Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0D01320g8.846ON26023912850.0
KLTH0C03740g8.846ON2542346022e-77
Kwal_27.102278.846ON2542395797e-74
Ecym_46178.846ON2492355701e-72
ABL120W8.846ON2492345631e-71
Smik_13.4948.846ON3042705211e-64
Skud_13.4538.846ON3002685211e-64
KLLA0D01430g8.846ON2632455171e-64
TDEL0B005208.846ON2682265076e-63
KNAG0J002408.846ON2862345071e-62
Suva_13.4708.846ON3032715053e-62
NDAI0K003308.846ON3132784784e-58
YMR281W (GPI12)8.846ON3042704784e-58
KAFR0B039608.846ON2782534531e-54
NCAS0C003808.846ON2762274494e-54
ZYRO0G14300g8.846ON2802604391e-52
TPHA0I002808.846ON3012554323e-51
CAGL0M03047g8.846ON3042704045e-47
Kpol_1068.48.846ON2912413618e-41
TBLA0B033008.846ON3192633567e-40
TDEL0C051403.372ON68047721.2
Ecym_56102.367ON690156721.4
TPHA0F034401.494ON401158711.5
Kwal_23.40814.281ON30750683.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0D01320g
         (260 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON...   499   0.0  
KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {O...   236   2e-77
Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {O...   227   7e-74
Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar ...   224   1e-72
ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic hom...   221   1e-71
Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W...   205   1e-64
Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W...   205   1e-64
KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {O...   203   1e-64
TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON} ...   199   6e-63
KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}...   199   1e-62
Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W...   199   3e-62
NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846...   188   4e-58
YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER me...   188   4e-58
KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.84...   179   1e-54
NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON} ...   177   4e-54
ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} simil...   173   1e-52
TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846 ...   171   3e-51
CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly...   160   5e-47
Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON} c...   143   8e-41
TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.84...   141   7e-40
TDEL0C05140 Chr3 complement(920322..922364) [2043 bp, 680 aa] {O...    32   1.2  
Ecym_5610 Chr5 complement(1235299..1237371) [2073 bp, 690 aa] {O...    32   1.4  
TPHA0F03440 Chr6 (738544..739749) [1206 bp, 401 aa] {ON}               32   1.5  
Kwal_23.4081 s23 (561871..562794) [924 bp, 307 aa] {ON} YKL183W ...    31   3.6  

>SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON}
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281W GPI12 ER membrane protein involved in the second
           step of glycosylphosphatidylinositol (GPI) anchor
           assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 260

 Score =  499 bits (1285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/239 (100%), Positives = 239/239 (100%)

Query: 22  ICVSQRIAAHNRQVFRNVFPSRTPTSVNLIVAHPDDETMFFSPTLLQLHVNYPPSVPLRV 81
           ICVSQRIAAHNRQVFRNVFPSRTPTSVNLIVAHPDDETMFFSPTLLQLHVNYPPSVPLRV
Sbjct: 22  ICVSQRIAAHNRQVFRNVFPSRTPTSVNLIVAHPDDETMFFSPTLLQLHVNYPPSVPLRV 81

Query: 82  ICLTNGDADGLGAVREQELRLSMQLLLPARNTSVIVEGFEDGMGVEWDTRQVVATINRHV 141
           ICLTNGDADGLGAVREQELRLSMQLLLPARNTSVIVEGFEDGMGVEWDTRQVVATINRHV
Sbjct: 82  ICLTNGDADGLGAVREQELRLSMQLLLPARNTSVIVEGFEDGMGVEWDTRQVVATINRHV 141

Query: 142 SDASPLLLTFDEHGVSGHVNHVSCNTAVSALVEQREQREQRFTALYLNSKRYFPPKYGSF 201
           SDASPLLLTFDEHGVSGHVNHVSCNTAVSALVEQREQREQRFTALYLNSKRYFPPKYGSF
Sbjct: 142 SDASPLLLTFDEHGVSGHVNHVSCNTAVSALVEQREQREQRFTALYLNSKRYFPPKYGSF 201

Query: 202 AVDLARIITGRQPPVFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNELHG 260
           AVDLARIITGRQPPVFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNELHG
Sbjct: 202 AVDLARIITGRQPPVFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNELHG 260

>KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {ON}
           weakly similar to uniprot|P23797 Saccharomyces
           cerevisiae YMR281W GPI12 ER membrane protein involved in
           the second step of glycosylphosphatidylinositol (GPI)
           anchor assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 254

 Score =  236 bits (602), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 147/234 (62%), Gaps = 4/234 (1%)

Query: 25  SQRIAAHNRQVFRNVFPSRTPTSVNLIVAHPDDETMFFSPTLLQLHVNYPPSVPLRVICL 84
           S RI A N Q F  +F    PTS+NL++AHPDDE MFF+PTLLQL   +   +P+ V  L
Sbjct: 22  SARIKASNEQAFTTLFSVLNPTSINLVIAHPDDEVMFFAPTLLQLDHYFDTDIPVSVFSL 81

Query: 85  TNGDADGLGAVREQELRLSMQLLLPARNTSVIVEGFEDGMGVEWDTRQVVATINRHVSDA 144
           T+G ADGLG +RE+ELR S+ LL   R   V V  FEDGM VEWD ++    + + V   
Sbjct: 82  TDGGADGLGKLREEELRDSVHLLFRRRKAEVTVLNFEDGMKVEWDLQKTSEALRKQVVGD 141

Query: 145 SPLLLTFDEHGVSGHVNHVSCNTAVSALVEQREQREQRFTALYLNSKRYFPPKYGSFAVD 204
            PL LTFD+HGVS H+NH+SC   V  L  +    E R  +  L SKR    KY +F   
Sbjct: 142 QPLFLTFDDHGVSSHINHISCYETVRNL--RAAHPESR--SFSLTSKRSIFQKYTAFVPS 197

Query: 205 LARIITGRQPPVFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNEL 258
           L  ++ G +  VFMSTF QYLL+L+ M NAH SQMVWFR+GWW  S +VF NE+
Sbjct: 198 LITVLRGSRQAVFMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSCYVFANEV 251

>Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {ON}
           YMR281W (GPI12) -
           N-acetylglucosaminylphosphatidylinositol de-N-acetylase
           [contig 39] FULL
          Length = 254

 Score =  227 bits (579), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 113/239 (47%), Positives = 150/239 (62%), Gaps = 4/239 (1%)

Query: 22  ICVSQRIAAHNRQVFRNVFPSRTPTSVNLIVAHPDDETMFFSPTLLQLHVNYPPSVPLRV 81
           I  S +I   NR+   ++F    PTS+NL++AHPDDE MFF+PTLLQ+    P S+ + V
Sbjct: 19  ILGSVQIERSNRRALGSLFRGSAPTSINLVIAHPDDEVMFFAPTLLQIDEWLPGSIEVNV 78

Query: 82  ICLTNGDADGLGAVREQELRLSMQLLLPARNTSVIVEGFEDGMGVEWDTRQVVATINRHV 141
           I LT+G ADGLG +R +EL+  ++LLL  R  SV V  F DGM VEWD  + V  +   +
Sbjct: 79  ISLTDGGADGLGDLRTKELQDCVRLLLRKRKASVEVLDFLDGMDVEWDLERAVKALQERI 138

Query: 142 SDASPLLLTFDEHGVSGHVNHVSCNTAVSALVEQREQREQRFTALYLNSKRYFPPKYGSF 201
            D SPL LTFDE+G+SGHVNH+SC  A    V++  +   + +   L SKRY   KY  F
Sbjct: 139 LDESPLFLTFDENGISGHVNHISCYKA----VQKVRKHYSKSSCFKLVSKRYLFEKYSGF 194

Query: 202 AVDLARIITGRQPPVFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNELHG 260
              L        P   +++F QYLL+L++M NAHVSQMVWFR+GWWL S +V+ NEL  
Sbjct: 195 IPALFHSFISSSPSTLINSFRQYLLALSSMMNAHVSQMVWFRYGWWLFSYYVYANELQA 253

>Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar to
           Ashbya gossypii ABL120W
          Length = 249

 Score =  224 bits (570), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 115/235 (48%), Positives = 147/235 (62%), Gaps = 11/235 (4%)

Query: 26  QRIAAHNRQVFRNVFPSR-TPTSVNLIVAHPDDETMFFSPTLLQLHVNYPPSVPLRVICL 84
           + +  HN +V+  +  S    TSV LI+AHPDDE MFF+PTLLQL      SVP RV+CL
Sbjct: 24  KHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMFFAPTLLQLDARMAQSVPFRVVCL 83

