIATEIDGLVSDFFSQWYNFIPILDKDEFYNYYNK 415
                           ++ +QD    L ++EID L+  FF  W +F+ ++++ EFY YY+ 
Sbjct: 434  QNKGKKNGKVNNNNNNSANQDGISPLSSSEIDELLKLFFQNWSDFVLMINEKEFYQYYSV 493

Query: 416  FKTDLMDPNFFDDEKNLFNKRNKSISYKIFGCILLIICQMGLISKV-------KAENLPA 468
            FK+DL + N      +        ++YKIFG I+L+ CQMGL+SK+       K++N   
Sbjct: 494  FKSDLQNNNISKMSLSTL------MNYKIFGLIILLFCQMGLLSKIKLSSNNTKSKNFKQ 547

Query: 469  TNKYSQLMAYYDIVVRQLMMNPYFNLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKV 528
                 ++M YY  ++ +LM N +F + + ++QSL+  SL LFY L++G +S++Y+LR KV
Sbjct: 548  QYHLKKVMNYYHNLINKLMWNEFFKISNVTLQSLKLLSLILFYNLHMGNISNIYELRSKV 607

Query: 529  VSMSQQLRLHRCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHE 588
            +SMSQQLRLHRCPSAVL G+   + K +Q  RR+LFW IYYLD+F++LQLGVPRLLKDHE
Sbjct: 608  ISMSQQLRLHRCPSAVLCGSTLKIHKLEQSNRRLLFWNIYYLDIFASLQLGVPRLLKDHE 667

Query: 589  IECALPV-------------------ADNDDQKVNLAGQMIALEGRVSMLSLSVIRFAKV 629
            IECALP+                   A+NDD K       I LEG VS LSL +IR++++
Sbjct: 668  IECALPIPMDTDSKSDNQSQRSAATNAENDDNK-------IKLEGCVSHLSLVIIRYSQI 720

Query: 630  LGNILDSIFKRGMSASLTKQISLVHENALDNWRRGLPQQLKFELDVNGTINMDEFNHLKQ 689
            +GNILD IFKR M+ S+TK I+L+H +ALD+WR  LP  LKF+L+VNG+I++  F   + 
Sbjct: 721  VGNILDMIFKRNMTESMTKSIALIHIHALDDWRNTLPSNLKFDLNVNGSIDLSSFIDQQN 780

Query: 690  LDTSGNMYSKENKSLMVLYFMAKCMIHLPVVAKRPLVNDPEQSPESSTPSNNCGDRSSSS 749
            L+       ++   ++ LYF    MIH+PVVA RPL   P    +S    N   DRSSSS
Sbjct: 781  LNEEEQRTQQQKLLVIFLYFFGVNMIHMPVVASRPL---PLVENDS---LNQIPDRSSSS 834

Query: 750  YVLLQQATNTLLNVFTSLRNVYPPIPINVSRTKTRFSLLSARGSLEYTKGGALFQDNKAX 809
            Y+ LQ ATNT+LNV   L   Y P+PIN+SRT  RFS++SA G L++ KGG+LF +NKA 
Sbjct: 835  YIALQHATNTMLNVLDLLSPTYVPLPINMSRTMVRFSMISACGMLDFIKGGSLFLENKAL 894

Query: 810  XXXXXXXXXXXXXXXXPGTLSWHSLKLLDMSISLILQPANTKPEKLEKMLQRKLNYYNKL 869
                            PG +SWHSLKL D++++L  Q  N K EKL+K+L++K NYYN+L
Sbjct: 895  LAQVVKNIETDRFLDLPGVISWHSLKLFDLTLTLFFQNTNIKLEKLDKLLEKKSNYYNRL 954

Query: 870  TNR--RSNLGGGRSASSPGGNS-----------KRKLD----ENQGSAEPP-------KL 905
              +    N     S + P   S           K+K D    EN+  +  P       K 
Sbjct: 955  MGKPIVRNPAEKNSTTVPASMSAVDETDLPRADKKKKDIVDTENEYVSSVPDTNNIVVKQ 1014

Query: 906  TP----ASSKGDT--------------PPDKKIKLEDTGFVPVRAVSQHSQSDSEKFENF 947
            TP     S+K +               P   K K +     PV   ++ ++ +  + +  
Sbjct: 1015 TPEEWDTSTKTNVKDSTLAHKLTTIELPSTDKKKRKQEQISPVNKKAKKAEQEVSQTQVG 1074

Query: 948  QPPVAP------------QNSIAEAFHLDPVLNNNP--FSNTDLNAFFNT 983
             P  +             QN  A+A   DP+LN+N   FSN DL++ F T
Sbjct: 1075 VPRSSTSSTAQNSNYANIQNQFADALQFDPILNSNSFNFSNLDLSSLFKT 1124

>Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {ON}
            similar to Ashbya gossypii ABL121C
          Length = 1577

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/718 (50%), Positives = 470/718 (65%), Gaps = 65/718 (9%)

Query: 385  EIDGLVSDFFSQWYNFIPILDKDEFYNYYNKFKTDLMDPNFFDDEKNLFNKRNKSISYKI 444
            E D ++  FF +WY+ IPI DK EF NY+ KFK ++  P FF     +F KR+KSISYKI
Sbjct: 598  ECDEMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVSTPEFFTSGDTIFAKRHKSISYKI 657

Query: 445  FGCILLIICQMGLISKVKAENLPATNKYSQLMAYYDIVVRQLMMNPYFNLKSTSIQSLQF 504
            F C+L+ + QMGL++KVK ENL   +K + LM YYD  +  ++ NPYF   STSIQSLQ 
Sbjct: 658  FACLLVTVVQMGLMTKVKRENLGRRHKLNILMTYYDRALSHIITNPYFGSNSTSIQSLQL 717

Query: 505  TSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKAQQGERRILF 564
             SL LFYFLN+G++S++Y+LRGKVVS +QQLRLHRCPSAVLGG+G  VS+ QQGERR+LF
Sbjct: 718  LSLLLFYFLNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLF 777

Query: 565  WGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEGRVSMLSLSVI 624
            WG+YYLDVF++LQLGVPRLLKDHEIECALPV+ + D++VNLAGQMI+LEG++S  SLSVI
Sbjct: 778  WGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPFSLSVI 837

Query: 625  RFAKVLGNILDSIFKRGMSASLTKQISLVHENALDNWRRGLPQQLKFELDVNGTINMDEF 684
            RF+KVLGN+LDSIFKRGM+ S+TK+++LVHENALDNWR GLP  L+F+LDVNGTINMDEF
Sbjct: 838  RFSKVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLRFQLDVNGTINMDEF 897

Query: 685  NHLKQ--LDTSGNMYSKENKSLMVLYFMAKCMIHLPVVAKRPLVNDPEQSPESSTPS-NN 741
            N LK   L+   + ++KEN   M LYF+AK MIH+PVVA +P V+   Q  E + P+ + 
Sbjct: 898  NQLKHEYLNNDNSKFNKENFIFMTLYFLAKSMIHIPVVAGKPPVDTSVQ--EKNDPAISR 955

Query: 742  CGDRSSSSYVLLQQATNTLLNVFTSLRNVYPPIPINVSRTKTRFSLLSARGSLEYTKGGA 801
              DRSSSSY+LLQQATNT LNV TS+R  Y P+PIN+SR KTRF L SARGSLEYTKGGA
Sbjct: 956  QADRSSSSYILLQQATNTFLNVLTSMRTAYLPLPINISRAKTRFGLFSARGSLEYTKGGA 1015

Query: 802  LFQDNKAXXXXXXXXXXXXXXXXXPGTLSWHSLKLLDMSISLILQPANTKPEKLEKMLQR 861
            LFQDNK+                 PGT+SWHSLKL DM+I+LILQP NTKPEK EK+LQ+
Sbjct: 1016 LFQDNKSLLLNLIKELEVDRKLGIPGTISWHSLKLFDMAINLILQPPNTKPEKEEKLLQK 1075

Query: 862  KLNYYNKLTNRRSNLGGGRSASSPGGNSKR----------------KLDENQGSAEPPKL 905
            K++YYNKL +    +      S+   + ++                K ++  G+   P++
Sbjct: 1076 KISYYNKLIDHSVGMHASVITSAAIQHQRQQQQQQQQQQQQQQLHYKENKGNGAKRKPEI 1135

Query: 906  TPASSKGDTPPDKKIKLEDTGF-VPVR--AVSQHSQSDSE-------------------K 943
              +S+  +   +K++K+E+    +P     +S   + DSE                   K
Sbjct: 1136 G-SSTTTNMSLNKRVKMEEPSVKIPTSNGPLSALHEDDSEMLGKSLRSNTIVSDVPTGQK 1194

Query: 944  FENFQP-PVAPQNSIAEAFHLDPVLNNNPFSNTDLNAFFN----TNNGNVPAALRS---G 995
             E+  P  ++  N+IAEAF LDPVL+  PFS+TDL +F N    TN       + +   G
Sbjct: 1195 MESEIPVSMSATNAIAEAFQLDPVLHATPFSSTDLTSFLNGEVVTNASMFADTMHTTGIG 1254

Query: 996  GSLFXXX-------------XXXXXXXXXXXXXXXXXXXXEGLFKVPSNGDFLKDYYN 1040
            G L                                     +GLFKVPSNGDFLKDYY+
Sbjct: 1255 GGLTDVSGHNGLPSNNSLLNMSSIGFGIGSGPSLANLSSKDGLFKVPSNGDFLKDYYS 1312

 Score =  308 bits (789), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 189/417 (45%), Positives = 232/417 (55%), Gaps = 106/417 (25%)

Query: 56  MSPTPLNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 115
           +SPT + ++     T ++S   TP S   YRVAQACDRCRSKKTRCDGKRPQCSQCAAVG
Sbjct: 99  LSPTMVQASATPGSTPLSSM--TPMS---YRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 153

Query: 116 FECKISDKLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKEEQLHLVSKYS------ 169
           FECKISDKLSRRAFPRGY                     CDLKEEQL LVSKYS      
Sbjct: 154 FECKISDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKEEQLRLVSKYSAGSVGV 213

Query: 170 ---------------------------------------------NKRT--SEISENEDE 182
                                                        NK+   S+ +  E++
Sbjct: 214 GVGGPVTAGTTVGNRSSVNGAVNESASSTVGSIATAGSTAGLAHQNKKCAGSDSTTPEED 273

Query: 183 QILQQLSAANGGSLRVSSTNLYLLNKTTPGDQQ------------------DEEDQMSSK 224
           +ILQQLS ++GG+LRVSSTNLYLLNK T G QQ                    + Q  S+
Sbjct: 274 RILQQLSKSDGGTLRVSSTNLYLLNKKTSGQQQLLLPGSANKSEAFPIQPDSYKLQQRSQ 333

Query: 225 TTVDCNGVGCNHSHQ-----------PNIHDKPVST----------------NLNDPTSI 257
           +T   +    ++  +           PNI   PV++                NLNDPTSI
Sbjct: 334 STASSHVADSDNPAEFQKEHLQPRTLPNI---PVASTAIPSAPPGVTAYSLANLNDPTSI 390

Query: 258 SFEQNEAPGLPAVKALTSMANHEHSVQLATLVALSVPRSTEEILLIPQLLARIGQVHGLT 317
           SFEQ++APGL AVKAL++MANHE S QLATLVA+S+PR+TEEIL +PQLLARIGQVHG T
Sbjct: 391 SFEQDQAPGLSAVKALSTMANHEQSSQLATLVAMSIPRTTEEILFVPQLLARIGQVHGFT 450

Query: 318 SKQSLYTASLLASLKESIPLTLPTNVDMLKSTNLWEVDDVIQFFQTVFKFDIQAESS 374
           SKQ LYTAS+LASLKE +P      +++L+S +LWE+DDV  F     +F   + +S
Sbjct: 451 SKQCLYTASVLASLKEIVPYQTSPELELLRSKSLWEIDDVDSFLSKGLRFSFPSATS 507

 Score = 92.8 bits (229), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 103/210 (49%), Gaps = 43/210 (20%)

Query: 1077 QNNDNNGFGFAVDASWGLAPLLEWSPAGKPVDPGTCNANENSIILDTSAAN-MESEMATG 1135
            + N   G+GF VDAS GLA LL WSP      PG    N+++IIL +   +  E ++ T 
Sbjct: 1394 KKNQQQGYGFVVDASLGLASLLGWSP-----KPG----NDDAIILGSDPKDDSEPKLNTA 1444

Query: 1136 GRLHSNTRSYTDAKNLDIVPTL----------PSSKXXXXXXHRLQKGASQQPRSASIP- 1184
                   RS+T    LD++PTL          PS           Q  AS +     +P 
Sbjct: 1445 -------RSFTTVNKLDMIPTLMSTTKSTTTAPSDAGLPSSIRPNQNPASIKLVQNPLPL 1497

Query: 1185 -TRKQSLCESNPTTATGSRD----DGVLTMGTRNHRGPRRRWNSTTGQNTRTQLATMNTP 1239
             TRKQ     NP+    S D    DG+LT+ TR+ RGPRR WN+T     + Q+   NT 
Sbjct: 1498 STRKQFAQAGNPSRYPFSPDLLQEDGMLTINTRSPRGPRRYWNNTASSTDQPQIHKNNTQ 1557

Query: 1240 QSERSKSQNIGEPGSTEDSLHDLFRWQNSG 1269
            Q    +SQ +      +D+++DLF+WQNSG
Sbjct: 1558 Q----QSQQL------DDNINDLFKWQNSG 1577

>CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]
           {ON} similar to uniprot|P39113 Saccharomyces cerevisiae
           YMR280c CAT8 transcription factor involved in
           gluconeogenesis
          Length = 1254

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/964 (40%), Positives = 546/964 (56%), Gaps = 109/964 (11%)

Query: 60  PLNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 119
           P N N++ +G++  S   TP     YRVAQACDRCR KKT+CDGK PQCSQCA VGFECK
Sbjct: 34  PANGNSV-SGSNTGSRGSTPT----YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECK 88

Query: 120 ISDKLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKEEQLHLVSKYSNKRTSEISEN 179
           ISD+L+R++FPRGY                     C+                 S++  N
Sbjct: 89  ISDRLNRKSFPRGYTETLEERVRELETENKRLMALCN-----------------SDLGSN 131

Query: 180 EDEQILQQLSAANGGSLRVSSTNLYLLNKTTPGDQQDEE----DQMSSKTTVDCNGVGCN 235
                L++ S +                K +P  ++D E    + M  +    C+  G +
Sbjct: 132 TRSDGLEKQSPSK--------------RKRSPSMERDSERGFTENMELQLQQSCSSCGNS 177

Query: 236 HSHQPNIHDKPVSTNL--NDPTSISFEQNEAPGLPAVKALTSMANHEHSVQLATLVALSV 293
             +   +H KPV +N+  +  T +SFEQN APGLPAVKAL SMA  E S QLA LV+L++
Sbjct: 178 DPNHRCVHLKPVVSNIIVDSNTDVSFEQNVAPGLPAVKALNSMAEREESAQLAMLVSLAL 237

Query: 294 PRSTEEILLIPQLLARIGQVHGLTSKQSLYTASLLASLKESIPLTLPTNVDMLKSTNLWE 353
           PRSTEEIL IPQL+A I +  G +SKQSLYT SLL+SLK+++P     + D   S N + 
Sbjct: 238 PRSTEEILFIPQLMANIQKTFGFSSKQSLYTVSLLSSLKKNLPTPNSNSSDENLSPNYYV 297

Query: 354 VDDVIQFFQTVFKFDIQAESSTT-----------------SQDHLIATEIDGLVSDFFSQ 396
            +D   FF  V KFDI  E+ T                  S D L   EI  LV  +F  
Sbjct: 298 SEDFRPFFYEVLKFDILGETETENGSNRNESPDSTIPNSRSDDLLSWMEIQRLVDVYFEC 357

Query: 397 WYNFIPILDKDEFYNYYNKFKTDLMDPNFFDDEKNLFNKRNKSISY-KIFGCILLIICQM 455
           W N IPI  +  F      FKT++    F D    ++      I++ KIF  +L ++CQM
Sbjct: 358 WSNTIPIFSRKLFIKQMKAFKTEV--DKFGDRLFEVYKTEQIKINFLKIFATVLAVMCQM 415

Query: 456 GLISKVKAENLPAT------NKYSQLMAYYDIVVRQLMMNPYF-NLKSTSIQSLQFTSLQ 508
            L+S++K   L AT       +   L+A+Y+ ++ ++ ++ +F ++ +T++QSLQ  S  
Sbjct: 416 ALLSRLK--QLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFI 473

Query: 509 LFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAV-LGGNGSAVSKAQQGERRILFWGI 567
            FYFLN+G++  +Y LRG V+SM+QQLRLHRCPSAV L  +GS + K +QGERR+LFW I
Sbjct: 474 SFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAI 533

Query: 568 YYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEGRVSMLSLSVIRFA 627
           YYLDVF +LQLGVPRL+KDHEIECALPV++ +D +         LEGRVS  SL+VIR+A
Sbjct: 534 YYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQ---------LEGRVSDFSLAVIRYA 584

Query: 628 KVLGNILDSIFKRG-MSASLTKQISLVHENALDNWRRGLPQQLKFELDVNGTINMDEFNH 686
           KVLGNILDSIFKR  MS + T+ ++ VHE ALD W+  LP++  F L+ NG  N DE   
Sbjct: 585 KVLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLEANGLFNFDELTV 644

Query: 687 LKQLDTSGNMYSKENKSLMVLYFMAKCMIHLPVVAKRPLVNDPEQSPESSTPS------- 739
           +K  ++  ++   E  S+++ YF+AKCMIHLPV+A R    + +  P +S+ +       
Sbjct: 645 VK--NSEKDLI--EKSSILLFYFLAKCMIHLPVIATRSASLEQQLQPGTSSDTSETPKES 700

Query: 740 -NNCGDRSSSSYVLLQQATNTLLNVFTSLRNVYPPIPINVSRTKTRFSLLSARGSLEYTK 798
            N    R   SY+L+Q+A +T+L V       Y P PIN+SRTK RF+LL+A  ++EY K
Sbjct: 701 QNKTPTRVCPSYILMQKAASTMLQVMHYTSEYYLPSPINISRTKARFALLTACSAVEYLK 760

Query: 799 GGALFQDNKAXXXXXXXXXXXXXXXXXPGTLSWHSLKLLDMSISLILQPANTKPEKLEKM 858
           GG+L+ + K                  PG +SWHSLKLLDM++ L+LQ   TK EKL+K+
Sbjct: 761 GGSLYVETKNLLENLIIKLELERKLDLPGIISWHSLKLLDMALMLLLQSPTTKMEKLDKL 820

Query: 859 LQRKLNYYNKLTNRRSNLGGGRSASSPGGNSKRKLDENQGSAEPPKLTPASSKGDTPPDK 918
           +Q+K+N+Y    NR+  +   + ++S   N K KL EN+ S       P  +KG+   D 
Sbjct: 821 VQKKINHY----NRQMGIPAMKLSNSRKNNKKIKL-ENESSQLSSTSNPI-AKGELKSDS 874

Query: 919 KIKLEDTGFVPVRAVSQHSQSDSEKFENFQPPVAPQNSIAEAFHLDPVLNNNPFSNTDLN 978
            +  ED        V+ +  + + K E     + P N I +    + +  +  FS+TDL+
Sbjct: 875 VVCEEDDN------VNDNEVTTTAKLEENNEFINP-NKIEQGVTSNTLAFS--FSSTDLS 925

Query: 979 AFFN 982
           A FN
Sbjct: 926 ALFN 929

>Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON}
           (51828..55088) [3261 nt, 1087 aa]
          Length = 1086

 Score = 90.9 bits (224), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 52/84 (61%), Gaps = 10/84 (11%)

Query: 50  AANNTTMSPTPLNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCS 109
             +N+++ PT L          V +  +  ++  + R++QACDRCR KK +CDG +P CS
Sbjct: 67  CVDNSSIQPTTL----------VKTSVNIDSNFLSNRLSQACDRCRLKKIKCDGLKPNCS 116

Query: 110 QCAAVGFECKISDKLSRRAFPRGY 133
           QC  V F CK SDKL+RR FPRGY
Sbjct: 117 QCLKVNFICKTSDKLTRRGFPRGY 140

>KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.277
           YJL089W
          Length = 725

 Score = 87.8 bits (216), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%)

Query: 76  ADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
            +T +  S +RV+QACDRCR KK +CDG++P+CS C  + F C IS KLSRR  P+GY
Sbjct: 1   MNTSSELSKFRVSQACDRCRLKKIKCDGQKPRCSNCKKINFNCAISTKLSRRGLPKGY 58

>TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {ON}
           Anc_1.277 YJL089W
          Length = 1044

 Score = 85.9 bits (211), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 45/67 (67%)

Query: 67  GTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSR 126
           G   S+  G +   +  N R++QACDRCR KK +CDG +P C+ C+ + F CK SD+L+R
Sbjct: 60  GMKDSLKLGNEHYDNDINIRLSQACDRCRLKKIKCDGLKPSCTHCSKIKFACKTSDRLTR 119

Query: 127 RAFPRGY 133
           R FP+GY
Sbjct: 120 RGFPKGY 126

>AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL089W (SIP4)
          Length = 852

 Score = 85.5 bits (210), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 38/48 (79%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           R +QACDRCR KK +CDG RP C+ C  +G++CK SDKL+RR FPRGY
Sbjct: 24  RSSQACDRCRLKKIKCDGLRPSCTSCKKIGYQCKTSDKLTRRGFPRGY 71

>KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON}
           uniprot|Q7Z8R2 Kluyveromyces lactis Sip4 protein
          Length = 717

 Score = 84.3 bits (207), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%)

Query: 80  ASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           AS    R +QACDRCR KK +CDG +P CS C  +G+ C  SDKL+RR FPRGY
Sbjct: 52  ASTKVKRFSQACDRCRLKKIKCDGIKPSCSNCKKIGYHCSTSDKLTRRGFPRGY 105

>Skud_10.125 Chr10 (233921..236422) [2502 bp, 833 aa] {ON} YJL089W
           (REAL)
          Length = 833

 Score = 84.3 bits (207), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 44/68 (64%), Gaps = 4/68 (5%)

Query: 66  MGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLS 125
           M TG S TS A T  S    R A ACDRCR KK +CDG +P CS C+ + F CK SDKLS
Sbjct: 25  MPTGQS-TSNAITDFSV---RKAHACDRCRLKKIKCDGLKPNCSNCSKIDFPCKTSDKLS 80

Query: 126 RRAFPRGY 133
           RR  P+GY
Sbjct: 81  RRGLPKGY 88

>Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089W
           (REAL)
          Length = 829

 Score = 84.3 bits (207), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 47/85 (55%), Gaps = 13/85 (15%)

Query: 49  VAANNTTMSPTPLNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQC 108
           V+ N   + PT       G GTS    A T  S    R A ACDRCR KK RCDG +P C
Sbjct: 17  VSNNKVLIVPT-------GKGTS---NATTDFSV---RKAHACDRCRLKKIRCDGLKPNC 63

Query: 109 SQCAAVGFECKISDKLSRRAFPRGY 133
           S C  + F CK SDKLSRR  P+GY
Sbjct: 64  SNCTKINFPCKTSDKLSRRGLPKGY 88

>ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa]
           {ON} weakly similar to uniprot|P46954 Saccharomyces
           cerevisiae YJL089W SIP4 Possibly involved in Snf1p
           regulated transcriptional activation shows homology to
           DNA binding domain of Gal4p has a leucine zipper motif
           and acidic region lexA-Sip4p activates transcription
          Length = 1027

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%)

Query: 80  ASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           A     R +QACDRCR KK +CDG +P CSQC  V F C+ SD+L+RR FPRGY
Sbjct: 27  AKNKKMRQSQACDRCRLKKIKCDGMKPTCSQCTKVNFTCRTSDRLTRRGFPRGY 80

>KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 862

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 45/65 (69%)

Query: 69  GTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 128
           G+ ++  A     + + R++QACDRCR KK +CDG +P C+ C  +GF C+ SDKLSRR 
Sbjct: 7   GSPLSPKATQLLLSKHARMSQACDRCRLKKIKCDGIKPTCTPCTKIGFHCQTSDKLSRRG 66

Query: 129 FPRGY 133
           FPRGY
Sbjct: 67  FPRGY 71

>Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}
           similar to Ashbya gossypii AFR096W
          Length = 952

 Score = 83.2 bits (204), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 38/48 (79%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           R +QACDRCR KK +CDG RP C+ C  +G++C+ SDKL+RR FPRGY
Sbjct: 25  RSSQACDRCRLKKIKCDGVRPSCTSCKKIGYQCRTSDKLTRRGFPRGY 72

>YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zinc
           cluster transcriptional activator that binds to the
           carbon source-responsive element (CSRE) of gluconeogenic
           genes; involved in the positive regulation of
           gluconeogenesis; regulated by Snf1p protein kinase;
           localized to the nucleus
          Length = 829

 Score = 83.2 bits (204), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 47/84 (55%), Gaps = 13/84 (15%)

Query: 50  AANNTTMSPTPLNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCS 109
            +N   + PT  +S+N  T  SV             R A ACDRCR KK +CDG +P CS
Sbjct: 18  CSNKVLIVPTGQSSSNAITDFSV-------------RKAHACDRCRLKKIKCDGLKPNCS 64

Query: 110 QCAAVGFECKISDKLSRRAFPRGY 133
            CA + F CK SDKLSRR  P+GY
Sbjct: 65  NCAKIDFPCKTSDKLSRRGLPKGY 88

>SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 919

 Score = 82.8 bits (203), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 37/48 (77%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           R +QACDRCR KK +CDG +P C+ C  VGF C+ SDKL+RR FPRGY
Sbjct: 24  RSSQACDRCRLKKIKCDGLKPNCTSCKKVGFHCQTSDKLTRRGFPRGY 71

>Suva_6.161 Chr6
           complement(283370..284500,284547..284764,284948..285781,
           285812..286127) [2499 bp, 832 aa] {ON} YJL089W (REAL)
          Length = 832

 Score = 81.6 bits (200), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 41/64 (64%), Gaps = 2/64 (3%)

Query: 72  VTSGADTPASASNYRV--AQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAF 129
           V +G  T  +  ++ V  A ACDRCR KK +CDG +P CS C  + F CK SDKLSRR  
Sbjct: 25  VPTGPSTANAVPDFSVRKAHACDRCRLKKIKCDGLKPNCSNCGKIDFPCKTSDKLSRRGL 84

Query: 130 PRGY 133
           P+GY
Sbjct: 85  PKGY 88

>Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OFF}
           YJL089W (SIP4) - shows homology to DNA binding domain of
           Gal4p, has a leucine zipper motif and acidic region;
           lexA-Sip4p activates transcription [contig 304] PARTIAL
          Length = 201

 Score = 76.3 bits (186), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 37/48 (77%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           R++QACDRCR KK +CDG +P C  C+ + F C+ SDKLSRR FPRGY
Sbjct: 24  RMSQACDRCRLKKIKCDGVKPTCGPCSKIKFHCQTSDKLSRRGFPRGY 71

>TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.277
           YJL089W
          Length = 945

 Score = 79.7 bits (195), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 35/48 (72%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           R + ACDRCR KK RCDG +P CSQC+   F C  SDKL+RR FP+GY
Sbjct: 54  RHSHACDRCRLKKVRCDGLKPSCSQCSRANFRCTTSDKLTRRGFPKGY 101

>NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON} 
          Length = 1186

 Score = 79.0 bits (193), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 36/54 (66%)

Query: 80  ASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           AS    R  QACDRCR KK +CD  +P CSQC    F+CK +DKL+RR F RGY
Sbjct: 111 ASIDKPRKIQACDRCRLKKIKCDDLKPSCSQCLKADFQCKTTDKLARRGFSRGY 164

>CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]
           {ON} some similarities with uniprot|P46954 Saccharomyces
           cerevisiae YJL089w SIP4 interacts with SNF1 protein
           kinase
          Length = 1209

 Score = 78.6 bits (192), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 37/48 (77%), Gaps = 1/48 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           R +QACDRCRSKK +CDG +P CS CA +G+ C  SDKLSRR  P+GY
Sbjct: 24  RHSQACDRCRSKKIKCDGLQP-CSNCAKIGYNCVTSDKLSRRGLPKGY 70

>KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1.277
           YJL089W
          Length = 1072

 Score = 76.6 bits (187), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 35/49 (71%)

Query: 85  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           +R  QACDRCR KK +CDG +P C+ CA + F CK S KLSRR  P+GY
Sbjct: 22  FRKNQACDRCRLKKIKCDGLKPTCTNCAKINFLCKTSHKLSRRGLPKGY 70

>TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa]
           {ON} Anc_1.277 YJL089W
          Length = 757

 Score = 73.9 bits (180), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (68%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           R +QACDRCR KK +CDG  P C+ C  + F C+ + KLSRR  P+GY
Sbjct: 96  RHSQACDRCRLKKIKCDGLIPHCTNCRKINFNCQTTHKLSRRGLPKGY 143

>NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa]
           {ON} Anc_1.277
          Length = 932

 Score = 65.5 bits (158), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 30/45 (66%)

Query: 89  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           QACDRCR KK +CD + P C+ C   G  C+ +++L RR F +GY
Sbjct: 43  QACDRCRLKKIKCDDRTPDCTPCMKAGIPCRTTERLKRRGFAKGY 87

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 56.2 bits (134), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 100/226 (44%), Gaps = 28/226 (12%)

Query: 500 QSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKAQQGE 559
            S+Q   + LF+      +++ Y   G  +  + +   HR     +  N + ++  +   
Sbjct: 417 HSIQTIIILLFFCQCSARLTTCYSYIGAALRAALKEGYHR----RVDPNNTTLNPIEIEM 472

Query: 560 RRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEGRVSML 619
           R+ +F+ IY LDV+    +G+PR L + + +  LP+ +  D+ +   G +   EG+  + 
Sbjct: 473 RKRIFYTIYKLDVYVNSMMGLPRSLSEDDFDQELPI-EISDECITENGYLSEQEGQ-QLS 530

Query: 620 SLSVIRFAKVLGNILDSIFKRGMSA-----SLTKQISLVHENALDNWRRGLPQQLKFELD 674
           S+S+  +   L  IL  I +R  S      S+T+   +  EN L  W   LP +LK    
Sbjct: 531 SISIANYHTKLYLILADIVQRLYSIKKKNRSITENTVISLENKLRKWADSLPHELK---- 586

Query: 675 VNGTINMDEFNHLKQLDTSGNMYSKENKSLMVLYFMAKCMIHLPVV 720
             G +++ +             Y + NK L + Y   + +++ P +
Sbjct: 587 -PGAVDVPQ------------KYERANKLLHLSYLQVQLILYRPFI 619

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 8/58 (13%)

Query: 61  LNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           +NSN +    SVT            RV +ACD CR KK +CDG+ P C  C    ++C
Sbjct: 49  MNSNKLSNVASVTQ-------KKRRRVTRACDECRKKKVKCDGQNP-CIHCTVYSYKC 98

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {ON}
           Anc_2.231 YIL130W
          Length = 1000

 Score = 55.5 bits (132), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 36/74 (48%), Gaps = 11/74 (14%)

Query: 54  TTMSPTPLNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAA 113
           TT++   +NSN  G           P      RV +ACD CR KK +CDG++P C  C  
Sbjct: 39  TTLNIHSINSNTQGN----------PIQLKRRRVTRACDECRKKKVKCDGQQP-CIHCTV 87

Query: 114 VGFECKISDKLSRR 127
             +EC  +   +RR
Sbjct: 88  YSYECTYNQPSTRR 101

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 90/185 (48%), Gaps = 20/185 (10%)

Query: 499 IQSLQFTSLQLFYFLNI-GEVSSVYDLRGKVVSMSQQLR--LHRC-PSAVLG-GNGSAVS 553
           + S+Q T L LF FL     +S+ Y   G  V++   LR  LHR  P+  +G G  S  +
Sbjct: 375 LNSIQ-TILMLFIFLQCSARLSTCYSYIG--VALRSALREGLHRVIPTNKIGTGTDSRFN 431

Query: 554 KAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALE 613
             +   R+ LF+ IY LD++    LG+PR +  ++ + +LP   +D+   N+    I  +
Sbjct: 432 CIEIEMRKRLFYTIYKLDIYVNAMLGLPRSISPNDFDQSLPFDLSDE---NITKDEIFFD 488

Query: 614 GRVSMLSLSVI--RFAKVLGNILDSIFKRGMSASLTKQISLVH------ENALDNWRRGL 665
            + ++LS + I  +  K++  I DSI         T +  + H      E  L++W   L
Sbjct: 489 RQNNVLSSAGIANQHTKLMM-IFDSIITELYPIKKTSKFFISHDSITNFELKLNHWLNNL 547

Query: 666 PQQLK 670
           P +LK
Sbjct: 548 PIELK 552

>TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa]
           {ON} Anc_1.128 YJL206C
          Length = 691

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 79/165 (47%), Gaps = 20/165 (12%)

Query: 560 RRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEGRVSML 619
           ++ LFW +Y +D++    LG+PR L +  I   LP  D DD+K+   G +    G++S  
Sbjct: 345 KKRLFWSVYKVDLYMNCILGLPRTLSESAINQELP-RDVDDEKITTKGILAQDWGKISSC 403

Query: 620 SLS--VIRFAKVLGNILDSIFK--RGMSASLTKQISLVHENALDNWRRGLPQQLKFELDV 675
            ++    +   V+  I +S++   +   A+    I+L  ++ L+ W   LP QLK +   
Sbjct: 404 GMNNQHTKLMLVMARIHESLYPVLKWDQATYVNIINL--QDKLNEWFIELPMQLKPDYQF 461

Query: 676 NGTINMDEFNHLKQLDTSGNMYSKENKSLMVLYFMAKCMIHLPVV 720
                   FN     +   N Y K NK L + Y +AK +++ P +
Sbjct: 462 --------FN-----EEERNYYLKPNKLLYLDYLLAKIILYKPFI 493

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 1/35 (2%)

Query: 81  SASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 115
           + S  RV++AC+ CRSKK +CDG++P C  C  VG
Sbjct: 120 TTSKGRVSRACEFCRSKKKKCDGQQP-CDLCKLVG 153

>KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]
           {ON} some similarities with uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 678

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%)

Query: 90  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           AC  C+ ++ RCDG  PQC  C   G +C   DK++ R  PR Y
Sbjct: 66  ACCFCKRRRKRCDGGFPQCGACVNAGIQCTFVDKITGRELPRDY 109

>KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {ON}
           weakly similar to uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 775

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 29/54 (53%)

Query: 80  ASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           +S + YR   AC RCR +K +CD K P C++C      C   D  +RR  PR Y
Sbjct: 9   SSGNIYRSVAACKRCRIRKIKCDNKFPSCTKCIQAQEPCITIDPSTRREIPRSY 62

>NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {ON}
           Anc_5.235
          Length = 890

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%)

Query: 69  GTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 128
           G S+ +G+ + ++ +  +   AC RCRSKK +CD K P C +CA +   C   D  + + 
Sbjct: 19  GNSLKNGSPSSSTFNTSKSKSACKRCRSKKIKCDQKFPSCDRCAHLKVPCVSVDPATGQD 78

Query: 129 FPRGY 133
            PR Y
Sbjct: 79  VPRSY 83

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.231
           YIL130W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 852

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 66/269 (24%), Positives = 114/269 (42%), Gaps = 42/269 (15%)

Query: 462 KAENLPATNKYSQLMAY-YDIVVRQLMMNPYFNLKSTSIQSLQFTSLQLFYFLNI-GEVS 519
           K E+  A +K+ +   Y Y I  R+L+        +  + S+Q T L LF FL     +S
Sbjct: 295 KGEDAAARDKFLEDEGYKYFIAARKLIDI----TNARDLNSIQ-TILMLFIFLQCSARLS 349

Query: 520 SVYDLRGKVVSMSQQLR--LHRCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQ 577
           + Y   G  V+M   LR  LHR  S       S  S  +   R+ LF+ IY LDV+    
Sbjct: 350 TCYAYIG--VAMRSALREGLHRSVSP-----DSGFSPIEIEMRKRLFYTIYKLDVYVNAM 402

Query: 578 LGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEGRVSMLSLSVI-----RFAKVLGN 632
           LG+PR +  ++ +  LP+  +D+   N+  +    E +   LS + I     +   +L  
Sbjct: 403 LGLPRSISSNDFDQTLPIELSDE---NITEEGYFPENQKGKLSSAEIANQHTKLIMILNV 459

Query: 633 ILDSIFK-RGMSASLTKQISLVHENALDNWRRGLPQQLKFELDVNGTINMDEFNHLKQLD 691
           I+  ++  R  +  +  ++    E  L  W  GLP++L                 +  + 
Sbjct: 460 IVGELYPIRKTNNLIRHEVVTELELKLRQWLDGLPREL-----------------IPGIK 502

Query: 692 TSGNMYSKENKSLMVLYFMAKCMIHLPVV 720
                Y   NK L + +F  + +++ P +
Sbjct: 503 DVPKEYETANKLLHLSFFHVQLILYRPFI 531

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 15  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 46

>NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {ON}
           Anc_6.279
          Length = 960

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 27/45 (60%)

Query: 89  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           QACD CR KK +C  ++P+C++C   G+EC  S K  R    R +
Sbjct: 10  QACDICRIKKLKCSREKPKCAKCMKNGWECCYSPKAKRSPLTRAH 54

>SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {ON}
           similar to uniprot|P07272 Saccharomyces cerevisiae
           YLR014C PPR1 Zinc finger transcription factor containing
           a Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 898

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           R   AC+RCR+KKT+CD   P C++CA++G  C   D  + R   R Y
Sbjct: 48  RSIVACERCRTKKTKCDQNFPSCARCASLGEPCISVDPATGRVVSRSY 95

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           RV +ACD CR KK +CDGK+P C  C    +EC
Sbjct: 9   RVTRACDECRKKKVKCDGKQP-CIHCTVYNYEC 40

 Score = 39.3 bits (90), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 94/213 (44%), Gaps = 24/213 (11%)

Query: 468 ATNKYSQLMAY-YDIVVRQLMMNPYFNLKSTSIQSLQFTSLQLFYFLNI-GEVSSVYDLR 525
           A+ K+ Q   Y Y I  R+L+        +  + S+Q T + LF FL     +S+ Y   
Sbjct: 374 ASTKFLQDEGYKYFIAARKLIDI----TNARDLNSIQ-TIVLLFLFLQCSARLSTSYSYI 428

Query: 526 GKVVSMSQQLR--LHRCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRL 583
           G  V+M   LR  LHR          +   + +  +R  LF+ IY +D++    LG+PR 
Sbjct: 429 G--VAMRSALREGLHRKIKPDPSKTKTNFIEIEMRKR--LFYTIYKMDIYINTMLGLPRT 484

Query: 584 LKDHEIECALPVADNDDQKVNLAGQMIALEGRVSMLSLSVI--RFAKVLGNILDSIFK-- 639
           +   + +  LP+  NDD    +    I  E +  +LS + I  +  K+L  ILD I    
Sbjct: 485 ISPRDFDQELPLELNDDY---ITEDAIYPEEQGDVLSSAGIANQHTKILM-ILDQIMADL 540

Query: 640 ---RGMSASLTKQISLVHENALDNWRRGLPQQL 669
              +  +  ++ Q+    E  L  W   LP +L
Sbjct: 541 YPIKKTNNLISHQMVTNLELKLRQWLDQLPPEL 573

>SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 906

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 26/48 (54%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           R   AC RCR KK +CD K P CS+CA+    C   D  + R  PR Y
Sbjct: 38  RSIAACKRCRLKKVKCDQKFPSCSKCASANEPCVSLDPATGRDVPRSY 85

>YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}
           GAL4DNA-binding transcription factor required for the
           activation of the GAL genes in response to galactose;
           repressed by Gal80p and activated by Gal3p
          Length = 881

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 87  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           + QACD CR KK +C  ++P+C++C    +EC+ S K  R    R +
Sbjct: 7   IEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAH 53

>KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.279
           YPL248C
          Length = 875

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%)

Query: 83  SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           +N    QACD CR KK +C   +P C +CA  G+ C  S K  R    R +
Sbjct: 13  ANSSTDQACDLCRIKKLKCSKDKPACRKCAKNGWNCTYSPKAKRSPLTRAH 63

>Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C
           (REAL)
          Length = 878

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 87  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           + QACD CR KK +C  ++P+C++C    +EC+ S K  R    R +
Sbjct: 7   IEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAH 53

>Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 bp,
           881 aa] {ON} complement(81534..83840,83842..84180) [2646
           nt, 882 aa]
          Length = 881

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%)

Query: 83  SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           SN    Q CD CR KK +C  ++P+C +C    +EC  S K+ R    R +
Sbjct: 2   SNIITNQVCDSCRLKKLKCSKEKPKCFKCLKHNWECNYSPKIKRSPLTRAH 52

>NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]
           {ON} Anc_7.17
          Length = 1059

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (64%)

Query: 85  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           YR++  C  CR  KT+CD ++P CS+C  +G  C
Sbjct: 47  YRLSFVCQECRKSKTKCDKEKPSCSRCLKIGITC 80

>Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON}
           (71447..74704) [3258 nt, 1086 aa]
          Length = 1085

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 5/71 (7%)

Query: 52  NNTTMSPTPLNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDG----KRPQ 107
           NN  +    +  N    G+++ S   T       RVA+ACDRCR +K +CD     K  +
Sbjct: 85  NNNDLMMKNIKDNQHVVGSAIKSNVST-TKVQKRRVARACDRCRKRKIKCDEIKNLKVNK 143

Query: 108 CSQCAAVGFEC 118
           CS C   G EC
Sbjct: 144 CSNCVKYGAEC 154

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {ON}
           Anc_2.231 YIL130W
          Length = 848

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 13  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 44

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 96/210 (45%), Gaps = 22/210 (10%)

Query: 470 NKYSQLMAY-YDIVVRQLMMNPYFNLKST-SIQSLQFTSLQLFYFLNI-GEVSSVYDLRG 526
           NK+ Q   Y Y I  R+L+     ++ +T  + S+Q T L LF FL     +SS Y   G
Sbjct: 289 NKFLQDEGYKYFIAARKLI-----DITNTRDLNSIQ-TVLMLFIFLQCSARLSSCYTYIG 342

Query: 527 KVVSMSQQLR--LHRCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLL 584
             V+M   LR   HR        N   ++  +   ++ LF+ +Y +D++    LG+PR L
Sbjct: 343 --VAMRSVLREGYHRASDP----NDPNINPIELEMKKRLFYNVYKMDIYINAMLGLPRSL 396

Query: 585 KDHEIECALPVADNDDQKVNLAGQMIALE-GRVSMLSLS--VIRFAKVLGNILDSIFKRG 641
           +  + +  LP+ +  D+ +   G     + G +S +++S    +   V   I+  ++   
Sbjct: 397 RVEDFDQTLPI-ELSDENITAEGYFYERQKGELSSIAISNQHTKLIMVFDTIVSELYPLK 455

Query: 642 MSASLTKQISLVH-ENALDNWRRGLPQQLK 670
            + ++    ++   E  L  W   LP +L+
Sbjct: 456 KTNNMISHETVTRLEAKLTEWVDNLPVELR 485

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {ON}
           Anc_2.231 YIL130W
          Length = 930

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 82  ASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSR 126
           A   RV +ACD CR KK +CDG++P C  C    +EC  +    R
Sbjct: 30  AKRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPTKR 73

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 85/186 (45%), Gaps = 23/186 (12%)

Query: 498 SIQSLQFTSLQLFYFLNI-GEVSSVYDLRGKVVSMSQQLR--LHRCPSAVLGGNGSAVSK 554
           SIQ++    L +F FL     +S+ Y   G  V+M   LR  LHR       G  S  + 
Sbjct: 377 SIQAI----LMMFIFLQCSARLSTCYSYIG--VAMRSALREGLHR-----QVGPNSGFNP 425

Query: 555 AQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEG 614
            +   R+ LF+ IY LD++    LG+PR +  ++ +  LP+  +D+   N+  Q    E 
Sbjct: 426 IEIEMRKRLFYTIYKLDIYVNAMLGLPRSISANDFDQTLPLELSDE---NITEQGYFPEN 482

Query: 615 RVSMLSLSVI-----RFAKVLGNILDSIFK-RGMSASLTKQISLVHENALDNWRRGLPQQ 668
           +  +LS + I     +   +L  I+  ++  +  +  ++ +     E  L NW   LP +
Sbjct: 483 QNGVLSSTGIANEHTKLLMILDAIVGELYPIKKTNTFISHETIATLEQKLRNWLDDLPNE 542