Query: 85  TNGDADGLGAVREQELRLSMQLLLPARNTSVIVEGFEDGMGVEWDTRQVVATINRHVSDA 144
           T+GDADGLG VR +EL  +++LL+  R+  + + GF+DGM  EW    V   + + V+D 
Sbjct: 84  TDGDADGLGEVRRRELHKALRLLVLERDVEIQMGGFKDGMDEEWKMEVVREELAQVVTDR 143

Query: 145 SPLLLTFDEHGVSGHVNHVSCNTAVSALVEQREQREQRFTALYLNSKRYFPPKYGSFAVD 204
            PL+LTFDE GVSGH NH++C  A + L             L+L+S      KY  F VD
Sbjct: 144 RPLVLTFDERGVSGHRNHIACAHAAAKLGHH---------TLHLDSGHNLIRKYSFFFVD 194

Query: 205 LARIITGR-QPPVFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNEL 258
           L R++ G   P VF+STF QYL SL  M  AH SQMVWFRWGWW ASR+V+ NE 
Sbjct: 195 LFRLLFGYPMPTVFLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRYVYANEF 249

>ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR281W (GPI12)
          Length = 249

 Score =  221 bits (563), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 112/234 (47%), Positives = 150/234 (64%), Gaps = 11/234 (4%)

Query: 26  QRIAAHNRQVF-RNVFPSRTPTSVNLIVAHPDDETMFFSPTLLQLHVNYPPSVPLRVICL 84
           +R+  HN QVF R V      TS+ L++AHPDDE MFF+PTLLQL    P  +P RV+CL
Sbjct: 24  RRLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMFFAPTLLQLDARLPAWMPFRVVCL 83

Query: 85  TNGDADGLGAVREQELRLSMQLLLPARNTSVIVEGFEDGMGVEWDTRQVVATINRHVSDA 144
           T+G A+GLG +R  EL+ +++LL+   + ++ V  F DGM  +WD  +V   +   V+DA
Sbjct: 84  TDGGAEGLGQLRRAELQKALRLLVLEHDVTLEVADFTDGMKEDWDLAEVRTRLGELVTDA 143

Query: 145 SPLLLTFDEHGVSGHVNHVSCNTAVSALVEQREQREQRFTALYLNSKRYFPPKYGSFAVD 204
            PL+LTFDE GVSGH NH+ C  A + L  +          L+L S+R    KY  F +D
Sbjct: 144 KPLVLTFDERGVSGHRNHIGCALAAARLGHK---------TLFLRSERNLLRKYSFFVLD 194

Query: 205 LARIITGRQPP-VFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNE 257
           + R++ G  PP VF+ST  QYL +L AM  AH SQMVWFRWGWW+ASR+V+ NE
Sbjct: 195 VFRVVFGTPPPTVFVSTLAQYLHALVAMVVAHRSQMVWFRWGWWMASRYVYANE 248

>Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W
           (REAL)
          Length = 304

 Score =  205 bits (521), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 161/270 (59%), Gaps = 33/270 (12%)

Query: 22  ICVSQRIAAHNRQVFRNVFPSR-TPTSVNLIVAHPDDETMFFSPTLLQLHVNYPPSVPLR 80
           I  + +I + N +  ++VFP++ +   +NLI+AHPDDE MFFSP + QLH  +P +VP  
Sbjct: 30  IYFTPKIISRNNESLQHVFPNKYSDYQINLIIAHPDDEVMFFSPMISQLHSYFPNTVPFN 89

Query: 81  VICLTNGDADGLGAVREQELRLSMQLLL-PARNTSVIVEGFEDGMGVEWDTRQVVATINR 139
           +ICL+ G+A+GLG  R +EL  S  LLL   R  SV V  F+DGM   WD   + +T+++
Sbjct: 90  IICLSKGNAEGLGQTRVRELNDSAALLLHNERAVSVQVMDFQDGMNEVWDIDSITSTLSQ 149

Query: 140 HV----SDASPLLLTFDEHGVSGHVNHVSCNTAVSALVE-------QREQREQRFTALYL 188
            +    ++ + +++TFD +GVSGH+NH SC+TAV  L+        ++E +    TALYL
Sbjct: 150 TIGINNNELNQIIVTFDSYGVSGHINHKSCHTAVRKLIADYTRSNVRKEVKTPLITALYL 209