Query: 669 LKFELD 674
           L   L+
Sbjct: 543 LAPNLE 548

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
           {ON} Anc_2.231
          Length = 906

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 32  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 100/239 (41%), Gaps = 46/239 (19%)

Query: 498 SIQSLQFTSLQLFYFLNI-GEVSSVYDLRGKVVSMSQQLR--LHRCPSAVLGGNGSAVSK 554
           SIQ++    L LF FL     +S+ Y   G  V+M   LR   HR       G  S  + 
Sbjct: 354 SIQAI----LMLFIFLQCSARLSTCYAYIG--VAMRSALREGYHR-----QVGPLSGFTP 402

Query: 555 AQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEG 614
            +   R+ LF+ IY LD++    LG+PR +   + +  LP+  +D+   N+       E 
Sbjct: 403 IEIEMRKRLFYTIYKLDIYVNAMLGLPRSISPDDFDQTLPIELSDE---NITEHGYLPEN 459

Query: 615 RVSMLSLSVI-----RFAKVLGNILDSIFKRGMSASLTKQISLVH-ENALDNWRRGLPQQ 668
           +  +LS + I     +   +L +I+  ++    + +L    ++   E  L  W   LP +
Sbjct: 460 QNGVLSSTGIANQHTKLLMILNSIVRELYPIKKTNNLISHETVTRLELKLRTWMDELPTE 519

Query: 669 LKFELDVNGTINMDEFNHLKQLDTSGNMYSKENKSLMVLYFMAKCMIHLPVVAKRPLVN 727
           L                 +  L+     Y + NK L+ L F+     H+ ++  RP ++
Sbjct: 520 L-----------------VPNLENIPAKYERANK-LLHLSFL-----HVQIILYRPFIH 555

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
           (REAL)
          Length = 1012

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 81  SASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           S    RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 11  SVKRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 62/225 (27%), Positives = 101/225 (44%), Gaps = 27/225 (12%)

Query: 456 GLISKVKAENLPATNKYSQLMAY-YDIVVRQLMMNPYFNLKS-TSIQSLQFTSLQLFYFL 513
            L SK    N  +  K+ Q   Y Y I  R+L+     N +   SIQ++    L LF FL
Sbjct: 306 ALFSKSIVSNDSSREKFLQDEGYKYFIAARKLI--DITNARDLNSIQAI----LMLFIFL 359

Query: 514 NI-GEVSSVYDLRGKVVSMSQQLR--LHRCPSAVLGGNGSAVSKAQQGERRILFWGIYYL 570
                +S+ Y   G  V+M   LR   HR  S+      S  S  +   R+ LF+ IY L
Sbjct: 360 QCSARLSTCYTYIG--VAMRSALRAGFHRKLSS-----SSGFSPIEIEMRKRLFYTIYKL 412

Query: 571 DVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEGRVSMLSLSVI-----R 625
           DV+    LG+PR +   + +  LP+  +D+   N+       E + S+LS + I     +
Sbjct: 413 DVYINAMLGLPRSISPDDFDQTLPLDLSDE---NITEVAYLPENQHSVLSSTGISNEHTK 469

Query: 626 FAKVLGNILDSIFKRGMSASLTKQISLVH-ENALDNWRRGLPQQL 669
              +L  I+  ++    ++++    ++   E  L NW   LP++L
Sbjct: 470 LFLILNEIISELYPIKKTSNIISHETVTSLELKLRNWLDSLPKEL 514

>NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279
          Length = 890

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%)

Query: 87  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 131
           + QACD CR KK +C  + P+CS+C   G +C  S K+ R    R
Sbjct: 16  IEQACDNCRLKKLKCSKETPKCSKCLKNGMKCLYSPKVKRSPLTR 60

>ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} similar
           to uniprot|P04386 Saccharomyces cerevisiae YPL248C GAL4
           DNA-binding transcription factor required for the
           activation of the GAL genes in response to galactose
           repressed by Gal80p and activated by Gal3p
          Length = 794

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%)

Query: 87  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           +  ACD CR KK RC  + P+C++C   G+EC  S K +R    R +
Sbjct: 7   IDHACDSCRQKKLRCSKEEPKCAKCIQNGWECCYSPKANRTPLTRAH 53

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)
          Length = 954

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 100/223 (44%), Gaps = 23/223 (10%)

Query: 456 GLISKVKAENLPATNKYSQLMAYYDIVVRQLMMNPYFNLKSTSIQSLQFTSLQLFYFLNI 515
            L SK    N  +  K+ Q   Y   +  + +++   +    SIQ++    L LF FL  
Sbjct: 304 ALFSKSIVSNDSSREKFLQDEGYKYFIAARKLIDITNSRDLNSIQAI----LMLFIFLQC 359

Query: 516 -GEVSSVYDLRGKVVSMSQQLR--LHRCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDV 572
              +S+ Y   G  V+M   LR   HR     LG N S  S  +   R+ LF+ IY LDV
Sbjct: 360 SARLSTCYTYIG--VAMRSALRAGFHR----KLGTN-SGFSPIEIEMRKRLFYTIYKLDV 412

Query: 573 FSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEGRVSMLSLSVI-----RFA 627
           +    LG+PR +   + +  LP+  +D+   N+       E + ++LS + I     +  
Sbjct: 413 YINAMLGLPRSISPDDFDQTLPLDLSDE---NITETAYLPENQNAVLSSTGISNEHTKLF 469

Query: 628 KVLGNILDSIFKRGMSASLTKQISLVH-ENALDNWRRGLPQQL 669
            +L  I+  ++    ++++    ++   E  L NW   LP++L
Sbjct: 470 LILNEIISELYPIKKTSNIISHETVTSLELKLRNWLDSLPKEL 512

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 81  SASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           S    RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 11  SVKRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
           (REAL)
          Length = 926

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 81  SASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           S    RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 11  SVKRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 100/225 (44%), Gaps = 27/225 (12%)

Query: 456 GLISKVKAENLPATNKYSQLMAY-YDIVVRQLMMNPYFNLKS-TSIQSLQFTSLQLFYFL 513
            L SK    N  +  K+ Q   Y Y I  R+L+     N +   SIQ++    L LF FL
Sbjct: 303 ALFSKSIVSNDSSREKFLQDEGYKYFIAARKLI--DITNARDLNSIQAI----LMLFIFL 356

Query: 514 NI-GEVSSVYDLRGKVVSMSQQLR--LHRCPSAVLGGNGSAVSKAQQGERRILFWGIYYL 570
                +S+ Y   G  V+M   LR   HR  SA      S  +  +   R+ LF+ IY L
Sbjct: 357 QCSARLSTCYTYIG--VAMRSALRAGFHRKLSA-----NSGFTPIEIEMRKRLFYTIYKL 409

Query: 571 DVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEGRVSMLSLSVI-----R 625
           DV+    LG+PR +   + +  LP+  +D+   N+       E + ++LS + I     +
Sbjct: 410 DVYINAMLGLPRSISPEDFDQTLPLDLSDE---NITEVAYLPENQNAVLSSTGISNEHTK 466

Query: 626 FAKVLGNILDSIFKRGMSASLTKQISLVH-ENALDNWRRGLPQQL 669
              +L  I+  ++    + ++    ++   E  L NW   LP++L
Sbjct: 467 LFLILNEIISELYPIKKTNNIISHETVTSLELKLRNWLDSLPKEL 511

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
           cluster protein proposed to function as a
           transcriptional regulator involved in the stress
           response; null mutants have a respiratory deficiency,
           calcofluor white sensitivity and slightly increased
           cycloheximide resistance
          Length = 964

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 99/225 (44%), Gaps = 27/225 (12%)

Query: 456 GLISKVKAENLPATNKYSQLMAY-YDIVVRQLMMNPYFNLKS-TSIQSLQFTSLQLFYFL 513
            L SK    N  +  K+ Q   Y Y I  R+L+     N +   SIQ++    L L  FL
Sbjct: 303 ALFSKSIVSNDSSREKFLQDEGYKYFIAARKLI--DITNARDLNSIQAI----LMLIIFL 356

Query: 514 NI-GEVSSVYDLRGKVVSMSQQLR--LHRCPSAVLGGNGSAVSKAQQGERRILFWGIYYL 570
                +S+ Y   G  V+M   LR   HR  S       S  S  +   R+ LF+ IY L
Sbjct: 357 QCSARLSTCYTYIG--VAMRSALRAGFHRKLSP-----NSGFSPIEIEMRKRLFYTIYKL 409

Query: 571 DVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEGRVSMLSLSVI-----R 625
           DV+    LG+PR +   + +  LP+  +D+   N+       E + S+LS + I     +
Sbjct: 410 DVYINAMLGLPRSISPDDFDQTLPLDLSDE---NITEVAYLPENQHSVLSSTGISNEHTK 466

Query: 626 FAKVLGNILDSIFKRGMSASLTKQISLVH-ENALDNWRRGLPQQL 669
              +L  I+  ++    ++++    ++   E  L NW   LP++L
Sbjct: 467 LFLILNEIISELYPIKKTSNIISHETVTSLELKLRNWLDSLPKEL 511

>KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {ON}
           Anc_1.128 YJL206C
          Length = 658

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 78/182 (42%), Gaps = 23/182 (12%)

Query: 499 IQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKAQQG 558
           I S+Q   +   +    G++ + Y   G  + ++ +  LHR PS      G    + +  
Sbjct: 240 IHSIQAIFMMTIFLQCSGDLKACYYYIGIALRIAIRENLHRKPSLT----GPTAIEDETK 295

Query: 559 ERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMI-------- 610
           +R  LFW IY +D++    LG+P  L +  I+  LP  D DD+K+   G +         
Sbjct: 296 KR--LFWSIYKVDIYMNCTLGLPASLNESFIDQELP-YDVDDEKIVSDGVIFNENSNIIS 352

Query: 611 --ALEGRVSMLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHENALDNWRRGLPQQ 668
              +    + L L +++  + L +I   I K      +   + L  E+ L  W   LP Q
Sbjct: 353 SCGMNNEHTKLILIMLKIYRTLYSIDVEILK------IDANVVLHLEDILFTWYNNLPLQ 406

Query: 669 LK 670
           LK
Sbjct: 407 LK 408

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 27/48 (56%), Gaps = 5/48 (10%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           RV +AC  CR KK RCDGK P CS CA     C+ ++     A PR +
Sbjct: 27  RVFKACIACRKKKRRCDGKSP-CSHCARTSIICEYTNT----ARPRSH 69

>NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {ON}
           Anc_6.279
          Length = 935

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%)

Query: 89  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           QACD CR KK +C  ++P+C++C    +EC  S K  R    R +
Sbjct: 11  QACDLCRVKKLKCSKEKPKCAKCLKNNWECCYSPKTRRSPLTRAH 55

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.231
           YIL130W
          Length = 902

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 82  ASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           A   RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 28  AKRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/184 (28%), Positives = 81/184 (44%), Gaps = 23/184 (12%)

Query: 496 STSIQSLQFTSLQLFYFLNI-GEVSSVYDLRGKVVSMSQQLR--LHRCPSAVLGGNGSAV 552
           S SIQ    T L LF FL     +S+ Y   G  V+M   LR   HR       G  S +
Sbjct: 375 SNSIQ----TVLMLFIFLQCSARLSTCYAYIG--VAMRSALREGFHR-----KVGPESDL 423

Query: 553 SKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIAL 612
           S  +   R+ LF+ IY LDV+    LG+PR +   + +  LP+  +D+   N+  Q    
Sbjct: 424 SPLEIEIRKRLFYTIYKLDVYVNAMLGLPRSISPEDFDQVLPLELSDE---NITEQAYYP 480

Query: 613 EGRVSMLSLSVI-----RFAKVLGNILDSIFKRGMSASLTKQISLVH-ENALDNWRRGLP 666
           E     LS + I     R   +L  I+  ++      ++    ++ + E  L +W   LP
Sbjct: 481 EREDGSLSSTGIANCHTRLIMILDTIMRKLYPIKRPNNVISHETVTNLEKLLRDWTNTLP 540

Query: 667 QQLK 670
            +LK
Sbjct: 541 AELK 544

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
           (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 80/178 (44%), Gaps = 12/178 (6%)

Query: 497 TSIQSLQFTSLQLFYFLNI-GEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKA 555
           TSIQ++    + LF FL     +S+ Y   G  +  + +  LHR     +    S ++  
Sbjct: 468 TSIQTI----IMLFLFLQFSARLSNCYSYIGIALRNALREGLHR----FVNPKSSNLNPL 519

Query: 556 QQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEGR 615
               R+ +F+ IY  D++    LG+P+ L   + +  LPV  +D+             G 
Sbjct: 520 DIEMRKRVFYTIYKCDLYLNSMLGLPKSLSSADFDQVLPVELSDENITEEGYFPDKQNGE 579

Query: 616 VSMLSLS--VIRFAKVLGNILDSIFKRGMSASLTKQISLVH-ENALDNWRRGLPQQLK 670
           VS  +++    +   +L +I   ++    S ++    ++   E  L+NW + LPQQLK
Sbjct: 580 VSSAAIANYHTKLMLILADITKELYPNKKSNNIVSHETVTQLEMRLENWIQSLPQQLK 637

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           RV +ACD CR KK +CDG++P C  C    + C
Sbjct: 31  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYNC 62

>Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}
           similar to Ashbya gossypii AER183C
          Length = 898

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 127
           RV++ACD CR+KK +C+G+ P CS C     EC  +  + RR
Sbjct: 22  RVSKACDTCRAKKIKCNGEEP-CSNCGKHDLECAYTHVIKRR 62

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 82/181 (45%), Gaps = 22/181 (12%)

Query: 498 SIQSLQFTSLQLFYFLNI-GEVSSVYDLRGKVVSMSQQLR--LHRCPSAVLGGNGSAVSK 554
           SIQ++    + LF FL     +S+ Y   G  V+M   LR  +HR     L  +  + + 
Sbjct: 293 SIQAI----VMLFIFLQCSARLSTCYTYIG--VAMRNALREGMHRN----LNADTHSYNP 342

Query: 555 AQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEG 614
            +   R+ LF+ IY +DV+    LG+PR +   + + ALP A+  D+ +   G     +G
Sbjct: 343 IEIEMRKRLFYTIYKMDVYVNTMLGLPRSVSQRDFDQALP-AELTDEFITKDGLHFEKQG 401

Query: 615 RVSMLSLSVI-----RFAKVLGNILDSIFKRGMSASLTKQISLVH-ENALDNWRRGLPQQ 668
            V  LS + I     +   +L NI+  ++    + +L     +   E  L  W   LP +
Sbjct: 402 NV--LSSAGIANQHTKLIMILDNIVAELYPVKKTNNLISHDVVTQLELKLRQWLDNLPPE 459

Query: 669 L 669
           L
Sbjct: 460 L 460

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
           (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 81/181 (44%), Gaps = 22/181 (12%)

Query: 498 SIQSLQFTSLQLFYFLNI-GEVSSVYDLRGKVVSMSQQLR--LHRCPSAVLGGNGSAVSK 554
           SIQ++    + LF FL     +S+ Y   G  V+M   LR  +HR     L  +    S 
Sbjct: 324 SIQAI----VMLFIFLQCSARLSTCYTYIG--VAMRNALREGMHRN----LNTDTHGYSP 373

Query: 555 AQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEG 614
            +   R+ LF+ IY +DV+    LG+PR +   + + ALP A+  D+ +   G     +G
Sbjct: 374 IEIEMRKRLFYTIYKMDVYVNTMLGLPRSVSQRDFDQALP-AELTDEYITEDGLHPEKQG 432

Query: 615 RVSMLSLSVI-----RFAKVLGNILDSIFKRGMSASLTKQISLVH-ENALDNWRRGLPQQ 668
            V  LS + I     +   +L NI+  ++    + +L     +   E  L  W   LP +
Sbjct: 433 DV--LSSAGIANQHTKLIMILDNIVAELYPVKKTNNLISHDVVTQLEFKLRQWLDNLPPE 490

Query: 669 L 669
           L
Sbjct: 491 L 491

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 58/260 (22%), Positives = 109/260 (41%), Gaps = 36/260 (13%)

Query: 505 TSLQLFYFLNI-GEVSSVYDLRGKVVSMSQQLR--LHRCPSAVLGGNGSAVSKAQQGERR 561
           T + LF FL     +S+ Y   G  V+M   LR  LHR  +  +G  G    + +  +R 
Sbjct: 282 TIVMLFIFLQCSARLSTCYAYIG--VAMRSALREGLHR--NLTMGAPGFTPIEIEMRKR- 336

Query: 562 ILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEGRVSMLSL 621
            LF+ IY +D++    LG+PR +   + + + P+ + DD+ +   G  I  E +   LS 
Sbjct: 337 -LFFTIYKMDIYLNTMLGLPRAISQRDFDQSFPL-EIDDEYITEDG--IYPERQGDELSS 392

Query: 622 SVI-----RFAKVLGNILDSIFKRGMSASL-TKQISLVHENALDNWRRGLPQQLKFELDV 675
           + I     +   +L NI+  ++    + +L + ++    E  L  W   LP +L      
Sbjct: 393 AGIANQHTKLIMILDNIVSELYPIKKTNNLISHEVVTNLELKLRQWLNQLPPEL------ 446

Query: 676 NGTINMDEFNHLKQLDTSGNMYSKENKSLMVLYFMAKCMIHLPVVAKRPLVNDPEQSPES 735
                      +  L+     + K N+ L + +   + +++ P +        P + P S
Sbjct: 447 -----------IPGLEDVPPKFYKANRLLHLSFLQVQIVLYRPFIHYLSRTA-PRRDPLS 494

Query: 736 STPSNNCGDRSSSSYVLLQQ 755
              + NC   + +   L Q+
Sbjct: 495 IQRAKNCISVARTVVTLAQE 514

>CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130w
          Length = 847

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSR 126
           +V +ACD CR KK +CDG +P C  C    +EC  +  L R
Sbjct: 15  KVTRACDDCRKKKVKCDGNQP-CIHCTVYSYECTYNHPLKR 54

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 94/213 (44%), Gaps = 27/213 (12%)

Query: 468 ATNKYSQLMAY-YDIVVRQLMMNPYFNLKSTSIQSLQFTSLQLFYFLNI-GEVSSVYDLR 525
           + NK+ Q   Y Y I  R+L+        +  + S+Q T L +F FL     +S+ Y   
Sbjct: 320 SNNKFLQDEGYKYFIAARKLLDIT----NARDLNSMQ-TILMMFIFLQCSARLSTCYTYI 374

Query: 526 GKVVSMSQQLR--LHR-CPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPR 582
           G  ++M   LR   HR  P      + S  +  +   R+ LF+ IY LDV+    LG+P 
Sbjct: 375 G--LAMRSVLREGFHRNLP------DNSIHTPLEIEMRKRLFYTIYKLDVYVNAMLGLPG 426

Query: 583 LLKDHEIECALPVADNDDQKVNLAGQMIALEGRVSMLSLSVI-----RFAKVLGNILDSI 637
            L   + +  LP+   D+    L  Q I  +     LS + I     +   +LG+IL  +
Sbjct: 427 SLDREDFDQELPLDLPDEA---LTEQGINYDQNPYSLSSTGIANEHTKLFMILGDILKHL 483

Query: 638 FK-RGMSASLTKQISLVHENALDNWRRGLPQQL 669
           +  + ++  ++ +     E  L  W   LP++L
Sbjct: 484 YPIKKINIFISHKTVTDLELKLKMWLEELPREL 516

>KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON} 
          Length = 888

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%)

Query: 90  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           AC RCRSKKT+CD K P C +C  +   C   D  +    PR Y
Sbjct: 45  ACKRCRSKKTKCDQKLPSCGKCTKLNTPCISVDPATGEDVPRSY 88

>SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {ON}
           similar to uniprot|P04386 Saccharomyces cerevisiae
           YPL248C GAL4 DNA-binding transcription factor required
           for the activation of the GAL genes in response to
           galactose repressed by Gal80p and activated by Gal3p
          Length = 745

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 25/45 (55%)

Query: 87  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 131
           V QACD CR +K RC  + P+CS+C    +EC  S K  R    R
Sbjct: 5   VQQACDSCRKRKLRCSKELPKCSKCLKHNWECCYSPKAVRSPLTR 49

>YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON}
           PDR1Zinc cluster protein that is a master regulator
           involved in recruiting other zinc cluster proteins to
           pleiotropic drug response elements (PDREs) to fine tune
           the regulation of multidrug resistance genes
          Length = 1068

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 10/74 (13%)

Query: 59  TPLNSNNMGTGTSVTSGADTPASASNY---------RVAQACDRCRSKKTRCDGKRPQCS 109
           TP N  ++ TG    S AD+   ++ +         +V++ACD CR +K +C+GK P C+
Sbjct: 5   TPKNGVHIETGPDTESSADSSNFSTGFSGKIRKPRSKVSKACDNCRKRKIKCNGKFP-CA 63

Query: 110 QCAAVGFECKISDK 123
            C     EC  S +
Sbjct: 64  SCEIYSCECTFSTR 77

>KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {ON}
           some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 979

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 86  RVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           + ++ACD+CR KKTRCD   +RP CS C  +G  C       +R   +GY
Sbjct: 30  KTSRACDQCREKKTRCDFSDERPICSACQRMGKTCTFERVPMKRGPTKGY 79

>KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {ON}
           similar to uniprot|P39529 Saccharomyces cerevisiae
           YJL206C and some similarities with YIL130W
           uniprot|P40467 Saccharomyces cerevisiae YIL130W ASG1
           Proposed transcriptional activator member of the Gal4p
           family of zinc cluster proteins
          Length = 650

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 77/328 (23%), Positives = 133/328 (40%), Gaps = 52/328 (15%)

Query: 423 PNFFDDEKNLFNKRNKSISYK---IFGCILLIICQMGLISKVKAENLPATNKYSQLMAYY 479
           P F    ++L+  +N   S K       +  +I    L  K  AE    T  + Q+M ++
Sbjct: 180 PTFIKVVESLYTVKNFEYSEKQKRFLPLVYSVIAVGALFCKSYAE----TTDHKQMMEFF 235

Query: 480 D------IVVRQLMMNPYFNLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQ 533
                   +  + +++P   + S  ++SLQ   +   +      +SS Y   G  +  + 
Sbjct: 236 QDEGHKYFIEAKCLLDP---INSQDVESLQAIFMLTIFLQCSANLSSGYTYIGIALRTAI 292

Query: 534 QLRLHRCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECAL 593
           +   HR  S         ++  +Q   + LFW IY  D++    LG+P  L +  I+   
Sbjct: 293 KQNFHRKTSL------QNLNLLEQETIKKLFWTIYKTDIYMNCILGLPNSLDESLIDQEF 346

Query: 594 PVADNDDQKVNLAGQMIALEGRVSMLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISLV 653
           P +D DD ++     ++   G++S + ++      +L  I+++  K     SLT   S+ 
Sbjct: 347 P-SDIDDDRILENRLLVQPSGKLSSVGMNNEHTKLIL--IMNNAHKILYPMSLTVT-SIS 402

Query: 654 H------ENALDNWRRGLPQQLKFELDVNGTINMDEFNHLKQLDTSGNM--YSKENKSLM 705
           H      E  L NW   LP QLK E                   TS  +  Y K N+ L 
Sbjct: 403 HSEISKLEGELSNWLERLPFQLKPEFS----------------PTSEKLAPYLKPNRYLH 446

Query: 706 VLYFMAKCMIHLPVVAKRPLVNDPEQSP 733
           + Y  A+ M++ P +    LV D E+ P
Sbjct: 447 LDYLHAEIMLYRPFI--HYLVLDSEEFP 472

 Score = 39.3 bits (90), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 85  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 119
           ++V  AC  C+ +K RCDG+ P C+ C     +C+
Sbjct: 30  HKVKHACSSCKERKVRCDGQSP-CASCINARVKCE 63

>Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {ON}
           YGL013C (REAL)
          Length = 1069

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 16/70 (22%)

Query: 69  GTSVTSGADTPASASNY---------------RVAQACDRCRSKKTRCDGKRPQCSQCAA 113
           G  + +G DT +SA +Y               +V++ACD CR +K +C+GK P C+ C  
Sbjct: 6   GVHIEAGPDTESSADSYNFTIGLSGKVRKPRSKVSKACDNCRKRKIKCNGKFP-CASCEI 64

Query: 114 VGFECKISDK 123
              EC  + +
Sbjct: 65  YSCECTFTTR 74

>KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17
           YOR363C
          Length = 948

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 68  TGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           TG  V   A +     N R++  C  CR+ K +CD ++PQC +C  +G EC
Sbjct: 7   TGPDVVVKAPSQKRKRN-RLSYVCKACRTAKAKCDKEKPQCGRCYKLGVEC 56

>KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5.235
           YLR014C
          Length = 864

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%)

Query: 90  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           AC RCR+KK +CD + P C +CA V   C   D  +    PR Y
Sbjct: 33  ACKRCRAKKIKCDQEFPSCGKCAKVNEPCVSIDPATGEDIPRSY 76

>CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa]
           {ON} similar to uniprot|Q12180 Saccharomyces cerevisiae
           YOL089c HAL9
          Length = 1053

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 7/71 (9%)

Query: 51  ANNTTMSPTPLNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRP---Q 107
           AN T + P P+++N M       S           R A+AC+ CR +KT+CD   P   +
Sbjct: 142 ANGTPLPPQPVSANYMNN----ISQMPGQLHKEKRRAAKACEYCRKRKTKCDEVSPYTNK 197

Query: 108 CSQCAAVGFEC 118
           CS C+  G +C
Sbjct: 198 CSNCSKAGVDC 208

>NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235
          Length = 889

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 23/44 (52%)

Query: 90  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           AC RCR KK +CD   P CS+CA +   C   D  +    PR Y
Sbjct: 21  ACKRCRLKKIKCDNNVPSCSRCAKLRVPCVAVDSATGEDVPRSY 64

>Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}
           YPL248C (REAL)
          Length = 895

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%)

Query: 87  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 131
           + QACD CR KK +C  ++P+CS+C    +EC  S K  R    R
Sbjct: 7   MEQACDICRLKKLKCSKEKPKCSKCLKNNWECCYSPKTKRSPLTR 51

>KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly
           similar to uniprot|P52960 Saccharomyces cerevisiae
           YOR363C PIP2 peroxisome induction pathway 2 (PIP2)
           transcriptional activator of peroxisome proliferation
           may form heterodimer with Oaf1 to activate
           oleate-inducible gene expression activator of peroxisome
           proliferation
          Length = 847

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 83  SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC--KISDKLSRRAFP 130
           S  R++  C  CR +K +CD  +P+C +CA +G EC   +S+++S +  P
Sbjct: 24  SRLRLSFVCRNCRKRKIKCDKAQPKCGRCAKLGLECNYDLSEQISLKKTP 73

>TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.279
           YPL248C
          Length = 993

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 87  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           V QACD CR KK RC  + P+C++C    +EC  S +  R    R +
Sbjct: 8   VDQACDSCRIKKLRCSKENPKCAKCLKNKWECCYSPRKRRSPLTRAH 54

>TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.235
           YLR014C
          Length = 862

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%)

Query: 90  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           AC RCR KK +CD + P C +CA V   C   D  + R  PR Y
Sbjct: 29  ACKRCRLKKIKCDQEFPSCLKCARVKVPCVSLDPATGRDVPRSY 72

>TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1154

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 89  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           QACD CR KK +C  ++P+C++C    +EC  S +  R    R +
Sbjct: 16  QACDSCRLKKLKCSKEKPKCAKCLKNIWECCYSPRAKRSPLTRNH 60

>Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {ON}
           YLR014C (REAL)
          Length = 906

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 90  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 33  ACKRCRQKKIKCDQEFPSCKRCAKLKVPCVSLDPATGKDVPRSY 76

>Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C
           (PPR1) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 246]
           FULL
          Length = 881

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 25/48 (52%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           R   AC RCR +K +CD K P CS+C +    C   D  + R  PR Y
Sbjct: 44  RSIAACKRCRIRKVKCDQKFPSCSRCVSANEPCVSIDPATGRDVPRSY 91

>KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]
           {ON} some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger; overexpression increases salt
           tolerance through increased expression of the
           ENA1(Na+/Li+ extrusion pump) gene while gene disruption
           decreases both salt tolerance and ENA1 expression
          Length = 902

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFP 130
           RV++ACD CR+KK +CDG  P CS C  V  EC  +  + +R  P
Sbjct: 9   RVSKACDACRAKKIKCDGCDP-CSNCKKVSQECGYTYVVKKRQKP 52

>KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 866

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 24/48 (50%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           R   AC RCR +K +CD K P CS+C      C   D  + R  PR Y
Sbjct: 33  RSIAACKRCRVRKVKCDQKFPSCSRCVTANEPCVSVDPATGRDVPRSY 80

>Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W
           (REAL)
          Length = 1046

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 16/85 (18%)

Query: 47  PHVAANNTTMSPTPLNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRP 106
           P + A +++ SP P NS             +T     N R++  C  CR  KT+CD ++P
Sbjct: 36  PGLEAEHSSTSPAPENS-------------ETHNRKRN-RISFVCQACRKSKTKCDREKP 81

Query: 107 QCSQCAAVGFECKISDKLSRRAFPR 131
           +CS+C   G +C + D +S++  PR
Sbjct: 82  ECSRCIKHGLKC-VYD-VSKQPAPR 104

>ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 855

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%)

Query: 90  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           AC RCR+KK +CD + P C +CA     C   D  + R  PR Y
Sbjct: 32  ACKRCRTKKIKCDHEFPSCKKCARANKPCVSLDPATGRDVPRSY 75

>TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%)

Query: 85  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 131
           + + +ACD CR KK +C   RP+C +C   G++C  S ++ R    R
Sbjct: 2   FEMDRACDSCRHKKLKCSKTRPKCKKCLKNGWDCCYSPRIKRSPLTR 48

>TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.17
           YOR363C
          Length = 1232

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           R++  C  CR  KT+CD K+P C++C   G +C
Sbjct: 47  RISFVCQHCRKSKTKCDKKQPHCARCIKHGIQC 79

>Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {ON}
           YOL089C (REAL)
          Length = 1029

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 33/62 (53%), Gaps = 7/62 (11%)

Query: 73  TSGADTPASASNY--RVAQACDRCRSKKTRCDGKRPQ---CSQCAAVGFEC--KISDKLS 125
           TS  D  AS+ N   RV++ACD CR +K RCD   PQ   CS C      C  K  D++ 
Sbjct: 113 TSSNDLIASSKNLKKRVSKACDHCRKRKIRCDEVDPQTNKCSNCVKFQSACTFKHRDEIL 172

Query: 126 RR 127
           R+
Sbjct: 173 RK 174

>TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON}
           Anc_3.109 YOL089C
          Length = 1178

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 39/76 (51%), Gaps = 15/76 (19%)

Query: 50  AANNTTMSP---TPLNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRP 106
           +A++ ++SP    PL  N++          D P SA   RV++ACD CR +K +CD KR 
Sbjct: 217 SASSKSVSPLESIPLQKNDL-------KPYDNPRSAKK-RVSRACDHCRKRKIKCDEKRD 268

Query: 107 ----QCSQCAAVGFEC 118
               +CS C     EC
Sbjct: 269 PNTNKCSNCIKYNSEC 284

>Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {ON}
           YLR014C (REAL)
          Length = 903

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 37/78 (47%), Gaps = 3/78 (3%)

Query: 56  MSPTPLNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 115
           M    LNSN   +  S     D+P  A + +   AC RCR KK +CD + P C +CA + 
Sbjct: 1   MKQKKLNSNK--SNRSHLRKGDSPNIAIS-KSRTACKRCRLKKIKCDQEFPSCKRCAKLQ 57

Query: 116 FECKISDKLSRRAFPRGY 133
             C   D  + +  PR Y
Sbjct: 58  VPCVSLDPATGKDVPRSY 75

>NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1033

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 87  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           + QACD CR KK +C    P+C QC    + C  S K+ R    R +
Sbjct: 7   IEQACDNCRLKKLKCSKHFPKCGQCLKNNWPCIYSPKVKRSPLTRVH 53

>YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON}
           Putative protein of unknown function; similar to
           transcriptional regulators from the Zn[2]-Cys[6]
           binuclear cluster protein family; mRNA is weakly cell
           cycle regulated, peaking in S phase; induced rapidly
           upon MMS treatment
          Length = 758

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 61/249 (24%), Positives = 107/249 (42%), Gaps = 30/249 (12%)

Query: 497 TSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKAQ 556
           T I S+Q   +   +      + + Y   G  +  + +  LHR  S+++G      +  Q
Sbjct: 284 TDIYSIQAIFMMTIFLQCSANLKACYSFIGIALRAALKEGLHR-RSSIVGP-----TPIQ 337

Query: 557 QGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEGRV 616
              ++ LFW +Y LD++    LG P  + + +I+   P+ D DD+ ++  G  I  +   
Sbjct: 338 DETKKRLFWSVYKLDLYMNCILGFPSGIDESDIDQEFPL-DVDDENISTIG--IKFQDWR 394

Query: 617 SMLSLSVIRFAKVLGNILDSIFKRGMSA--------SLTKQISLVHENALDNWRRGLPQQ 668
           ++ S  +      L  I+  I+K   S         S T+ +SL   + LDNW   LP  
Sbjct: 395 TISSCGMNNKHTKLILIMSRIYKLMYSLRRKPLEEDSRTQIVSL--NDQLDNWYAQLPDI 452

Query: 669 LKFELDVNGTINMDEFN---HLKQLDTSGNMYSKENKSLMVLYFMAKCMIHLPVVAKRPL 725
           LK +     TI   +      +   DTS   Y+K  K L + + ++K +++ P      +
Sbjct: 453 LKVD-----TIRYRQTQPPLTVSANDTSSP-YTKPKKLLYLDFLLSKIVLYKPFYHYISI 506

Query: 726 VNDPEQSPE 734
             DP   PE
Sbjct: 507 --DPLDIPE 513

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 119
           R  +AC  CR +K RC G  P C  C    +ECK
Sbjct: 42  RAHRACIACRKRKVRCSGNIP-CRLCQTNSYECK 74

>KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some
           similarities with uniprot|P25502 Saccharomyces
           cerevisiae YKL015W PUT3 Positive regulator of PUT
           (proline utilization) genes zinc-finger transcription
           factor of the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 703

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 95/208 (45%), Gaps = 41/208 (19%)

Query: 507 LQLFYF-LNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKAQQGERRILFW 565
           L + YF L++ + +  Y + G  + ++  L +H+          SA  K  +     +FW
Sbjct: 314 LYVAYFGLSVDKSAFAYVMVGNAIRIAFTLGIHK---------TSATPKNNR-----IFW 359

Query: 566 GIYYLDVFSALQLGVPRLLKDHEIECALPVADN-DDQKVNLAGQMIALEGRVSMLSLSVI 624
             +  D   A++ G P L+  +EIE  +P   + D   ++++ +    E +VS+      
Sbjct: 360 LCFLYDRLLAIRFGFPLLI--NEIEIEIPSCSSFDTDFLSISLEKYHFEAQVSL------ 411

Query: 625 RFAKVLGNILDSIFKRGMSASLTKQISLVHENALDNWRRGLPQQLKFELD---------- 674
             AK+  NI+  I+ +  S+ +    +++ E  L +W  GLP +LKF+ +          
Sbjct: 412 --AKITTNIIKRIYTKNSSSFVHNCHAVLKE--LKDWFDGLPSELKFDYNNFSLETSRPT 467

Query: 675 VNGTINMDEFNHLKQLDTSGNMYSKENK 702
           VN  IN   +N+L  L T   ++   NK
Sbjct: 468 VNLHIN---YNYLIILTTRSVVFYVFNK 492

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%)

Query: 84  NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 115
           N +  +AC+ C+ +K RC G  P C  C  +G
Sbjct: 11  NAKSKRACETCKRRKKRCSGGLP-CEYCVKIG 41

>ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 912

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 131
           RV +AC+ C+ +K +CDG +P C+ C   G ECK      RR + R
Sbjct: 12  RVRKACEICKRRKVKCDGSQP-CANCVKHGQECKYISGTVRRRYRR 56

>SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {ON}
           weakly similar to uniprot|P40467 Saccharomyces
           cerevisiae YIL130W ASG1 Proposed transcriptional
           activator member of the Gal4p family of zinc cluster
           proteins and to YJL206C uniprot|P39529 Saccharomyces
           cerevisiae YJL206C
          Length = 780

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           RV++ACD CR +K RCDG++P C  C    + C
Sbjct: 27  RVSRACDVCRQRKVRCDGRQP-CIHCTVYSYNC 58

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 83/342 (24%), Positives = 144/342 (42%), Gaps = 55/342 (16%)

Query: 393 FFSQWYNFIPILDKDEFYNYYNKFKT--DLMD--PNFFDDEKNLFNKRNKSISYKIFGCI 448
            F  W N+  +L +  FY+  N  +    L D  P  + DE+N           K    I
Sbjct: 244 IFKTW-NYACVLFR--FYHRPNFIRVFNSLYDTNPEDYTDEQN-----------KALPLI 289

Query: 449 LLIICQMGLISK--VKAENLPATNKYSQLMAYYDIVVRQL--MMNPYFNLKSTSIQSLQF 504
             +I    L SK  + A ++ A   +      Y I  R+L  + N      +T + ++Q 
Sbjct: 290 YSVIAVGALFSKEDLGANDVAAREFFQDEGYRYFIAARKLTDITN------ATDVYAIQ- 342

Query: 505 TSLQLFYFLNI-GEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKAQQGERRIL 563
           T   L  FL    ++++ Y   G  +  +    LH   S      G +  +A+  +R  L
Sbjct: 343 TVFMLTIFLQCSAKLTTCYSYIGVALRAAITQGLHTKVSTA----GKSPVEAETCKR--L 396

Query: 564 FWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEGRVSMLSLS- 622
           FW IY +DV+    LG+PR + + +++  LP   +DD+  +L G      G++S   ++ 
Sbjct: 397 FWTIYKMDVYMNCILGLPRSISEEDVDQDLPQDLDDDRITDL-GIEPQPAGKISSCGMNN 455

Query: 623 -VIRFAKVLGNI---LDSIFKRGMSASLTKQISLVHENALDNWRRGLPQQLKFELDVNGT 678
              +   ++ +I   L  +      A+L  +     EN L NW   LP QL+        
Sbjct: 456 QHTKLIVIMNHIHCKLSPLKNDAPPATLLLESVHELENELQNWTLQLPLQLR-------- 507

Query: 679 INMDEFNHLKQLDTSGNMYSKENKSLMVLYFMAKCMIHLPVV 720
                +  L Q +   ++Y K NK L++ +  AK M++ P +
Sbjct: 508 ---PNYTFLDQAE--ADLYLKPNKLLLLDFLHAKIMLYRPFI 544

>Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W
           (REAL)
          Length = 469

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 87  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 128
           V  ACD CR ++ +CDGK+P CS+C    FEC     L +R 
Sbjct: 4   VKYACDFCRVRRVKCDGKKP-CSRCIQHDFECTYQQPLRKRG 44

>KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]
           {ON} some similarities with uniprot|P52960 Saccharomyces
           cerevisiae YOR363C PIP2 peroxisome induction pathway 2
           (PIP2) transcriptional activator of peroxisome
           proliferation may form heterodimer with Oaf1 to activate
           oleate-inducible gene expression activator of peroxisome
           proliferation
          Length = 619

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           R    CD CR +K +CD  +P CS+CA  G EC
Sbjct: 10  RRLHVCDACRIRKLKCDKAKPNCSRCAKHGLEC 42

>SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa]
           {ON} some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1020

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 34/69 (49%), Gaps = 6/69 (8%)

Query: 67  GTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKR--PQCSQCAAVGFECKISDKL 124
           G GT+ +    T  +    +V++ACD+CR KK +CD     P CS C  VG  C      
Sbjct: 16  GNGTTYS----TTETKKRSKVSRACDQCRKKKIKCDVSEDNPVCSGCFKVGDRCTFERVP 71

Query: 125 SRRAFPRGY 133
            +R   +GY
Sbjct: 72  LKRGPSKGY 80

>CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051w OAF1 peroxisome proliferating transcription
           factor or uniprot|P52960 Saccharomyces cerevisiae
           YOR363c PIP2
          Length = 994

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 30/46 (65%), Gaps = 2/46 (4%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 131
           R++  C  CR  KTRCD ++P C++C  +  EC + D +++++ PR
Sbjct: 22  RISFVCQACRRSKTRCDKEKPICTRCKKLKLEC-VYD-MAKQSAPR 65

>Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}
           YJL206C (REAL)
          Length = 833

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 53/245 (21%), Positives = 106/245 (43%), Gaps = 22/245 (8%)

Query: 497 TSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKAQ 556
           T I S+Q   +   +      + + Y   G  +  + +  LHR  S+++G      +  Q
Sbjct: 272 TEIYSIQAIFMMTIFLQCSANLKACYSFIGIALRAALKEGLHR-KSSIVGP-----TPIQ 325

Query: 557 QGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEGRV 616
              ++ LFW +Y LD++    LG P  + + +I+   P+ D DD+ ++  G        +
Sbjct: 326 DETKKRLFWSVYKLDLYMNCILGFPSGIDESDIDQEFPL-DVDDENISTMGIKFQDWRTI 384

Query: 617 SMLSLS-----VIRFAKVLGNILDSIFKRGMSASLTKQISLVHENALDNWRRGLPQQLKF 671
           S   ++     +I     +  ++ S+ ++ +      QI  +++  L+NW   LP  LK 
Sbjct: 385 SSCGMNNKHTKLILIMSRIYKLMYSLRRKPLEEDSRSQIVSLNDQ-LENWYTQLPDILKV 443

Query: 672 ELDVNGTINMDEFNHLKQL--DTSGNMYSKENKSLMVLYFMAKCMIHLPVVAKRPLVNDP 729
           +     TI   +      +  D S + Y+K  K L + + ++K +++ P      +  DP
Sbjct: 444 D-----TIRYRQPQPPANVCADESSSPYTKPKKLLYLDFLLSKIVLYKPFYHYISI--DP 496

Query: 730 EQSPE 734
              PE
Sbjct: 497 LDVPE 501

 Score = 39.3 bits (90), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 119
           R  +AC  CR +K RC G+ P C  C    FECK
Sbjct: 29  RAHRACVACRKRKVRCSGQTP-CRLCQNNSFECK 61

>KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.17
           YOR363C
          Length = 951

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSR 126
           R++  C  CR  KT+CD ++P CS+C     EC    +L R
Sbjct: 60  RISFVCQACRKAKTKCDKEKPMCSRCRKQDLECVYDIELQR 100

>KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {ON}
           Anc_6.279 YPL248C
          Length = 834

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%)

Query: 87  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           + QACD CR KK RC  ++P C +C      C  S +  R    R +
Sbjct: 1   MEQACDICRVKKLRCSKEKPSCFKCLKNNLTCTYSPRAKRSPLTRAH 47

>Ecym_3112 Chr3 (203876..207310) [3435 bp, 1144 aa] {ON} similar to
           Ashbya gossypii AGR280C
          Length = 1144

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/209 (22%), Positives = 90/209 (43%), Gaps = 32/209 (15%)

Query: 388 GLVSDFFSQWYNFIPILDKDEFYNYYNKFKTDLMDPNFFDDEKNLFNKRNKSISYKIFGC 447
            L+  +F++  +  P+LD+ E Y ++  + TD +     +D    F      + + +  C
Sbjct: 300 ALLDTYFNRIQSKYPLLDEQEIYKFHEDYITDNLSEYSLNDYH--FYSGRMWMVFSVAAC 357

Query: 448 ILLIICQMGLISKVKAENLPATNKYSQLMAYYDIVVRQLMMNPYFNLKSTSIQSLQFTSL 507
           I + I         ++  L     +S  + Y       L +           Q L+  +L
Sbjct: 358 IHITIG--------RSLTLSPHRFFSTAIHYVSKCGTALSL----------FQQLEILTL 399

Query: 508 QLFYFLNIGEVSSVYDLRGKVVSMSQ-QLRLHRCPSAVLGGNGSAVSKAQQGERRILFWG 566
            +FY +   + S  YD+   V+++S+ +L LH+  S+    N ++  K +      LFW 
Sbjct: 400 LVFYVIRRDKDSVGYDIIKDVINISKNKLYLHKRTSS---DNFASRKKLR------LFWS 450

Query: 567 IYYLDVFSALQLGVPRLLKDHEIECALPV 595
           +Y L+    + +G P  + + EIE  LP+
Sbjct: 451 VYLLERMICVSIGKPYTISESEIE--LPI 477

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 18/31 (58%)