Query: 189 NS-KRYFPPKYGSFAVDLARIITGRQPP-------------------VFMSTFPQYLLSL 228
            S K     KY SF  ++ R++ G   P                   + M+T  QY+L+ 
Sbjct: 210 RSYKNNIVLKYNSFIWEILRMLYGLISPFRKTTQALPSDVVAEKNSLLLMNTHAQYILAF 269

Query: 229 AAMCNAHVSQMVWFRWGWWLASRFVFVNEL 258
           AAM NAH SQ+VWFR+GWW+ SRFVFVNE 
Sbjct: 270 AAMLNAHKSQVVWFRYGWWILSRFVFVNEF 299

>Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W
           (REAL)
          Length = 300

 Score =  205 bits (521), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 114/268 (42%), Positives = 159/268 (59%), Gaps = 31/268 (11%)

Query: 22  ICVSQRIAAHNRQVFRNVFPSRTPTS-VNLIVAHPDDETMFFSPTLLQLHVNYPPSVPLR 80
           I  + +I + N ++ ++VFP +   S +NL++AHPDDE MFFSP + QLH  +P +VP  
Sbjct: 28  IFFTPKIISRNDELLQHVFPHKNRDSQINLVIAHPDDEVMFFSPVISQLHSYFPITVPFN 87

Query: 81  VICLTNGDADGLGAVREQELRLSMQLLLP-ARNTSVIVEGFEDGMGVEWDTRQVVATINR 139
           +ICL+ G+ADGLG  R +EL  S  LLL   R  SV V  FEDGM   WD   +V+TI++
Sbjct: 88  IICLSKGNADGLGESRVKELNGSAALLLQNERPVSVQVMDFEDGMDEVWDINSIVSTISQ 147

Query: 140 HVS----DASPLLLTFDEHGVSGHVNHVSCNTAVSALVE-----QREQREQ--RFTALYL 188
            +       + +++TFD +GVS H+NH SC+TAV  L++     + E  E+    TALYL
Sbjct: 148 TIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTAVKRLIDRYAESKAETNEETPHITALYL 207

Query: 189 NS-KRYFPPKYGSFAVDLARIITG-----------------RQPPVFMSTFPQYLLSLAA 230
            S K     KY SF  ++ +I+                   R   + M+T  QY+L+ AA
Sbjct: 208 KSYKNNIVLKYNSFIWEILKILYSVIVPFPKTIQPPTTTTQRSKLLLMNTHAQYVLAYAA 267

Query: 231 MCNAHVSQMVWFRWGWWLASRFVFVNEL 258
           M NAH SQ+VWFR+GWW+ SRFVFVNE 
Sbjct: 268 MLNAHKSQVVWFRYGWWILSRFVFVNEF 295

>KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {ON}
           similar to uniprot|Q75DZ3 Ashbya gossypii ABL120W
           ABL120Wp and weakly similar to YMR281W uniprot|P23797
           Saccharomyces cerevisiae YMR281W GPI12 ER membrane
           protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de- N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 263

 Score =  203 bits (517), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 107/245 (43%), Positives = 144/245 (58%), Gaps = 17/245 (6%)

Query: 23  CVSQRIAAHNRQVFRNVFPSRTP---TSVNLIVAHPDDETMFFSPTLLQLHVNYPPSVPL 79
           C+++ I  HNR  F  +         TSV L+VAHPDDE MFFSPTL Q +   P S+P+
Sbjct: 23  CLTKTIKEHNRWYFHELVSESMVSKLTSVTLVVAHPDDEVMFFSPTLTQFNELLPISIPI 82

Query: 80  RVICLTNGDADGLGAVREQELRLSMQLLLPARNTSVIVEGFEDGMGVEWDTRQVVATINR 139
            V+C+T GDADGLG +R+QEL  S++++   R     V  FEDGM   WD   +   +  
Sbjct: 83  NVVCMTAGDADGLGHIRKQELVDSLRIMFHGRQFGCDVLDFEDGMDAVWDQVLLEKQLRS 142