Query: 88  AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           +++C  C+ +K +CD K P C+ C   G  C
Sbjct: 38  SRSCLLCQRRKQKCDHKIPSCTACLKAGVRC 68

>YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}
           MAL33MAL-activator protein, part of complex locus MAL3;
           nonfunctional in genomic reference strain S288C
          Length = 468

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 87  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 127
           V  ACD CR ++ +CDGK+P CS+C    F+C     L +R
Sbjct: 4   VKYACDYCRVRRVKCDGKKP-CSRCIEHNFDCTYQQPLKKR 43

>KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {ON}
           Anc_4.113 YGL013C
          Length = 995

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 122
           +V QACD CR +K +C GK+P CS C A   +C  S+
Sbjct: 18  KVRQACDNCRKRKLKCTGKQP-CSTCEAYSCDCIYSE 53

 Score = 33.5 bits (75), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 22/36 (61%)

Query: 559 ERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALP 594
           +RR L+W +YY +   A + G+P  + ++ + C LP
Sbjct: 502 KRRTLWWKLYYYEKVIASKRGIPSRINENVMNCLLP 537

>ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL051W
           (OAF1) and YOR363C (PIP2); Tandem gene triplication in
           this genome
          Length = 970

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 2/67 (2%)

Query: 65  NMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKL 124
           +M +G       D    +   R++  C  CR  KT+CD ++P+CS+CA    +C + D  
Sbjct: 6   DMSSGQLSEESPDRKYVSKRNRISFVCQACRKSKTKCDREKPRCSRCAKNNVKC-VYDIE 64

Query: 125 SRRAFPR 131
            +RA PR
Sbjct: 65  KQRA-PR 70

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
           Ashbya gossypii AER370W
          Length = 826

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 82  ASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           A   R+ +ACD CR KK +CD + P C  C    +EC
Sbjct: 13  AKRRRITRACDECRKKKVKCDNRHP-CIHCTVYSYEC 48

>SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {ON}
           some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 878

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 83  SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 127
           S  RV++ACD CRSKK +C+G++  CS C   G  C  +  + +R
Sbjct: 8   SRRRVSKACDSCRSKKIKCNGEQ-TCSNCLKYGCPCTYTHTIKKR 51

>YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON}
           PPR1Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain, positively
           regulates transcription of URA1, URA3, URA4, and URA10,
           which are involved in de novo pyrimidine biosynthesis,
           in response to pyrimidine starvation; activity may be
           modulated by interaction with Tup1p
          Length = 904

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 90  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 33  ACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATGKDVPRSY 76

>AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL130W
          Length = 801

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           RV +ACD CR KK +CD + P C  C    +EC
Sbjct: 13  RVTRACDECRKKKVKCDSRHP-CIHCTVYSYEC 44

>ACL093C Chr3 complement(178239..181271) [3033 bp, 1010 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIR023W
           (DAL81)
          Length = 1010

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 86/425 (20%), Positives = 159/425 (37%), Gaps = 112/425 (26%)

Query: 343 VDMLKSTNLWEVDDVIQFFQTVFKFD------IQAESSTTSQDHLIATEIDGLVSDFFSQ 396
           +D ++ +N   +  V    Q V + D      ++ E      + L+      LV  FF  
Sbjct: 297 IDQVQLSNTLALRKVAPGVQFVLRADFNHQLYLKNERDVDLVEKLVHPHGKILVDIFFKL 356

Query: 397 WYNFIPILDKDEFYNYYNKFKTDLMDP---NFFDDEKNLFNKRNKSISYKIFGCILLIIC 453
            + + PIL +  F   Y+K   +L  P   + +      ++   +++ ++       +I 
Sbjct: 357 IHPYFPILHERVFLEKYSKSYRELTAPILASIYSLALQWWDFHPQAVGFQRPD----VID 412

Query: 454 QMGLISKVKAENLPATNKYSQLMAYYDIVVRQLMMNPYFNLKSTSIQSLQFTSLQLFYFL 513
           Q+  I+               L  ++D++ R     P  ++  T +  LQ  S       
Sbjct: 413 QLNEIA---------------LRTFFDVLER-----PKLSIVQTGLLILQCRS------- 445

Query: 514 NIGEVSSVYDLRGKVVSMSQQLRL------HRCPSAVLGGNGSAVSKAQQGERRILFWGI 567
              E  + + L  +VV++++ L L       R PS             ++G RR L W +
Sbjct: 446 ---ECPNNWILCSEVVALAEDLGLGIDCKDWRLPSW------------ERGLRRRLAWAV 490

Query: 568 YYLDV--------FSALQLG---VPRLLKDHEIECALPVADNDDQKVNL-AGQMIALEGR 615
           +Y D         +S L LG   + ++L D +     PV  N  +K N   G        
Sbjct: 491 WYQDKWISMLEARYSHLILGRNWLVKMLSDQDFSANSPVISNSQEKSNANIGTGKTAPSN 550

Query: 616 VSMLSLS---------------VIRFAKVLGNILDSIFKRGMSASLTK-----QISLVHE 655
           +S+L LS               ++  + +LG ILD+ +  G  ++ TK     +++   +
Sbjct: 551 ISVLDLSPTDEDFNNGKLLFRQMVSLSIILGEILDTFYTLGAISTTTKIEQVLKLAKPLQ 610

Query: 656 NALDNWRRGLPQQLKFELDVNGTINMDEFNHLKQLDTSGNMYSKENKSLMVLYFMAKCMI 715
             L  W   LP +L          +M+ F   K            N SL + YF A+  +
Sbjct: 611 LKLREWYHSLPSKL----------SMNNFQPRK---------FNSNASLTLAYFAAEITL 651

Query: 716 HLPVV 720
           H  ++
Sbjct: 652 HRKII 656

>Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W
           (REAL)
          Length = 1040

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 16/85 (18%)

Query: 47  PHVAANNTTMSPTPLNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRP 106
           P + A +++ SP P NS             +T     N R++  C  CR  KT+CD ++P
Sbjct: 36  PGLEAEHSSTSPAPENS-------------ETHNRKRN-RISFVCQACRKSKTKCDREKP 81

Query: 107 QCSQCAAVGFECKISDKLSRRAFPR 131
           +C +C   G +C + D +S++  PR
Sbjct: 82  ECGRCIKHGLKC-VYD-VSKQPAPR 104

>TBLA0D00630 Chr4 complement(164651..167884) [3234 bp, 1077 aa] {ON}
           Anc_7.389 YBL066C
          Length = 1077

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 73  TSGADTPASASNYRVAQACDRCRSKKTRCDG--KRPQ-CSQCAAVGFECKI 120
           T   D   +A+N+R   +C  CR +K RC+   K+PQ C++CA +  +C I
Sbjct: 13  TPHDDALPAATNHRPVTSCTHCRQQKIRCNALQKQPQPCTRCAKLNLKCNI 63

>KLTH0G15180g Chr7 (1326581..1329871) [3291 bp, 1096 aa] {ON}
           similar to uniprot|Q05854 Saccharomyces cerevisiae
           YLR278C Protein of unknown function localizes to the
           nucleus potential Cdc28p substrate
          Length = 1096

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 95/215 (44%), Gaps = 38/215 (17%)

Query: 388 GLVSDFFSQWYNFIPILDKDEFYNYYNKFKTDLMDPNFFDDEKNLFNKRNKSISYKIFGC 447
             +  +F++     P+LD+ E YN+++    D ++ N      N F+          F C
Sbjct: 248 AFLDTYFTRLQFKYPLLDEQEIYNFHD----DYINNNVHSYSTNEFH----------FAC 293

Query: 448 ILLIICQMGLISKVKAENLPATNKYSQLMA--YYDIVVRQLMMNPYFNLKSTSIQSLQFT 505
                 +M LI  + A    +T KY  L+   Y+   +R +      NL  T IQ ++  
Sbjct: 294 -----GRMWLIFSISACLQMSTGKYRGLLPNRYFSTAIRHITKCGS-NL--TYIQQVEVL 345

Query: 506 SLQLFYFLNIGEVSS-VYDLRGKVVSMSQ-QLRLHRCPSAVLGGNGSAVSKAQQGERRIL 563
           SL L Y +     SS +Y++   V+++ + +L L+R     +  N          ++  L
Sbjct: 346 SLLLLYIIRTDRDSSGLYEIIKDVMAICKNKLFLNRWNQHDIFRN----------KKLRL 395

Query: 564 FWGIYYLDVFSALQLGVPRLLKDHEIECALPVADN 598
           FW +Y L+    + +G P  + + EI+  LP+ DN
Sbjct: 396 FWCVYSLERMICVAVGKPYTISEAEID--LPLFDN 428

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 18/31 (58%)

Query: 88  AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           +++C  C+ +K RCD K P C+ C     +C
Sbjct: 38  SRSCLLCQRRKRRCDHKMPSCTACLKAAVKC 68

>Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W
           (REAL)
          Length = 775

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 9/38 (23%)

Query: 89  QACDRCRSKKTRCDGKRPQCSQCA---------AVGFE 117
           ++C+ CR +K RCDGKRP+CS C          A+GFE
Sbjct: 10  RSCELCRKRKLRCDGKRPRCSTCVRKKSSECTYAIGFE 47

>Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C
           (REAL)
          Length = 786

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 53/244 (21%), Positives = 108/244 (44%), Gaps = 20/244 (8%)

Query: 497 TSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKAQ 556
           T I S+Q   +   +      + + Y   G  +  + +  LHR  S++ G         Q
Sbjct: 305 TDIYSIQAIFMMTIFLQCSANLKACYSFIGIALRAALKEGLHR-KSSITGPTA-----IQ 358

Query: 557 QGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAG------QMI 610
              ++ LFW +Y LD++    LG P  + + +I+   P+ D DD+ ++  G      +MI
Sbjct: 359 DETKKRLFWSVYKLDLYMNCILGFPSGIDESDIDQEFPL-DVDDENISTMGIKFQDWRMI 417

Query: 611 ALEGRVSMLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHENALDNWRRGLPQQLK 670
           +  G  +  +  ++  +++   ++ S+ ++ +      QI  +++  L+NW   LP  LK
Sbjct: 418 SSCGMNNEHTKLILIMSRIY-KLMYSLRRKPLEEDSRLQIVSLNDQ-LENWYAQLPDILK 475

Query: 671 FELDVNGTINMDEFNHLKQLDTSGNMYSKENKSLMVLYFMAKCMIHLPVVAKRPLVNDPE 730
            +  +     +    H+   D S   Y+K  K L + + ++K +++ P      +  DP 
Sbjct: 476 VDKIIYREPQLPL--HICASDNSSP-YTKPKKLLYLDFLLSKIVLYKPFYHYISI--DPL 530

Query: 731 QSPE 734
             PE
Sbjct: 531 DVPE 534

>KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {ON}
           conserved hypothetical protein
          Length = 370

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 122
           RV++ACD CR  KT+CDG+RP CS+C      C  S+
Sbjct: 17  RVSKACDACRKSKTKCDGERP-CSRCLKENKLCTYSN 52

>Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 aa]
           {ON} YKL015W (REAL)
          Length = 976

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 51/255 (20%), Positives = 108/255 (42%), Gaps = 16/255 (6%)

Query: 425 FFDDEKNLFNKRNKSISYKIFGCILLIICQMG--LISKVKAENLPATNKYSQLMAYYDIV 482
           ++D+ KN  +  N  +   ++ C +L+I  +G   +  +  E L   +   +L       
Sbjct: 375 YYDNTKNTLDNENDPVLQAVWFCKILLILAVGEMYLGSINIEMLKNYSNQPKLPGSKFFQ 434

Query: 483 VRQLMMNPYFN---LKSTSIQSLQFTSLQLFYFLNIGEVS-SVYDLRGKVVSMSQQLRLH 538
           +   + N  F+   L++ + +      L   +FL + + + + Y   G+ +     L LH
Sbjct: 435 MGSKIFNCLFSSERLENVTKKGGIEVLLLYAFFLQVADYTLASYFYFGQALRTCLILGLH 494

Query: 539 RCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADN 598
                 +      ++K +    R L+W +Y  +   + + G+P    D+ I  ALP AD 
Sbjct: 495 ------VDSQSDTLTKYEIEHHRRLWWTVYMFERMLSSKAGLPLSFTDYTISTALP-ADI 547

Query: 599 DDQKVNLAGQMIALEGRVSMLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHENAL 658
           DD+ +   G+      R + L  + +   K+   IL  +++R    ++   + +V +  L
Sbjct: 548 DDETI--EGKNNQYVFRKAELISNCVTIVKINAQILSKLYQRQPETNIIITLKVVIKQLL 605

Query: 659 DNWRRGLPQQLKFEL 673
           + WR  L   L+ + 
Sbjct: 606 E-WRNNLSDSLQVDF 619

>CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051w OAF1 peroxisome proliferating transcription
           factor or uniprot|P52960 Saccharomyces cerevisiae
           YOR363c PIP2
          Length = 1022

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 72  VTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 128
           V  G  +  S    R++  C  CR  KT+CD ++P CS+C   G  C + D  S++A
Sbjct: 4   VDEGDSSDISKKRNRLSFVCQGCRKAKTKCDKEKPACSRCLKHGIRC-VYDLTSQKA 59

>TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1.380
           YLR256W
          Length = 1422

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 115
           R+  +C  CR +K +CD KRP C+QC   G
Sbjct: 113 RIPLSCTICRKRKVKCDKKRPHCNQCTKTG 142

>TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {ON}
           Anc_7.17 YOR363C
          Length = 1274

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 9/76 (11%)

Query: 52  NNTTMSPTP---LNSNN----MGTGTSVTSGADTPASASNYR--VAQACDRCRSKKTRCD 102
           NN ++S TP   L  NN    + +  ++TS   +P   +  R  ++  C  CR  KT+C+
Sbjct: 26  NNASVSTTPPPILLENNKSSTIQSNPTITSPITSPGHITKKRNRISFVCQSCRKSKTKCN 85

Query: 103 GKRPQCSQCAAVGFEC 118
             +P CS+C  +G  C
Sbjct: 86  KDKPSCSRCKKLGIFC 101

>CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some
           similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089c HAL9 or uniprot|P38114 Saccharomyces
           cerevisiae YBR150c TBS1
          Length = 1049

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 32/70 (45%), Gaps = 5/70 (7%)

Query: 54  TTMSPTPLNSNNMGTGTSVTSGADTPASASNY--RVAQACDRCRSKKTRCDGKRP---QC 108
           +T +P+  NS   GT   +  G        +Y  R  +ACD CR +K RCD   P   +C
Sbjct: 2   STETPSRENSQLPGTTPMIDYGMAMELLQQHYKRRSTKACDHCRKRKIRCDEVNPVTNKC 61

Query: 109 SQCAAVGFEC 118
           S C     EC
Sbjct: 62  SNCVKFKVEC 71

>YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}
           OAF1Oleate-activated transcription factor, acts alone
           and as a heterodimer with Pip2p; activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1047

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 16/85 (18%)

Query: 47  PHVAANNTTMSPTPLNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRP 106
           P + A +++ SP P NS             +T     N R+   C  CR  KT+CD ++P
Sbjct: 36  PGLEAEHSSTSPAPENS-------------ETHNRKRN-RILFVCQACRKSKTKCDREKP 81

Query: 107 QCSQCAAVGFECKISDKLSRRAFPR 131
           +C +C   G +C + D +S++  PR
Sbjct: 82  ECGRCVKHGLKC-VYD-VSKQPAPR 104

>KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON}
           weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 934

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 23/43 (53%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 128
           R +  C  CR +K +CD KRP+CS+C   G  C      SR A
Sbjct: 14  RPSFVCQECRRRKIKCDKKRPRCSRCVDTGLPCTYLASGSRSA 56

>TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {ON}
           Anc_7.17 YOR363C
          Length = 989

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 71  SVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           S++ G +T     N R++  C  CR  KT+CD ++P+C +C   G +C
Sbjct: 26  SLSPGFETHVKRRN-RISFVCQACRRSKTKCDREKPRCGRCQQHGLQC 72

>Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {ON}
           YLR014C (REAL)
          Length = 899

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 90  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 33  ACKRCRLKKIKCDQEFPSCKRCANLEVPCVSLDPATGKDVPRSY 76

>TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON}
           Anc_7.56 YOR337W
          Length = 757

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query: 56  MSPTPLNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 115
           + P P+  N  G  TSV          ++ +   AC  CR ++ +CD + P C  C+ +G
Sbjct: 17  LEPVPI-ENKYGDQTSVKKEVTAELKKNDGKRRLACSNCRKRRKKCDVEYP-CGGCSRLG 74

Query: 116 FECKISDKLSRRA 128
            EC I+++  R+ 
Sbjct: 75  LECNINEEDLRKT 87

>NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON} Anc_2.547
          Length = 924

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 45/90 (50%), Gaps = 8/90 (8%)

Query: 46  VPHVAANNTTMSPTPLNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKR 105
           +PH A  N TM+ +  NSNN  T    +  + T  S    +V++ACD+C  ++ RC+  +
Sbjct: 12  IPHRAKLNDTMNMS--NSNNEPT----SPKSLTETSKKRSKVSRACDQCHKRRIRCNYNK 65

Query: 106 P--QCSQCAAVGFECKISDKLSRRAFPRGY 133
               C+ C  +G  C  +    +R   +GY
Sbjct: 66  VTNMCAGCKRIGEHCLFTRIPLKRGPVKGY 95

>TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa]
           {ON} 
          Length = 847

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%)

Query: 79  PASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           P +    R+   C  CR+KK +CD K+P C +C   G  C
Sbjct: 2   PMAMKKRRLNNGCWTCRTKKVKCDSKKPFCDKCKDSGLHC 41

>NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON}
           Anc_1.380
          Length = 1478

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 33/70 (47%), Gaps = 6/70 (8%)

Query: 46  VPHVAANNTTMSPTPLNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKR 105
           V  V+ +NT +S T  +S+    GTS      T       RV  +C  CR +K +CD  R
Sbjct: 4   VSPVSFSNTPLSATDSSSHANANGTS------TKVKRKRNRVPLSCTICRKRKVKCDKIR 57

Query: 106 PQCSQCAAVG 115
           P C QC   G
Sbjct: 58  PHCQQCTKTG 67

>YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}
           HAL9Putative transcription factor containing a zinc
           finger; overexpression increases salt tolerance through
           increased expression of the ENA1 (Na+/Li+ extrusion
           pump) gene while gene disruption decreases both salt
           tolerance and ENA1 expression
          Length = 1030

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 35/82 (42%), Gaps = 12/82 (14%)

Query: 49  VAANNTTMSPTPLNSN-------NMGTGTSVTSGADTPASASNY--RVAQACDRCRSKKT 99
           VA  NT  SPT   S        ++ T    T+  D   S  N   RV++ACD CR +K 
Sbjct: 85  VAYPNTIYSPTEHQSQFQTQQNRDISTMMEHTNSNDMSGSGKNLKKRVSKACDHCRKRKI 144

Query: 100 RCDGKRPQ---CSQCAAVGFEC 118
           RCD    Q   CS C      C
Sbjct: 145 RCDEVDQQTKKCSNCIKFQLPC 166

>NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON} 
          Length = 865

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           R +  C  C+++K RCD +RP CS+C  +G +C
Sbjct: 26  RRSHVCITCKNQKLRCDRERPSCSRCRRIGRDC 58

>AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YOL089C
           (HAL9)
          Length = 879

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 127
           RV++ACD CR+KK RC+G+ P C  C      C  +  + RR
Sbjct: 76  RVSKACDICRAKKIRCNGEEP-CVNCEKFNLGCTYTHVIKRR 116

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1207

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKIS 121
           +V++ACD CR +K +C G+RP C+ C     EC  S
Sbjct: 12  KVSKACDNCRRRKIKCSGERP-CAGCKTYNCECIFS 46

 Score = 36.6 bits (83), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 42/102 (41%), Gaps = 18/102 (17%)

Query: 551 AVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALP--------VADNDDQK 602
            + + Q  +RR L+W +Y ++    ++ G P ++ + +I C LP        +  ND   
Sbjct: 603 GLQEYQAEKRRQLWWKLYMIEKLHCMKRGFPSVINEDKINCLLPEKFRFLGYLDSNDYFN 662

Query: 603 VNLAGQMIALEGRVSMLSLS----------VIRFAKVLGNIL 634
                    L   +S LSLS           I F+K   NIL
Sbjct: 663 KINNPNFNNLSENLSKLSLSDLKDYGNLGLTIIFSKFSNNIL 704

>KLTH0E00440g Chr5 complement(42945..45011) [2067 bp, 688 aa] {ON}
           some similarities with uniprot|P25502 Saccharomyces
           cerevisiae YKL015W PUT3 Positive regulator of PUT
           (proline utilization) genes zinc-finger transcription
           factor of the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 688

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 80/187 (42%), Gaps = 27/187 (14%)

Query: 501 SLQFTSLQLFYF-LNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKAQQGE 559
           SL  + L + YF L++ + +S + + G  +     L LH+    ++             E
Sbjct: 292 SLILSLLYMAYFSLSLNKATSAFVMTGSAIRTMFTLGLHKRTKTIV-------------E 338

Query: 560 RRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEGRVSML 619
            R+ FW  +  D   A++ G P ++ +  I   L + + DD   NL    + +   VS  
Sbjct: 339 NRV-FWLCFIYDRLLAVRFGFPLMIDERNINIPL-LTEVDD---NLTAVSLDIYHFVSQ- 392

Query: 620 SLSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHENALDNWRRGLPQQLKFEL-DVNGT 678
               +R AK+   I+  I+ R   + L    +++ +  L NW   LP +LKF+  D+   
Sbjct: 393 ----VRLAKITTQIITKIYTRNPYSFLHNCHAVLKQ--LKNWFESLPAELKFDYNDIKTA 446

Query: 679 INMDEFN 685
                FN
Sbjct: 447 TTRSTFN 453

>KLTH0B10076g Chr2 (841024..843090) [2067 bp, 688 aa] {ON} some
           similarities with uniprot|P25502 Saccharomyces
           cerevisiae YKL015W PUT3 Positive regulator of PUT
           (proline utilization) genes zinc-finger transcription
           factor of the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 688

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 80/187 (42%), Gaps = 27/187 (14%)

Query: 501 SLQFTSLQLFYF-LNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKAQQGE 559
           SL  + L + YF L++ + +S + + G  +     L LH+    ++             E
Sbjct: 292 SLILSLLYMAYFSLSLNKATSAFVMTGSAIRTMFTLGLHKRTKTIV-------------E 338

Query: 560 RRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEGRVSML 619
            R+ FW  +  D   A++ G P ++ +  I   L + + DD   NL    + +   VS  
Sbjct: 339 NRV-FWLCFIYDRLLAVRFGFPLMIDERNINIPL-LTEVDD---NLTAVSLDIYHFVSQ- 392

Query: 620 SLSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHENALDNWRRGLPQQLKFEL-DVNGT 678
               +R AK+   I+  I+ R   + L    +++ +  L NW   LP +LKF+  D+   
Sbjct: 393 ----VRLAKITTQIITKIYTRNPYSFLHNCHAVLKQ--LKNWFESLPAELKFDYNDIKTA 446

Query: 679 INMDEFN 685
                FN
Sbjct: 447 TTRSTFN 453

>KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {ON}
           weakly similar to uniprot|P04386 Saccharomyces
           cerevisiae YPL248C GAL4 DNA-binding transcription factor
           required for the activation of the GAL genes in response
           to galactose repressed by Gal80p and activated by Gal3p
          Length = 749

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%)

Query: 89  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           QACD CR KK +C  + P CS C    ++C  S K  R    R +
Sbjct: 9   QACDWCRRKKLKCSREHPICSNCFKHNWDCHYSPKKVRSPLTRAH 53

>KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17
           YOR363C
          Length = 1045

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           R++  C  CR  KT+CD ++P+CS+CA     C
Sbjct: 24  RISLVCQACRKSKTKCDREKPRCSRCAKNNLRC 56

>SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON}
           similar to uniprot|P35995 Saccharomyces cerevisiae
           YKL222C Hypothetical ORF and similar to uniprot|Q12340
           Saccharomyces cerevisiae YOR172W
          Length = 718

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 76  ADTPASASNYR--VAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKISDKLSRRAFP 130
            D+ AS    R  V ++C  CR +K +CD K+P+CS CAA    EC   +K +    P
Sbjct: 2   VDSQASVIRKRRKVIKSCLFCRKRKLKCDHKKPKCSTCAARNLPECVYVEKFTHEIDP 59

>KLTH0H11704g Chr8 complement(1003625..1007182) [3558 bp, 1185 aa]
           {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
           YLR256W HAP1
          Length = 1185

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 78/366 (21%), Positives = 139/366 (37%), Gaps = 51/366 (13%)

Query: 393 FFSQWYNFIPILDKDEFYNYYNKF----KTDLMDPNFFDDEKNLFNKRNKSISYKIFGCI 448
           F S  +   P+L +D F +   +F    K D+  P     ++  F K          GC+
Sbjct: 387 FRSPLHALFPVLTEDWFCDTVKEFIKNHKDDMSKPEVVVTQRCDFGK---------IGCM 437

Query: 449 LLIICQMGLISKVKAE-NLPATNK--YSQLMAYYDIVVRQLMMNPYFNLKSTSIQSLQFT 505
           L+I+    L+   KAE NLP   +  Y+  +    I   +L ++ +  L+   +  L   
Sbjct: 438 LIIMRLSFLMYADKAEKNLPEEQRDVYAHSIGPEFISTAELCLSLFRLLRKAILPVLHCA 497

Query: 506 SLQLFYFLNIGEVSSVYD------LRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKAQQGE 559
            L   Y     +   + D        G +  M+  + LH    A   G   A SK     
Sbjct: 498 VLLRIYRRYAPDEGDIADSGGSEPFSGILTKMATSIGLH--VDAEFSGQF-AFSKMYSQA 554

Query: 560 RRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVA-DNDDQKVNLAGQMIALEGRVSM 618
            R  ++ IY+LD++  +  G    + +H     LPV   N+D  ++    +  LE    +
Sbjct: 555 WRKCWYVIYFLDLYEGMNSGNATTINEHSFSTRLPVVGTNEDGTLSSYITVPELE----I 610

Query: 619 LSLSVIR----FAKVLGNILDSIFKRGMSASLTKQISLVHENAL---DNWRRGLPQQLKF 671
            S+  +R    F+     +L+ +  R    S  K  S   E  L     + +GL + LK 
Sbjct: 611 ASIECLRKNYDFSIACHKLLNLVMNRNFKVSCEKVQSAAGELELLLKKTYEKGLRKILK- 669

Query: 672 ELDVNGTINMDEFNHLKQLDTSGNMYSKENKSLMVLYFMAKCMIHLPVVAKRPLVNDPEQ 731
                        +  K +D S    +     +    F+     HL +   + ++ DP++
Sbjct: 670 -------------HPAKTIDESITKCNDFKVFIETYSFLFMVYFHLFLHVDKLVIGDPDR 716

Query: 732 SPESST 737
            P S++
Sbjct: 717 CPPSTS 722

>Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W
           (REAL)
          Length = 1045

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 29/46 (63%), Gaps = 2/46 (4%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 131
           R++  C  CR  KT+CD ++P+C +C   G +C + D +S++  PR
Sbjct: 61  RISFVCQACRKSKTKCDREKPECGRCTKHGLKC-VYD-VSKQPAPR 104

>KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {ON}
           weakly similar to uniprot|P39529 Saccharomyces
           cerevisiae YJL206C Hypothetical ORF
          Length = 674

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 65/150 (43%), Gaps = 19/150 (12%)

Query: 476 MAYYDIVVRQLMMNPYFN--LKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQ 533
           M YY   ++      YF+  ++  ++ S++   L  FY   +  ++SVY   G  +S + 
Sbjct: 260 MCYYISALK------YFHEPIEEPNLDSVRTLILIAFYSQGLNRMNSVYAYTGLALSTAV 313

Query: 534 QLRLHRCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECAL 593
              +HR        N     +A+Q  R+ ++W  + +D   A +LG+P      +I+  L
Sbjct: 314 AQGIHR------QANNHQFPRAEQEARKKIWWTAFLMDTLWASRLGLPPHFNSCDIDIEL 367

Query: 594 P-----VADNDDQKVNLAGQMIALEGRVSM 618
           P       D  D K  +A   +AL  R  M
Sbjct: 368 PDESMSTEDGFDPKYLIANTHLALLVRSVM 397

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 17/27 (62%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCA 112
           R  +AC RC ++K +C G++P C  C 
Sbjct: 12  RSKKACQRCSAQKVKCLGEKPPCRACV 38

>SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]
           {ON} conserved hypothetical protein
          Length = 971

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 38/65 (58%), Gaps = 4/65 (6%)

Query: 531 MSQQLRLHRCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIE 590
           ++Q++ L R P++  G     + ++    RRILFW I+ LD  ++L   +P L+K  E +
Sbjct: 388 LAQRVMLTRDPTSYHGITDPTLVQS----RRILFWQIFQLDTLTSLHNNLPPLIKLDEFD 443

Query: 591 CALPV 595
            ALPV
Sbjct: 444 TALPV 448

>CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa]
           {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
           YLR256w HAP1 transcription factor
          Length = 1355

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 3/50 (6%)

Query: 66  MGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 115
           M T T++   A  P    N R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 1   MSTTTTIPGAA--PKKKRN-RIPLSCTICRKRKVKCDKTRPHCNQCTKTG 47

>CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar to
           uniprot|P12383 Saccharomyces cerevisiae YGL013c PDR1
           transcription factor
          Length = 1107

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 127
           +V +ACD CR +K +C+G +P C  C   G EC  +D  S +
Sbjct: 26  KVGKACDSCRRRKIKCNGLKP-CPSCTIYGCECTYTDAKSTK 66

>SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051W OAF1 Oleate-activated transcription factor acts
           alone and as a heterodimer with Pip2p activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 983

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           R++  C  CR  KT+CD ++P C++C   G EC
Sbjct: 23  RISFVCKACRKSKTKCDREKPSCTRCIKNGIEC 55

>SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {ON}
           conserved hypothetical protein
          Length = 362

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 122
           RV++ACD CR  KT+CDG+RP C +C +    C  S+
Sbjct: 6   RVSKACDTCRKSKTKCDGERP-CQRCLSENKICTYSN 41

>Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W
           (REAL)
          Length = 759

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 44/83 (53%), Gaps = 5/83 (6%)

Query: 54  TTMSPTPLNSNNMGTGTSVTSGA--DTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQC 111
           T+ SP   NS +  +   + SG   +TP +ASN R   AC  CR+++ +CD   P C  C
Sbjct: 32  TSTSPKEENSRS-SSAVDIRSGTVINTPDNASNTRKRLACTNCRNRRKKCDLGFP-CGNC 89

Query: 112 AAVGFECKISDK-LSRRAFPRGY 133
           + +   C ++D+ L ++ +   Y
Sbjct: 90  SRLELVCNVNDEDLRKKRYTNKY 112

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 53/292 (18%), Positives = 118/292 (40%), Gaps = 43/292 (14%)

Query: 390 VSDFFSQWY--NFIPILDKDEFYNYYNKFKTDLMDPNFFDDEKNLFNKRNKSISYKIFGC 447
           +S+F+   Y   FI +  +   Y ++N  K +  D N+   E                  
Sbjct: 329 LSNFYKWLYPGYFIFVHRESFLYGFFNHSKNNYEDSNYCSVE------------------ 370

Query: 448 ILLIICQMGLISKVKAENLPATNKYSQLMAYYDIVVRQLMMNPYFNLKSTSIQSLQFTSL 507
           ++  +C +G      +   P  ++YS++  YY+   + L+   +    +  I ++Q    
Sbjct: 371 LIYAVCAVG------SRLTPDLHEYSEI--YYERSKKTLLQLVFDEQSTARITTVQALFC 422

Query: 508 QLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSA-VLGGNGSAVSKAQQGERRILFWG 566
             FY L  G     +   G  + +   +     P    +  +   +++++   R  ++WG
Sbjct: 423 LAFYELGKGNNQLGWYFSGLAIRVGYDMGFQLDPKVWYIDDSNLQLTQSELEIRSRIYWG 482

Query: 567 IYYLDVFSALQLGVPRLLKDHEIECALPVAD-----NDDQKVNLAGQMIALEGRVSMLSL 621
            Y  D F  L LG    L        +P +D     N  ++    G+ +    ++S+   
Sbjct: 483 CYIADHFICLMLGRTSTLSVS--NSTMPDSDELPEVNGTEEFRFIGRHVL---QISLPLK 537

Query: 622 SVIRFAKVLGNILDSIFKRGMSASLTKQISLVH--ENALDNWRRGLPQQLKF 671
           ++I  ++++      IF    S  +T+++  ++   + + NWR+ LP+ L++
Sbjct: 538 NLIILSRLVQIFTSKIFIE--SEDITQKVKYLNTFNSQVYNWRQSLPEFLQW 587

>Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL038W
           (REAL)
          Length = 1169

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 8/73 (10%)

Query: 69  GTSVTSGADTPASASNY------RVAQACDRCRSKKTRCDGK--RPQCSQCAAVGFECKI 120
           GTS +     PA+AS +      + ++ACD+CR KK +CD K  R  C+ C   G  C  
Sbjct: 19  GTSNSPDDMNPAAASGHAMKKRTKASRACDQCRKKKIKCDYKDERGVCTNCQRNGDRCSF 78

Query: 121 SDKLSRRAFPRGY 133
                +R   +GY
Sbjct: 79  ERVPLKRGPSKGY 91

>KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]
           {ON} uniprot|P08657 Kluyveromyces lactis LAC9 Lactose
           regulatory protein LAC9
          Length = 865

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 22/45 (48%)

Query: 89  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           QACD CR KK +C    P C+ C     +C  S ++ R    R +
Sbjct: 93  QACDACRKKKWKCSKTVPTCTNCLKYNLDCVYSPQVVRTPLTRAH 137

>NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON} 
          Length = 508

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           R    C  CR++K +CD +RP+C +C  +G EC
Sbjct: 15  RSYSGCWTCRARKVKCDTQRPKCCRCKQLGIEC 47

>Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON}
           complement(89752..93018) [3267 nt, 1089 aa]
          Length = 1088

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 127
           R++  C +CR  KTRCD ++P C++C      C    +L ++
Sbjct: 34  RISFVCQQCRKAKTRCDKEQPNCTRCIKNNLNCIYDIELQKK 75

>Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig
           274] FULL
          Length = 628

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 78  TPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           TP S  N R++  CD CR +K +C+ ++P CS+C     +C
Sbjct: 3   TPKSKKN-RISHVCDACRIRKLKCNKQKPSCSRCVKHDLQC 42

>NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}
           Anc_7.17 YAL051W
          Length = 944

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (61%)

Query: 85  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           YR++  C  CR  K +CD ++P CS+C+    EC
Sbjct: 34  YRLSFVCQGCRRSKVKCDQEKPVCSRCSKHDLEC 67

>ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some
           similarities with uniprot|P39529 Saccharomyces
           cerevisiae YJL206C
          Length = 571

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 123
           RV+ ACD CR KK +CDG++P C  C     EC  SD+
Sbjct: 23  RVSHACDNCRLKKKKCDGQQP-CKLCKNSENECIYSDR 59

 Score = 36.2 bits (82), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 55/243 (22%), Positives = 100/243 (41%), Gaps = 26/243 (10%)

Query: 497 TSIQSLQFTSLQLFYFLNI-GEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKA 555
           T + S+Q T   L  FL   G +   Y   G  +  +    LHR  S+++G      +  
Sbjct: 184 TDVYSIQ-TMFMLTMFLQCSGNLKRCYSYMGIALRAAIAEGLHR-KSSLMGP-----TPI 236

Query: 556 QQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEGR 615
           +   ++ LFW +Y +D++    +G+P+ +    +   LP  D DD+ +   G +    G+
Sbjct: 237 EDESKKRLFWTVYKVDIYMNCIMGLPQSISQKTVNMELP-KDLDDENITNQGCIDQPWGK 295

Query: 616 VSMLSLS--VIRFAKVLGNILDSIFKRGMSASLTKQISLVHENALDNWRRGLPQQLKFEL 673
           +S   ++    +   +L  I D+++       + K     H N L      L   L   L
Sbjct: 296 LSSTGMNNEHTKLMLILSRIHDTLY------PVLKWDEGTHNNIL-----SLQNDLDQWL 344

Query: 674 DVNGTINMDEFNHLKQLDTSGNMYSKENKSLMVLYFMAKCMIHLPVVAKRPLVNDPEQSP 733
                     +  L   DT  + Y K  K L + Y +A+ ++  P V    +  +P+Q+P
Sbjct: 345 LQLPLQLKPGYEFLD--DTERDYYMKPCKLLYMDYLLARILMCKPFV--HYIAVEPDQAP 400

Query: 734 ESS 736
             S
Sbjct: 401 RYS 403

>Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380W
           (REAL)
          Length = 542

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 131
           RV +AC  CR +K +C+GK P C  C A G+ C  +D       PR
Sbjct: 15  RVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPR 59

>SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa]
           {ON} weakly similar to uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1061

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 13/61 (21%)

Query: 71  SVTSGADTPA----------SASNYRVAQACDRCRSKKTRCDGKRP---QCSQCAAVGFE 117
           ++TS  ++PA           A   RV++ACD CR +K +CD  +P   +CS C     E
Sbjct: 109 TITSHTESPAFTSISPLDVSGAPKKRVSKACDHCRKRKIKCDDVKPRTGKCSNCTKFNAE 168

Query: 118 C 118
           C
Sbjct: 169 C 169

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 67/176 (38%), Gaps = 31/176 (17%)

Query: 522 YDLRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVP 581
           Y +    V  +Q + LH   +         +S  +  +RRIL+W  Y  D F +L+L  P
Sbjct: 518 YSIFATAVRFAQDMSLHNLDTY------KRLSYKECLKRRILWWHCYTTDKFLSLKLCKP 571

Query: 582 RLLKDHEIEC-------------ALPVADND----DQKVNLAGQMIALEGRVSML----S 620
            L+ + ++                LP    D    DQ   +   +  LE   S L    S
Sbjct: 572 SLINERDMTVLTDESYVVLIKGQLLPQVGTDREAIDQITTIEEALRKLEEHCSFLPVFIS 631

Query: 621 LSVIRFAKVLGNILDSIFK----RGMSASLTKQISLVHENALDNWRRGLPQQLKFE 672
               + A++   I  S F     +G +        L  +N+L +W + LP  ++ E
Sbjct: 632 YYTTKLARISSKIYYSFFTPTSLKGQTFDTMIDRVLEIKNSLSDWEKYLPGSIRLE 687

>ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON} similar
           to uniprot|P12351 Saccharomyces cerevisiae YLR256W HAP1
          Length = 1244

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 5/48 (10%)

Query: 73  TSGADTPASASNY-----RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 115
           TS A  PA+A+       R+  +C  CR +K +CD  RP C QC+  G
Sbjct: 12  TSAATDPAAANKMKRKRNRIPLSCTICRKRKVKCDKTRPNCEQCSKTG 59

>KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON}
           uniprot|Q6DR96 Kluyveromyces lactis HAP1
          Length = 1253

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 70  TSVTS-GADTPASASNY-RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 115
           +S+TS G  TP       RV  +C  CR +K +CD  RPQC QC   G
Sbjct: 2   SSITSPGTGTPQQKRKRNRVPLSCTICRKRKVKCDKGRPQCQQCVKTG 49

>Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W
           (REAL)
          Length = 545

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 72  VTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 123
           + S    P      RV +AC  CR +K +C+GK P C  C A G+ C  +++
Sbjct: 1   MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE 51

>ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar to
           uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
           Oleate-activated transcription factor acts alone and as
           a heterodimer with Pip2p activates genes involved in
           beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1035

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 2/46 (4%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 131
           R++  C  CR  KT+CD ++P+C +C   G  C + D + ++A PR
Sbjct: 55  RISFVCKACRRSKTKCDREKPKCGRCVQHGIAC-VYD-VEKQAAPR 98

>KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {ON}
           some similarities with uniprot|P35995 Saccharomyces
           cerevisiae YKL222c
          Length = 658

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 19/79 (24%)

Query: 63  SNNMGTGTSVTSG------------ADTPASASN------YRVAQACDRCRSKKTRCDGK 104
           + ++GTG S  S             +D  AS SN       +V ++C  CR +K +CD K
Sbjct: 44  AQDIGTGNSEESAGIGSHNNDEEHYSDKNASTSNGKVRKRRKVIKSCTFCRKRKLKCDRK 103

Query: 105 RPQCSQCAAVGF-ECKISD 122
           RP C+ C   G  EC  +D
Sbjct: 104 RPMCTGCKMRGLSECVYTD 122

>Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL038W
           (REAL)
          Length = 1171

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 37/73 (50%), Gaps = 8/73 (10%)

Query: 69  GTSVTSGADTPASASNY------RVAQACDRCRSKKTRCDGK--RPQCSQCAAVGFECKI 120
           GTS +     PA+A+++      + ++ACD+CR KK +CD K  R  CS C   G  C  
Sbjct: 19  GTSNSPEDMDPAAATSHAMKKRTKASRACDQCRKKKIKCDYKDERGVCSNCQRNGDRCSF 78

Query: 121 SDKLSRRAFPRGY 133
                +R   +GY
Sbjct: 79  ERVPLKRGPSKGY 91

>SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON}
           weakly similar to uniprot|P39720 Saccharomyces
           cerevisiae YAL051W OAF1 Oleate-activated transcription
           factor acts alone and as a heterodimer with Pip2p
           activates genes involved in beta-oxidation of fatty
           acids and peroxisome organization and biogenesis
          Length = 922

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 131
           R++  C  CR +K +CD +RP C QCA  G  C + D + R+  PR
Sbjct: 20  RLSFVCLECRRRKIKCDKQRPCCIQCAEQGLTC-VYD-IERQPAPR 63

>SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON}
           weakly similar to uniprot|P33200 Saccharomyces
           cerevisiae YBL005W PDR3 Transcriptional activator of the
           pleiotropic drug resistance network regulates expression
           of ATP-binding cassette (ABC) transporters through
           binding to cis-acting sites known as PDREs (PDR
           responsive elements)
          Length = 940

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 80  ASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKIS 121
            + S+ +V++ACD CR +K +C GK+P CS C A    C+ S
Sbjct: 17  VTKSSSKVSRACDNCRRRKIKCTGKQP-CSNCQAYQCHCEYS 57

>SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON}
           similar to uniprot|P05085 Saccharomyces cerevisiae
           YML099C ARG81 Zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type involved in
           the regulation of arginine-responsive genes acts with
           Arg80p and Arg82p
          Length = 848

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 90  ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
            C  CRS+K +CD  RP C +C   GFEC
Sbjct: 19  GCWTCRSRKVKCDLGRPSCKRCERSGFEC 47

>Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {ON}
           YOL089C (REAL)
          Length = 1032

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 29/59 (49%), Gaps = 7/59 (11%)

Query: 67  GTGTSV--TSGADTPASASN--YRVAQACDRCRSKKTRCDGKRPQ---CSQCAAVGFEC 118
           G  T V  T+  D  AS  N   RV++ACD CR +K RCD   PQ   CS C      C
Sbjct: 108 GVSTMVESTNSNDLGASGKNSKKRVSKACDHCRKRKIRCDEVDPQTDKCSNCVKFQSVC 166

>Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to
           Ashbya gossypii ADR403C
          Length = 978

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           R++  C  CR  KT+CD ++P+CS+CA    +C
Sbjct: 27  RISFVCQACRKSKTKCDREKPRCSRCAKNNIKC 59

>YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}
           PUT3Transcriptional activator of proline utilization
           genes, constitutively binds PUT1 and PUT2 promoter
           sequences as a dimer and undergoes a conformational
           change to form the active state; differentially
           phosphorylated in the presence of different nitrogen
           sources; has a Zn(2)-Cys(6) binuclear cluster domain
          Length = 979

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 70/164 (42%), Gaps = 11/164 (6%)

Query: 511 YFLNIGEVS-SVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKAQQGERRILFWGIYY 569
           +FL + + + + Y   G+ +     L LH      +      +S+ +    R L+W +Y 
Sbjct: 469 FFLQVADYTLASYFYFGQALRTCLILGLH------VDSQSDTLSRYEIEHHRRLWWTVYM 522

Query: 570 LDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEGRVSMLSLSVIRFAKV 629
            +   + + G+P    D+ I  ALP AD DD+ +           R + L  + +   K+
Sbjct: 523 FERMLSSKAGLPLSFTDYTISTALP-ADIDDETIEEKNSHYVF--RKAELISNCVTIVKI 579