Query: 140 HVSDASPLLLTFDEHGVSGHVNHVSCNTAVSALVEQREQREQRFTALYLNSKRYFPPKYG 199
            + D++PL+LTFD+ GVSGH+NH+SC   V  L    +        L+L S +    KY 
Sbjct: 143 SIPDSNPLVLTFDQFGVSGHINHISCGRLVEKLPYSHK--------LHLRSDQPIYVKYS 194

Query: 200 SFAVDLARIITGR------QPPVFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFV 253
           +F   + ++          +P  F+ST PQYLL+ +AM  AH SQMVWFR GWWL SRF 
Sbjct: 195 AFIAGIFQLGISTVYPDYGKPRCFISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFC 254

Query: 254 FVNEL 258
           F+NEL
Sbjct: 255 FINEL 259

>TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON}
           Anc_8.846 YMR281W
          Length = 268

 Score =  199 bits (507), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 140/226 (61%), Gaps = 17/226 (7%)

Query: 44  TPTSVNLIVAHPDDETMFFSPTLLQLHVNYPPSVPLRVICLTNGDADGLGAVREQELRLS 103
           TP S+ L++AHPDDE MFFSP+LLQL    P SV    +CL+ GDAD LG  RE EL+ S
Sbjct: 45  TPESLTLLIAHPDDEVMFFSPSLLQLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRS 104

Query: 104 MQLLL--PARNTSVIVEGFEDGMGVEWDTRQVVATINRHVSDASP--LLLTFDEHGVSGH 159
           + LL     R T +    + DG   +W+   VV+ +   V   S   LLLTFD HGVS H
Sbjct: 105 LNLLTSNSQRKTQLYQFDYPDGFDEKWEIESVVSIVESKVFIGSGFNLLLTFDAHGVSNH 164

Query: 160 VNHVSCNTAVSALVEQREQREQRFTALYLNS-KRYFPPKYGSFAVDLARIITG------R 212
            NHV+C+ AV+ L+E+  +      ALYLNS  R  P KY  F  +L R+++       R
Sbjct: 165 PNHVACHNAVARLIEKGHK------ALYLNSHSRNLPLKYSGFIWELIRMLSDSVMKLER 218

Query: 213 QPPVFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNEL 258
               FM++FPQY+L+ AAM NAH SQ+VWFR+GWW  SRFVFVN+L
Sbjct: 219 TGLTFMNSFPQYILAFAAMANAHESQLVWFRYGWWSLSRFVFVNDL 264

>KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}
           Anc_8.846 YMR281W
          Length = 286

 Score =  199 bits (507), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 104/234 (44%), Positives = 145/234 (61%), Gaps = 24/234 (10%)

Query: 47  SVNLIVAHPDDETMFFSPTLLQLHVNY-PPSVPLRVICLTNGDADGLGAVREQELRLSMQ 105
           SVNL++AHPDDE MFF+P+L+ L+     PS    +IC +NG ADGLG VREQEL  S+ 
Sbjct: 50  SVNLVIAHPDDEVMFFAPSLINLNEQIRDPSTVFNIICFSNGGADGLGNVREQELSDSIA 109

Query: 106 LLLPARNTSVIVEGFEDGMGVEWDTRQVVATINRHVSD-ASPLLLTFDEHGVSGHVNHVS 164
           +LLP RNTS++V  F+DGM  +WD ++++A +   V      +LLTFD  GVSGH+NH++
Sbjct: 110 MLLPTRNTSIVVLDFKDGMKEKWDVKEMIAKLRNIVPKLGHNVLLTFDGKGVSGHLNHIA 169

Query: 165 CNTAVSALVEQREQREQRFTALYLNS-KRYFPPKYGSFAVDLARII-------------- 209
           C  A      + + + Q+ T L L S  +    KY S+  +L +++              
Sbjct: 170 CYRAALGYYNEFKSK-QKLTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVLP 228

Query: 210 -----TGRQPPVFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNEL 258
                  R+  +F ST+PQY+LSLAAM NAH +Q+VWFR+GWW  SR VFVN+L
Sbjct: 229 KRGSNVARKITIF-STYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDL 281

>Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W
           (REAL)
          Length = 303

 Score =  199 bits (505), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 110/271 (40%), Positives = 155/271 (57%), Gaps = 34/271 (12%)