Query: 630 LGNILDSIFKRGMSASLTKQISLVHENALDNWRRGLPQQLKFEL 673
              IL  +++R    ++   + +V +  L+ WR  L   L+ + 
Sbjct: 580 NAQILSKLYQRQPETNIIITLKVVIKQLLE-WRNNLSDSLQVDF 622

>KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.654
           YKL015W
          Length = 818

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/239 (21%), Positives = 97/239 (40%), Gaps = 21/239 (8%)

Query: 444 IFGCILLIICQMGLI------SKVKAENLPATNKYSQLMAYYDIVVRQLMMNPYFNLKST 497
           I  C +L+I  +G +      SK K +NLP    + Q    +D++   +  N  +  K  
Sbjct: 302 ICFCKILLIFAIGEVYYGLNESKQKDQNLPGLKYFKQASQIFDLLFSTI--NLEYVTKEG 359

Query: 498 SIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKAQQ 557
            I++L    L  FY        S Y   G+ +     L LH      +     ++ + + 
Sbjct: 360 GIETLL---LYAFYLQVADSTVSSYFYFGQALRTCLILGLH------VDSQSDSIDRFKL 410

Query: 558 GERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEGRVS 617
              R L+W +Y  +   + + G+P    D+ I   LP   ND    N   +        +
Sbjct: 411 EHHRRLWWTVYMFERMLSSKAGLPLSFTDNTISTELP---NDFDMSNPPNECEHYIFPKA 467

Query: 618 MLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHENALDNWRRGLPQQLKFELDVN 676
               S ++  +V  NIL  +++R    ++   +  + +N L +WR  L   L+ + ++N
Sbjct: 468 EYISSCVKIVRVNANILSQLYQRQPKHNILPVLQKIMKN-LSSWRNELSDNLQVDFNLN 525

>ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; No
           homolog in Saccharomyces cerevisiae
          Length = 817

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 48/87 (55%), Gaps = 8/87 (9%)

Query: 518 VSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQ 577
           +SSV     ++  ++Q+L+L   P  V G    A  +     RRI+FW I+ LD  ++LQ
Sbjct: 270 ISSV----AQLARLAQRLQLTADPEYVPGSREMADVQF----RRIIFWQIFQLDTLTSLQ 321

Query: 578 LGVPRLLKDHEIECALPVADNDDQKVN 604
             +P LL+ +E E +LP   ++  K+N
Sbjct: 322 NRLPPLLRYNECETSLPSEFDEGGKLN 348

>TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON} 
          Length = 918

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 1/65 (1%)

Query: 61  LNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECK 119
           + S+ +   +  +S  + P         ++C  CR +K +CD  +P CS C A  F EC 
Sbjct: 5   IESSKISKNSPESSAVNKPPRKKRRSTIKSCSFCRRRKLKCDKSKPLCSTCRARNFTECI 64

Query: 120 ISDKL 124
            SD +
Sbjct: 65  YSDAI 69

>KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}
           Anc_1.128 YJL206C
          Length = 663

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 86/187 (45%), Gaps = 22/187 (11%)

Query: 499 IQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKAQQG 558
           ++++Q   +   Y     ++S+ ++L G  +  S +   H   S V    G  V + +  
Sbjct: 266 LRTIQTVFMMSLYLQFCADLSAAHNLIGIALRSSIREGYHLKSSLV----GPTVIEDEVK 321

Query: 559 ERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIAL------ 612
           +R  LFW IY ++ +    LG P  L D  I+  +P+ D DD ++ + G    L      
Sbjct: 322 KR--LFWSIYKMNAYLTSLLGFPTTLSDTLIDQEIPL-DIDDDRITVLGIQEPLGTTAGD 378

Query: 613 EGRVSMLSLS--VIRFAKVLGNILD--SIFKRGMSAS----LTKQISLVHENALDNWRRG 664
             R+S   ++    R   VL ++ +  S F  G + S    + + IS + E  +++WRR 
Sbjct: 379 TTRISSCGMNNEHTRLMTVLSHVYEYTSTFTLGATLSQVDTIREHISSL-EREIESWRRD 437

Query: 665 LPQQLKF 671
           LP+ L+ 
Sbjct: 438 LPEPLRL 444

 Score = 39.3 bits (90), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           RV  AC  CR KK +CDG+ P CS C    ++C
Sbjct: 30  RVRTACSMCRRKKRKCDGRVP-CSFCTKNHYQC 61

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6.60
           YLR266C
          Length = 795

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           ++ +AC  CR +K +CD  +P+C QC++    C
Sbjct: 9   KIIKACVFCRKRKLKCDLTKPKCKQCSSRNLNC 41

>Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380W
           (REAL)
          Length = 546

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK--LSRRAFP 130
           RV +AC  CR +K +C+GK P C  C + G+ C   DK   S  +FP
Sbjct: 15  RVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSSSSSFP 60

>Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 aa]
           {ON} YKL015W (REAL)
          Length = 985

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/253 (19%), Positives = 102/253 (40%), Gaps = 14/253 (5%)

Query: 425 FFDDEKNLFNKRNKSISYKIFGCILLIICQMG--LISKVKAENLPATNKYSQLMAYYDIV 482
           ++D+ K +F+  N  I   ++ C +L+I  +G   +  +  E L   +   +L       
Sbjct: 382 YYDNTKKVFDNENDPILQAVWFCKILLILAVGEMYLGSINNEMLKNYSNQPKLPGSKFFQ 441

Query: 483 VRQLMMNPYFNLKSTSIQSLQFTSLQLF-YFLNIGEVS-SVYDLRGKVVSMSQQLRLHRC 540
           +   + N  F+      +      L L+ +FL + + + + Y   G+ +     L LH  
Sbjct: 442 MGSKIFNCLFSRLENVTKKGGIEVLLLYAFFLQVADYTLASYFYFGQALRTCLILGLH-- 499

Query: 541 PSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDD 600
               +      +S+ +    R L+W +Y  +   + + G+P    D+ I   LP AD DD
Sbjct: 500 ----VDSQSDTLSRFEIEHHRRLWWTVYMFERMLSSKAGLPLSFTDYTISTELP-ADIDD 554

Query: 601 QKVNLAGQMIALEGRVSMLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHENALDN 660
           +             R + L  + +   K+   IL  +++R    ++   + +V +  L  
Sbjct: 555 KSSRSKNNHYVF--RKAELISNCVTIVKINAQILSKLYQRQPETNIMITLKVVIKQLLQ- 611

Query: 661 WRRGLPQQLKFEL 673
           WR  L   L+ + 
Sbjct: 612 WRNNLSDFLQVDF 624

>Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W
           (REAL)
          Length = 468

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 90  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 127
           ACD CR ++ +CDGK+P C +C    FEC     L +R
Sbjct: 7   ACDYCRVRRVKCDGKKP-CRRCLQHNFECTHQQPLKKR 43

>Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {ON}
           YKL038W (RGT1) - 1:1 [contig 55] FULL
          Length = 970

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 86  RVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           + ++ACD+CR KKTRCD   + P C+ C  +   C       +R   +GY
Sbjct: 34  KTSRACDQCRGKKTRCDFSDENPVCTSCQRMSKTCTFERVPMKRGPTKGY 83

>NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {ON}
           
          Length = 1113

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 122
           +V++AC  CR +K +C G  P CS CAA   EC   D
Sbjct: 32  KVSKACANCRRRKIKCTGTYP-CSNCAAYQCECIFDD 67

>TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2.654
           YKL015W
          Length = 1037

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/174 (20%), Positives = 76/174 (43%), Gaps = 11/174 (6%)

Query: 502 LQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKAQQGERR 561
           ++ T L  FY       ++ Y   G+ +     L +H      +      +S+ +   RR
Sbjct: 587 IEVTLLYAFYLQVADCTATSYFFLGEALRACLLLGMH------VDAQSDTLSRCEVEHRR 640

Query: 562 ILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVN-LAGQMIALEGRVSMLS 620
            L+W +Y  +   + + G+P    D+ I   LP   N  Q  + LA     +E      S
Sbjct: 641 RLWWTVYMFERMLSSKAGLPLSFTDNTISTELPSNINCAQDNDILAKYYYYVEAAYIGES 700

Query: 621 LSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHENALDNWRRGLPQQLKFELD 674
           + +++   + G IL  +++R  S+++   +  + +  L NW+  +P+ L+ + +
Sbjct: 701 VKIVQ---INGQILSKLYQRQPSSNILPILKDILKQLL-NWKSNVPESLQVDFN 750

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 122
           ++ +AC RCR +  +C G  P C +C      CK S+
Sbjct: 54  KITRACIRCRERHIKCPGNDP-CQKCLEANHICKFSE 89

>Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}
           YJL206C (REAL)
          Length = 772

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/229 (20%), Positives = 101/229 (44%), Gaps = 20/229 (8%)

Query: 497 TSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKAQ 556
           T I S+Q   +   +      + + Y   G  +  + +  LHR  S+++G      +  +
Sbjct: 296 TDIYSIQAIFMMTIFLQCSANLKACYSFIGIALRAALKDGLHR-KSSIVGP-----TPIE 349

Query: 557 QGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEGRV 616
              ++ LFW +Y LD++    LG P  + + +I+   P+ D DD+ ++  G        +
Sbjct: 350 DETKKRLFWSVYKLDLYMNCILGFPSGIDESDIDQEFPL-DVDDENISTTGIKFQDWRTI 408

Query: 617 SMLSLS-----VIRFAKVLGNILDSIFKRGMSASLTKQISLVHENALDNWRRGLPQQLKF 671
           S   ++     +I     +  ++ S+ ++ +      QI  +++  LD+W   LP  LK 
Sbjct: 409 SSCGMNNKHTKLILIMSRIYKLMYSLRRKPLEEDSRLQIVSLNDQ-LDDWYTQLPDTLKV 467

Query: 672 ELDVNGTINMDEFNHLKQLDTS--GNMYSKENKSLMVLYFMAKCMIHLP 718
           +     TI   +      + T+   + YSK  K L + + ++K +++ P
Sbjct: 468 D-----TIRYHQPQPPLSICTNDRNSSYSKPKKLLYLDFLLSKIVLYKP 511

 Score = 39.3 bits (90), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 119
           R  +AC  CR +K RC G+ P C  C    FECK
Sbjct: 53  RAHRACVACRKRKVRCSGQTP-CRLCQNNSFECK 85

>ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL051W
           (OAF1) and YOR363C (PIP2); Tandem gene triplication in
           this genome
          Length = 875

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%)

Query: 73  TSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           TSG+    +    +++  C  CR  KT+CD  +P CS+CA +G  C
Sbjct: 6   TSGSVLKPNTHKRKLSYVCIPCRKCKTKCDKLKPTCSRCAELGLYC 51

>KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa]
           {ON} weakly similar to uniprot|P12383 Saccharomyces
           cerevisiae YGL013C PDR1 Zinc cluster protein that is a
           master regulator involved in recruiting other zinc
           cluster proteins to pleiotropic drug response elements
           (PDREs) to fine tune the regulation of multidrug
           resistance genes
          Length = 1082

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 30/69 (43%), Gaps = 13/69 (18%)

Query: 53  NTTMSPTPLNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCA 112
           N   +  P +SN  GTG                +V++ACD CR KK +C G  P C  C 
Sbjct: 29  NGDRTAIPRDSNGNGTG------------KPRRKVSRACDSCRKKKIKCSGTLP-CKSCE 75

Query: 113 AVGFECKIS 121
             G EC  S
Sbjct: 76  TYGCECVYS 84

>YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON}
           YRR1Zn2-Cys6 zinc-finger transcription factor that
           activates genes involved in multidrug resistance;
           paralog of Yrm1p, acting on an overlapping set of target
           genes
          Length = 810

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 54  TTMSPTPLNSNNMGTGTSVTSGADTPASASNYR---VAQACDRCRSKKTRCDGKRPQCSQ 110
           T ++P   NSN+   G +  S + TP S S  +   + ++C  CR +K RCD ++P CS 
Sbjct: 15  TNVTPPSDNSNSTAGGAN-GSNSGTPTSTSGKKRNKLIKSCGFCRRRKLRCDQQKPMCST 73

Query: 111 CAAVGF-ECKISDKLSR 126
           C +     C+ +++ ++
Sbjct: 74  CISRNLTTCQYAEEFNK 90

>YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}
           RDR1Transcriptional repressor involved in the control of
           multidrug resistance; negatively regulates expression of
           the PDR5 gene; member of the Gal4p family of zinc
           cluster proteins
          Length = 546

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 122
           RV +AC  CR +K +C+GK P C  C A G+ C   D
Sbjct: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYID 50

>Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {ON}
           YGL013C (REAL)
          Length = 1000

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 14/70 (20%)

Query: 67  GTGTSVTSGADTPASASNY-------------RVAQACDRCRSKKTRCDGKRPQCSQCAA 113
           G      SGA+T   A+ +             +V++ACD CR +K +C+GK P C+ C  
Sbjct: 6   GVHIEADSGAETVMDANGFVMSLTGRVRKPRSKVSKACDNCRKRKIKCNGKFP-CASCEI 64

Query: 114 VGFECKISDK 123
              EC  + +
Sbjct: 65  YLCECTFTTR 74

 Score = 37.0 bits (84), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 44/103 (42%), Gaps = 9/103 (8%)

Query: 492 FNLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSA 551
           F    T ++ L + S  LF+   I     V ++    VS   ++ L R    V       
Sbjct: 460 FTCDVTHLEQLLYFSDLLFWLAEIYGFEKVLNVAVHFVS---RVGLSRWEFYV------G 510

Query: 552 VSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALP 594
           + +A    RR L+W  YY +   A +LG P  + D +I C LP
Sbjct: 511 LDEAFAERRRSLWWKAYYFEKTLASKLGYPSNIDDSKINCLLP 553

>SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]
           {ON} similar to gnl|GLV|KLLA0A03421g Kluyveromyces
           lactis KLLA0A03421g and weakly similar to YAL051W
           uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
           Oleate- activated transcription factor acts alone and as
           a heterodimer with Pip2p activates genes involved in
           beta- oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 946

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 22/33 (66%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           +++  C  CR  KT+CD ++P CS+C  +G +C
Sbjct: 24  KLSFVCQSCRKSKTKCDKQKPSCSRCLRLGHQC 56

>TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.109
           YOL089C
          Length = 996

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 5/47 (10%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQ---CSQCAAVGFEC--KISDKLSRR 127
           RVA+ACD CR +K +CD   PQ   CS C      C  ++ D + +R
Sbjct: 113 RVARACDHCRRRKIKCDPVNPQTNKCSNCTKYDANCTFRVRDDVEKR 159

>Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {ON}
           YGL013C (REAL)
          Length = 1080

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 123
           +V++ACD CR +K +C+GK P C+ C     EC  + +
Sbjct: 38  KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFTSR 74

>KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2.547
           YKL038W
          Length = 1088

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 38/76 (50%), Gaps = 6/76 (7%)

Query: 64  NNMGTGTSVTSGADTPA-SASNYR---VAQACDRCRSKKTRCDG--KRPQCSQCAAVGFE 117
           NN    TS T  A+  + S+SN R    ++ACD+CR KK +CD    R  C+ C   G +
Sbjct: 32  NNNTHMTSNTEEANNASRSSSNKRRTKASRACDQCRKKKVKCDNGDDRSVCTNCQRNGEK 91

Query: 118 CKISDKLSRRAFPRGY 133
           C       +R   +GY
Sbjct: 92  CTFERVPLKRGPSKGY 107

>Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa]
           {ON} YOR380W (RDR1) - Transcriptional repressor (zinc
           cluster protein) [contig 358] FULL
          Length = 552

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 72  VTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 122
           V +GAD P +    RV +AC  CR +K +CD   P C  C + G+ C+  D
Sbjct: 2   VATGADVPRN-KRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDD 50

>TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8.879
           YML099C
          Length = 1132

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 119
           R    C  CRS+K +CD ++PQC +C     +C+
Sbjct: 11  RTYSGCWTCRSRKIKCDQQKPQCKRCLKANLKCE 44

>Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019W
           (REAL)
          Length = 894

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 65  NMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKL 124
           N+       + A    S +  RV +AC+ C+ +K +CDG +P C  C+    EC+   K+
Sbjct: 6   NIDDALPTNTAASNENSKTRLRVQKACELCKKRKVKCDGNKP-CLNCSKHQKECRYDFKV 64

Query: 125 S 125
           +
Sbjct: 65  T 65

>NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {ON}
           Anc_7.17
          Length = 1161

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           R++  C  CR  KT+CD ++P C++C     +C
Sbjct: 64  RISFVCQECRKAKTKCDKEKPYCTRCVKQNIKC 96

>Kpol_1008.13 s1008 (21147..23855) [2709 bp, 902 aa] {ON}
           (21147..23855) [2709 nt, 903 aa]
          Length = 902

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 6/77 (7%)

Query: 59  TPLNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDG--KRPQ-CSQCAAVG 115
           TP+N++N   G ++ +G DT    +  R   AC  CR +K++CD   + P  C++C+  G
Sbjct: 28  TPVNNSNR-EGNNIENG-DTSIVGTVRRKKFACVECRQQKSKCDAVERAPDPCTKCSKKG 85

Query: 116 FECKISDKLSRRAFPRG 132
            +C I  K  RR + R 
Sbjct: 86  LQC-ILKKDYRRTYKRA 101

>Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii AGL233C
          Length = 926

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 76  ADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-EC 118
           +D     +  +V+++C  CR ++ +CD  RP+CS C + G  EC
Sbjct: 4   SDNKVVKTRRKVSKSCVFCRKRRVKCDKARPKCSTCVSKGLPEC 47

>TBLA0A05860 Chr1 (1449582..1452014) [2433 bp, 810 aa] {ON} 
          Length = 810

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 29/68 (42%), Gaps = 2/68 (2%)

Query: 66  MGTGTSVTSGADTPASASNY--RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 123
           + T +S       P   +N+  R  Q CDRCR  K +C G   QC+ C      C     
Sbjct: 16  VSTNSSEQPAQSGPPDPANWESRRDQVCDRCRKLKKKCYGLGRQCNNCQLSNNPCTTMAT 75

Query: 124 LSRRAFPR 131
           L RR  P+
Sbjct: 76  LKRRRKPK 83

>KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON} 
          Length = 791

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 69  GTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           G+S+T    T    S++RV++AC+ CR +K +C+G +P CS+C      C
Sbjct: 3   GSSITKPY-TYNKRSSHRVSRACNSCRKRKVKCNGVQP-CSKCITSNLRC 50

>KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {ON}
           
          Length = 1136

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 131
           R++  C  CR  K +CD ++P+C++C   G +C   ++  R+  PR
Sbjct: 45  RISFVCQNCRKSKMKCDREKPECTRCLKQGIKCVYDEE--RQPRPR 88

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
           YKL222C (REAL)
          Length = 688

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (57%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           +  +AC  CR KK +CD  RPQC QC     EC
Sbjct: 11  KAIKACLNCRRKKQKCDQARPQCYQCRIRKTEC 43

>KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa]
           {ON} weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 1040

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKIS 121
           RV+  C  CR +KTRCD   P CS+C A+  EC  S
Sbjct: 70  RVSYVCYACRRRKTRCDRGNP-CSKCVALSTECVYS 104

>KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa]
           {ON} some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1148

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 13/61 (21%)

Query: 71  SVTSGADTPASASNY----------RVAQACDRCRSKKTRCDGKRP---QCSQCAAVGFE 117
           S+T  A  PA  S+           RV++ACDRCR +K +CD   P   +CS C      
Sbjct: 4   SITEDAGIPAITSHAEGVTTKPAKKRVSKACDRCRRRKIKCDDLDPVSGKCSNCIKYKVP 63

Query: 118 C 118
           C
Sbjct: 64  C 64

>TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.60
           YLR266C
          Length = 793

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%)

Query: 67  GTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAA 113
            T T   S  DT       ++ ++C  CR +K +CD  RP C+QC++
Sbjct: 27  STYTISKSTTDTSQRRKKRKIPKSCYFCRKRKLKCDHSRPTCNQCSS 73

>TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]
           {ON} Anc_6.75 YLR278C
          Length = 1530

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%)

Query: 88  AQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFP 130
           +++C  CR +K RCD K P C+ C   G +C    + S  A P
Sbjct: 38  SKSCLLCRRRKQRCDHKLPSCTACLKAGVKCVQPARYSNNAAP 80

 Score = 32.7 bits (73), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 44/214 (20%), Positives = 93/214 (43%), Gaps = 40/214 (18%)

Query: 389 LVSDFFSQWYNFIPILDKDEFYNYYNKFKTDLMDPNFFDDEKNLFNKRNKSISYKIFGCI 448
            ++ +F++     P+LD++E Y+++          N+ +++ + F+  +   +Y      
Sbjct: 364 FLNTYFTRLQFKYPVLDENEIYSFH---------ENYINNKIHSFSNNDFHFNYG----- 409

Query: 449 LLIICQMGLISKVKAENLPATNKYSQL--MAYYDIVVRQLMMNPYFNLKSTSIQSLQFTS 506
                +M LI  + A     T KY+ L  + Y+   VR +      NL  T +Q ++  +
Sbjct: 410 -----KMWLIFSISAYLHMTTGKYNGLPPVRYFSTAVRHITRCSN-NL--TDLQKVELLA 461

Query: 507 LQLFYFLNIGEVS-SVYDLRGKVVSMSQ-QLRLHRCPSAVLGGNGSAVSKAQQGERRI-L 563
           L + Y +   + S  +YD+   V+ ++Q  L+L                      R+I +
Sbjct: 462 LLVLYIMKTDQDSLLLYDIIKDVMQIAQFNLKL-----------NKYNPNNPNKFRQIRI 510

Query: 564 FWGIYYLDVFSALQLGVPRLLKDHEIECALPVAD 597
           FW +Y L+    + +G   ++ + +I+  LP  D
Sbjct: 511 FWSLYLLERTICVAVGKSYIISEKDID--LPYFD 542

>Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa]
           {ON} YAL051W (REAL)
          Length = 1000

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRG 132
           R++  C  CR  KT+CD ++P+C +C      C I D ++R+A PR 
Sbjct: 20  RLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC-IYD-VARQAAPRN 64

>NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON} 
          Length = 701

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKISDK 123
           RV ++C  CR +K++CD  +P CS C   G  EC+  D+
Sbjct: 21  RVPKSCTVCRLRKSKCDRIKPYCSSCVLHGIKECRYDDR 59

>CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} similar
           to uniprot|P12351 Saccharomyces cerevisiae YLR256w HAP1
           transcription factor
          Length = 1372

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 115
           RV  +C  CR +K +CD  RP C+QC   G
Sbjct: 66  RVPLSCTICRRRKVKCDKSRPNCTQCVKTG 95

>KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {ON}
           Anc_7.512 YLR451W
          Length = 846

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 40/81 (49%), Gaps = 8/81 (9%)

Query: 55  TMSPTPLNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDG--KRPQ-CSQC 111
           T  PT + + + G  +S  S A+T A    +    AC  CR +K++CD   + P+ CS+C
Sbjct: 7   TNQPTSMFTGSDGNTSSNMSVANTAARKRKF----ACVECRQQKSKCDAHERAPEPCSKC 62

Query: 112 AAVGFECKISDKLSRRAFPRG 132
           A  G  C +     RR + R 
Sbjct: 63  AKKGVPCVLKKDF-RRTYKRA 82

>YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON}
           PIP2Autoregulatory oleate-specific transcriptional
           activator of peroxisome proliferation, contains
           Zn(2)-Cys(6) cluster domain, forms heterodimer with
           Oaf1p, binds oleate response elements (OREs), activates
           beta-oxidation genes
          Length = 996

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRG 132
           R++  C  CR  KT+CD ++P+C +C      C I D ++R+A PR 
Sbjct: 20  RLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC-IYD-VARQAAPRN 64

>NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879
          Length = 839

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 90  ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
            C  CRS+K +CD +RP C +C   G EC
Sbjct: 20  GCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48

>CAGL0G09757g Chr7 (930351..934622) [4272 bp, 1423 aa] {ON} some
           similarities with uniprot|Q05854 Saccharomyces
           cerevisiae YLR278c
          Length = 1423

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 50/234 (21%), Positives = 94/234 (40%), Gaps = 50/234 (21%)

Query: 361 FQTVFKFDIQAESSTTSQDHLIATEIDGLVSDFFSQWYNFIPILDKDEFYNYYNKFKTDL 420
           +   F+FD Q   S               +  FF++     P+LD+DE Y ++  +   L
Sbjct: 472 YDPAFEFDEQLSRS--------------FLDTFFTRLQFKYPLLDEDEIYTFHENY---L 514

Query: 421 MDPNFFDDEKNLFNKRNKSISYKIFGCILLIICQMGLISKVKAENLPATNKYSQL--MAY 478
            +  +   E N             F C      +M ++  + A     T KY     + Y
Sbjct: 515 KNQIYSYSETNFH-----------FAC-----GRMWMVFTISACLPMTTGKYKGQPPVRY 558

Query: 479 YDIVVRQLMMNPYFNLKSTSIQSLQFTSLQLFYFLNIGEVSSV-YDLRGKVVSMSQ-QLR 536
           +   +R +        K T +Q L+ ++L + Y +     S + Y++   V+++ + +L+
Sbjct: 559 FSTAIRHITR---CGNKLTPVQELELSTLLVLYIVRTDSDSMLLYEIIKDVMNICKNKLQ 615

Query: 537 LHRCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIE 590
           LH+        N    SK  +     LFW +Y L+    + +G P  + ++EIE
Sbjct: 616 LHK-----WHANDQFASKKLR-----LFWCVYLLERMICVAVGKPYTIHENEIE 659

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 88  AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           +++C  CR +K RCD K P C+ C     +C
Sbjct: 38  SRSCLLCRRRKQRCDHKLPSCTACLKAAVKC 68

>NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]
           {ON} Anc_7.17
          Length = 1022

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 10/73 (13%)

Query: 56  MSPTPLNSNNMGT-GTSVTSGADTPASAS---------NYRVAQACDRCRSKKTRCDGKR 105
           MS +PL +  M      V+SG  T + A+           R++  C  CR  KT+CD ++
Sbjct: 1   MSMSPLGTVAMSPPQEQVSSGNSTSSPAAGGSNRQIKKRNRISFVCQECRKAKTKCDKEK 60

Query: 106 PQCSQCAAVGFEC 118
           P C++C      C
Sbjct: 61  PACTRCVKQNLAC 73

>Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON}
           complement(3488..5758) [2271 nt, 757 aa]
          Length = 756

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 4/60 (6%)

Query: 69  GTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 128
            T  T  A +P     Y    +C RCR  K +C  +RP C+ C   G  C    +  RR+
Sbjct: 25  STDSTESATSPGDKEAY----SCSRCRKLKRKCQKQRPSCANCMNAGATCNYPGRAPRRS 80

>TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON} 
          Length = 873

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 5/76 (6%)

Query: 61  LNSNN-MGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDG--KRPQ-CSQCAAVGF 116
           ++SN+ +G G  +       +SA + R   AC  CR +K++CD   K P+ C++C+  G 
Sbjct: 1   MDSNSRIGNGAMIAGHEARRSSAIDKRKKFACVECRQQKSKCDALEKAPEPCTKCSKKGV 60

Query: 117 ECKISDKLSRRAFPRG 132
            C +  K  RR + R 
Sbjct: 61  SC-VLQKDYRRTYKRA 75

>NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON} 
          Length = 656

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           R    C  CR++K RC+ +RP CS+C  +G  C
Sbjct: 10  RPTHVCAACRTQKLRCNRERPSCSRCQRIGRTC 42

>KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {ON}
           Anc_1.380 YLR256W
          Length = 1233

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 115
           R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 33  RIPLSCTICRKRKVKCDKIRPHCNQCTKTG 62

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 71/324 (21%), Positives = 125/324 (38%), Gaps = 75/324 (23%)

Query: 386 IDGLVSDFFSQWYNFIPILDKDEFYNYYNKFKTDLMDPNFFDDEKNLFNKRNKSISYKIF 445
           I   V  FF   Y  +PI+D+  F ++ NK    ++  +  D  K   N R K+    + 
Sbjct: 399 IFTFVDKFFKHIYPIVPIIDEHNFKSHLNK----IILQDIRDSSKVNLNLR-KASDNCLL 453

Query: 446 GCILLII-----------CQMG------------LISKVKAENLPATN-KYSQLMAYYDI 481
           G +++I+           C +             LIS   A +   +N K   ++  ++ 
Sbjct: 454 GIMIIILRLTWLSLPPNRCNINLNNSSPDFINSLLISSNAATSASNSNMKDDNILIKFET 513

Query: 482 VVRQLMMNPYFNLKSTSIQS----------LQFTSLQLFYFLNIGEVSSVYDLRGK---- 527
            V  L +   + +K   I S          +QF      Y LN    S+  + R +    
Sbjct: 514 SVEALNLTKDYLIKFDKISSVSNNNINLTTIQFAIFYKIYMLNAPNSSTEPNTRAQDNDS 573

Query: 528 -------VVSMSQQLRLHRCPSAV--LGGNGSAVSKAQQGE------------------R 560
                  ++ M+    LHR P     L    S+ S  QQ E                  R
Sbjct: 574 NQILLSSIIQMAFSCGLHRDPDNFPQLNVVSSSTSLKQQNEEEMQRENQISTERFKHTWR 633

Query: 561 RILFWGIYYLDVFSALQLGVPRLLKDHE--IECALPVADNDDQKVNLAGQMIALEGRVSM 618
           ++ F+ I +LDV  +L +G PRLL++ +   +  LP A   D  V    ++I ++     
Sbjct: 634 KVWFY-IVHLDVNQSLAMGSPRLLRNLKDFSDTKLPSASKIDY-VRDIKELIIIKNYSLF 691

Query: 619 LSLSVIRFAKVLGNILDSIFKRGM 642
             + ++  A VL +IL+ +  + +
Sbjct: 692 WQIDLVIVA-VLNHILNILVAKNV 714

>KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conserved
           hypothetical protein
          Length = 639

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 20/39 (51%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKL 124
           R    C +C+S K +CD  +P C  C   GF+C  S  L
Sbjct: 12  RSYMGCQKCKSLKKKCDEVKPHCGYCKKRGFQCDYSRTL 50

>Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 aa]
           {ON} YMR019W (REAL)
          Length = 911

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 131
           RV +AC+ C+ +K +CDG RP C  C+    EC+   K + R   R
Sbjct: 41  RVQKACEICKRRKVKCDGNRP-CLNCSKHKKECRYDFKATNRRKKR 85

>KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON} 
          Length = 1476

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 115
           R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 47  RIPLSCTICRKRKVKCDKTRPHCNQCTKTG 76

>Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340)
           [3870 nt, 1290 aa]
          Length = 1289

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 115
           R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 22  RIPLSCTICRKRKVKCDKTRPHCNQCTKTG 51

>AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL248C
           (GAL4)
          Length = 648

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%)

Query: 87  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 133
           V QACD CR +K +C    P+C++C      C  S K+ R    R +
Sbjct: 5   VIQACDSCRRRKMKCSKTFPKCAKCREDNRVCLYSPKIRRSPLTRAH 51

>TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.59
           YHR178W
          Length = 877

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%)

Query: 90  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 128
           +C RCR  K +C  + P+CS C A  + C+   +L RR+
Sbjct: 97  SCSRCRRLKKKCLRQMPKCSNCVASHYACEYIGRLPRRS 135

>Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} similar
           to Ashbya gossypii AFR117C
          Length = 1198

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 115
           R+  +C  CR +K RCD  +P C+QC   G
Sbjct: 14  RIPLSCTICRKRKVRCDKTKPHCTQCVKTG 43

>NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON}
           Anc_1.380 YLR256W
          Length = 1581

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 17/30 (56%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 115
           RV  +C  CR +K +CD  RP C QC   G
Sbjct: 61  RVPLSCTICRKRKVKCDKIRPHCQQCTKTG 90

>TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON} 
          Length = 647

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 91/214 (42%), Gaps = 36/214 (16%)

Query: 499 IQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKAQQG 558
           +QS  + +   +Y L++ + S    L G  + M   L  H+ P+                
Sbjct: 275 VQSFLYAA---YYALSLDKSSLASILVGCAIRMMFGLGFHKHPTTA-------------K 318

Query: 559 ERRILFWGIYYLDVFSALQLGVPRLLKDHEIEC-ALPVADNDDQKVNLAGQMIALEGRVS 617
           E RI FW  Y  D   A++ G P  L D +++  +LP+ D            ++LE   +
Sbjct: 319 ENRI-FWLCYIYDRLVAVRFGFPLNLDDLDVDVLSLPLVDEK------GYYSVSLE---T 368

Query: 618 MLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHENALDNWRRGLPQQLKFELD--- 674
              +S ++ A++   IL SI+ +  S S  +  + V +  L  W   LPQ L  +LD   
Sbjct: 369 CHFVSQVKLARITTRILRSIYTKN-SISFIQNCNAVLKE-LKTWFDDLPQNLILDLDDFN 426

Query: 675 ---VNGTINMD-EFNHLKQLDTSGNMYSKENKSL 704
                 T+N+   +N+L  + T   ++   NK L
Sbjct: 427 IENSRSTVNLHINYNYLIIITTRPALFYVFNKML 460

 Score = 39.3 bits (90), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 115
           RV++ACD C+ +K RC G+ P C  C  +G
Sbjct: 5   RVSKACDVCKHRKKRCTGELP-CDYCTRIG 33

>AGR280C Chr7 complement(1266912..1270232) [3321 bp, 1106 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR278C
          Length = 1106

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 66/293 (22%), Positives = 128/293 (43%), Gaps = 56/293 (19%)

Query: 389 LVSDFFSQWYNFIPILDKDEFYNYYNKFKTDLMDPNFFDDEKNLFNKRNKSISYKIFGCI 448
            +  +F++     P+LD+ E Y +++ + +D +     D     F+          F C 
Sbjct: 281 FLDTYFTRIQFKYPLLDEREVYAFHDAYVSDSVQAYGTD----AFH----------FAC- 325

Query: 449 LLIICQMGLISKVKAENLPATNKYSQLMA--YYDIVVRQLMMNPYFNLKSTSIQSLQFTS 506
                +M ++  + A     T +Y  L    Y    +  L      N   T +Q ++  +
Sbjct: 326 ----GRMWMVFSIAACLHMTTGEYLGLPPNRYLSTAISHLTK---CNSALTPVQEVELLT 378

Query: 507 LQLFYFLNIG-EVSSVYDLRGKVVSMSQ-QLRLHRCPSAVLGGNGSAVSKAQQGERRI-L 563
           L +FY + I  + +++Y++   VV++ + +L LH+       GN          +R+  L
Sbjct: 379 LLVFYTIRIDRDSAALYEIIEDVVAICKNKLNLHQ---HTPYGNS---------DRKFRL 426

Query: 564 FWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKV---NLAGQMIALEGRVSM-L 619
           FW +Y L+    + +G P ++K+ EI   LP+   D+  +   +++G  +     ++  +
Sbjct: 427 FWCVYLLERMICVAVGKPYVIKESEI--GLPLFQEDEPSLVNHDISGSAVTGVHFINQAI 484

Query: 620 SLSVI--RFAKVLGNILDSIFKRGMSAS------LTKQISLVHE--NALDNWR 662
            L  I  RF +VLG I+  +  +    S      L +Q+SLV E    L+ WR
Sbjct: 485 KLRRIESRFVEVLG-IIPQVEDQWQQCSQLPRSKLQEQLSLVKEFFRELEIWR 536

 Score = 35.8 bits (81), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 88  AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           +++C  C+ +K RCD K P C+ C   G  C
Sbjct: 38  SRSCLLCQRRKQRCDHKIPSCTACLKAGVRC 68

>KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} some
           similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1007

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 34/72 (47%), Gaps = 9/72 (12%)

Query: 71  SVTSGADTPASASNYR--VAQACDRCRSKKTRCD-------GKRPQCSQCAAVGFECKIS 121
           SV+S   T  + S  R  V++ACD+CR KK +CD            C+ C  +G +C   
Sbjct: 95  SVSSNVSTATTESRRRSKVSRACDQCRKKKIKCDFIEGHDINPDQSCTGCRKIGEKCSFE 154

Query: 122 DKLSRRAFPRGY 133
               +R   +GY
Sbjct: 155 RIPLKRGPSKGY 166

>Smik_12.357 Chr12 complement(638342..642208) [3867 bp, 1288 aa]
           {ON} YLR278C (REAL)
          Length = 1288

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 91/217 (41%), Gaps = 22/217 (10%)

Query: 388 GLVSDFFSQWYNFIPILDKDEFYNYYNKFKTD--LMDPNFFDDEKNLFNKRNKSISYKIF 445
             +  FF++     PILD+ E Y +Y+ +  +  L+ P+            + S S   F
Sbjct: 307 SFLDTFFTRLQFKYPILDEQEIYTFYDHYLHNKILIPPSSPSTSSTAIPSNSHSYSEIEF 366

Query: 446 GCILLIICQMGLISKVKAENLPATNKYSQL--MAYYDIVVRQLMMNPYFNLKSTSIQSLQ 503
                +  +M L+  + A  L  T KY       Y+   +R +       L    +Q ++
Sbjct: 367 H---FLSGRMWLVFSISAYLLMTTGKYKGFPPHRYFSTAIRHITK---CGLHLNYVQQIE 420

Query: 504 FTSLQLFYFLNIGEVSSV-YDLRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKAQQGERRI 562
             +L + Y +     S + YD+   V+ +S++ +LH         N    +     ++  
Sbjct: 421 LLTLLVLYIIRTDRDSLILYDIIKDVMGISKK-KLHL--------NQWYPNDPFANKKLR 471

Query: 563 LFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADND 599
           LFW +Y L+    + +G P  +K+ EI   LP+ +ND
Sbjct: 472 LFWCVYLLERMICVAVGKPYTIKESEIN--LPLFNND 506

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%)

Query: 88  AQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 128
           +++C  CR +K RCD K P C+ C   G +C    K S  A
Sbjct: 38  SRSCLLCRRRKQRCDHKLPSCTACLKAGIKCVQPSKYSSIA 78

>ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]
           {ON} weakly similar to uniprot|P39961 Saccharomyces
           cerevisiae YER184C Hypothetical ORF
          Length = 724

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 122
           +V +AC  CR +K RCDG  P CS C ++  EC   D
Sbjct: 8   KVKRACQICRRRKIRCDGYLP-CSSCVSLKKECNYHD 43

>CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P39961 Saccharomyces
           cerevisiae YER184c
          Length = 835

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 118
           RV +ACD CR +K +CDG +P CS C      C
Sbjct: 16  RVIRACDVCRKRKVKCDGDQP-CSSCMTASTVC 47

>Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON} YLR256W
           (REAL)
          Length = 1503

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 12/80 (15%)

Query: 46  VPHVAANNTTMSPTPLNSNNMGTGTSVTSGADTP----ASASNY------RVAQACDRCR 95
           VP +A+   T S    + N  G  T  T+G+++P    +S S+       R+  +C  CR
Sbjct: 10  VPSIAS--MTQSSVQRSPNMHGATTPGTNGSNSPPLHMSSDSSKIKRKRNRIPLSCTICR 67

Query: 96  SKKTRCDGKRPQCSQCAAVG 115
            +K +CD  RP C QC   G
Sbjct: 68  KRKVKCDKFRPHCQQCTKTG 87

>KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {ON}
           Anc_8.423 YLR228C
          Length = 730

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 90  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 127
            CD C+ ++ +CD  +P C +CA +  EC  +    RR
Sbjct: 33  GCDNCKRRRVKCDEGKPFCQKCANMRLECVFTPPQPRR 70

>TDEL0G04090 Chr7 complement(744499..746730) [2232 bp, 743 aa] {ON}
           Anc_6.61 YOR172W
          Length = 743

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 72  VTSGADTPASASNYR-VAQACDRCRSKKTRCDGKRPQCSQCAAVGF 116
           +  G+D P      R + ++C  CR +K RCD K+P CS C+   F
Sbjct: 19  ILDGSDGPKVKKTRRKLIKSCAFCRKRKLRCDQKKPICSTCSQRRF 64

>ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa]
           {ON} some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1066

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 2/62 (3%)

Query: 73  TSGADTPASASNYRVAQACDRCRSKKTRC--DGKRPQCSQCAAVGFECKISDKLSRRAFP 130
            SG +T AS    + ++ACD+CR +K RC  D  +  C+ C   G  C       +R   
Sbjct: 50  ASGGNTSASKRRTKASRACDQCRKRKIRCDYDDDKGVCTSCRKNGESCAFERIQLKRGPS 109

Query: 131 RG 132
           +G
Sbjct: 110 KG 111

>YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}
           RGT1Glucose-responsive transcription factor that
           regulates expression of several glucose transporter
           (HXT) genes in response to glucose; binds to promoters
           and acts both as a transcriptional activator and
           repressor
          Length = 1170

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 7/64 (10%)

Query: 77  DTPASASNY-----RVAQACDRCRSKKTRCDGKRPQ--CSQCAAVGFECKISDKLSRRAF 129
           D+ A+AS+      + ++ACD+CR KK +CD K  +  CS C   G  C       +R  
Sbjct: 28  DSAAAASHAIKKRTKASRACDQCRKKKIKCDYKDEKGVCSNCQRNGDRCSFDRVPLKRGP 87

Query: 130 PRGY 133
            +GY
Sbjct: 88  SKGY 91

>KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene
           extends into a gap in the genome sequence
          Length = 729

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 89  QACDRCRSKKTRCDGKRPQCSQCAAVGF-EC 118
           + C  CR +K RCD  RP CS C A GF EC
Sbjct: 23  RTCTFCRQRKVRCDQGRPLCSSCKARGFSEC 53

>KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]
           {ON} Anc_2.547 YKL038W
          Length = 1286

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 38/87 (43%), Gaps = 11/87 (12%)

Query: 58  PTPLNSNNMGTGTSVTS------GADTPAS---ASNYRVAQACDRCRSKKTRCD--GKRP 106
           P P++   M  G++  S       AD P         + ++ACD+CR KK +CD    R 
Sbjct: 13  PLPISPGKMSHGSAGDSRSGQRRTADPPMEMHGKKRTKASRACDQCRRKKIKCDYNDMRN 72

Query: 107 QCSQCAAVGFECKISDKLSRRAFPRGY 133
            C+ C  +G  C       +R   +GY
Sbjct: 73  ICTNCQRIGERCSFERVPLKRGPTKGY 99

>Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W
           (REAL)
          Length = 831

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK--LSRRAFPRGY 133
           R+   C +C+  K +CD  RP CS+C     ECK  D   LS +    G+
Sbjct: 10  RLRLVCLQCKRIKRKCDKLRPVCSRCQQHSLECKYEDSADLSSKVIASGF 59

>Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}
           similar to Ashbya gossypii ACL058W
          Length = 885

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 38/68 (55%), Gaps = 4/68 (5%)

Query: 526 GKVVSMSQQLRLHRCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLK 585
            ++  ++Q+++L   P +  G    A+ ++    RRILFW I+YLD  ++L   +P L+K
Sbjct: 321 AQLFRLAQKIQLTLDPVSYHGMTDQALIRS----RRILFWQIFYLDTITSLHNNLPPLIK 376

Query: 586 DHEIECAL 593
             E +  L
Sbjct: 377 PGEFDTVL 384

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 91  CDRCRSKKTRCDGKRPQCSQCAAVGFECK--ISDKLSR 126
           C  C  +K +C  +RP C  C    FEC   ++D++SR
Sbjct: 38  CMPCHKRKVKCSRERPSCDNCLRNSFECVYFVNDRVSR 75

>TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.60
           YLR266C
          Length = 935

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 87  VAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKISD 122
           + + C  CR KK +CD +RP CS C A  F EC   D
Sbjct: 78  IIKTCLFCREKKLKCDKRRPLCSSCIARNFTECVYVD 114

>NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423
          Length = 775

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 21/39 (53%)

Query: 90  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 128
            CD C+ ++ +CD  +P C +C  +  EC  S    R+A
Sbjct: 57  GCDNCKRRRVKCDELKPTCQKCINMNLECVYSMPKPRKA 95

>NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {ON}
           Anc_4.113
          Length = 1118

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 127
           +V +ACD CR +K +C GK P C+ C A    C  S +  R+
Sbjct: 58  KVTKACDNCRRRKIKCTGKTP-CATCEAYQCLCIYSTQRGRK 98

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 128,584,340
Number of extensions: 5659670
Number of successful extensions: 19377
Number of sequences better than 10.0: 722
Number of HSP's gapped: 19800
Number of HSP's successfully gapped: 822
Length of query: 1270
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1149
Effective length of database: 39,606,813
Effective search space: 45508228137
Effective search space used: 45508228137
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 72 (32.3 bits)