Query: 22  ICVSQRIAAHNRQVFRNVFPSRTPTS-VNLIVAHPDDETMFFSPTLLQLHVNYPPSVPLR 80
           I  + +I + N    ++VFP R   S +NL++AHPDDE MFFSP + QLH  +P +VP  
Sbjct: 28  IYFTPKILSRNTDSLQHVFPHRDRNSQINLVIAHPDDEVMFFSPVISQLHAYFPDTVPFN 87

Query: 81  VICLTNGDADGLGAVREQELRLSMQLLL-PARNTSVIVEGFEDGMGVEWDTRQVVATINR 139
           ++CL+ GDA+GLG  R +EL  S  LLL   R  SV V  FEDGM   WD   + +T+++
Sbjct: 88  ILCLSKGDAEGLGETRAKELNDSAVLLLRNERPVSVQVMDFEDGMDEVWDIDSITSTLSQ 147

Query: 140 HVS----DASPLLLTFDEHGVSGHVNHVSCNTAVSALVEQ------REQREQ-RFTALYL 188
            +       S +++TFD +GVS H+NH SC+ AV   ++       +E+ E    TALYL
Sbjct: 148 TIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIAVEKFIDDYVGSKTKEKAENAHITALYL 207

Query: 189 NS-KRYFPPKYGSFAVDLARII--------------------TGRQPPVFMSTFPQYLLS 227
            S K     KY SF  ++ +++                    T +   + M+T  QY+L+
Sbjct: 208 RSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSIQPLAAPSTTTEKNGLLLMNTHSQYILA 267

Query: 228 LAAMCNAHVSQMVWFRWGWWLASRFVFVNEL 258
            AAM NAH SQ+VWFR+GWW+ SRFVFVNE 
Sbjct: 268 FAAMLNAHKSQVVWFRYGWWILSRFVFVNEF 298

>NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846
           YMR281W
          Length = 313

 Score =  188 bits (478), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 104/278 (37%), Positives = 158/278 (56%), Gaps = 44/278 (15%)

Query: 25  SQRIAAHNRQVFRNVF-------------PSRTPTSVNLIVAHPDDETMFFSPTLLQLHV 71
           +Q+I+++N++ F N                S   T ++L++AHPDDE MFF+PTLLQL+ 
Sbjct: 27  TQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQLSLVIAHPDDELMFFAPTLLQLNR 86

Query: 72  NYPPSVPLRVICLTNGDADGLGAVREQELRLSMQLLLPARNT---SVIVEGFEDGMGVEW 128
             P S+P  +IC ++GDA+GLG +R +EL  S+ LLL + N    ++ +  F DGM   W
Sbjct: 87  FLPTSIPFNIICFSDGDAEGLGYLRRKELHDSINLLLSSSNNRKINISILDFIDGMDQVW 146

Query: 129 DTRQVVATINRHV------SDASPLLLTFDEHGVSGHVNHVSCNTAVSALV--EQREQRE 180
           D +Q+++++   +      S  + +LLTFD +G+S H NH++CN AV  L+  +  + +E
Sbjct: 147 DGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISNHPNHIACNKAVHDLISYDGGKDKE 206

Query: 181 QRFTALYLNSKR-------YFPPKYGSFAVDLARII----TGRQPPV---------FMST 220
                L L+SK            KY  F +DL ++     TG    +         F++T
Sbjct: 207 MNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVKVYWNLATGTFNTIPNSASLELSFINT 266

Query: 221 FPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNEL 258
           + QY+LS A+M N H SQMVWFR+GWW  SRFVF N+L
Sbjct: 267 YSQYILSYASMLNTHKSQMVWFRYGWWWFSRFVFSNDL 304

>YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER
           membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly, the
           de-N-acetylation of the
           N-acetylglucosaminylphosphatidylinositol intermediate;
           functional homolog of human PIG-Lp
          Length = 304

 Score =  188 bits (478), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 104/270 (38%), Positives = 152/270 (56%), Gaps = 33/270 (12%)

Query: 22  ICVSQRIAAHNRQVFRNVFPSRT-PTSVNLIVAHPDDETMFFSPTLLQLHVNYPPSVPLR 80
           I  + +I + N    +++FP +     +NL++AHPDDE MFFSP + QL+  +P +VP  
Sbjct: 30  IYFTPKIVSRNNASLQHIFPHKYGDYEINLVIAHPDDEVMFFSPIISQLNSYFPRTVPFN 89

Query: 81  VICLTNGDADGLGAVREQELRLSMQLLL-PARNTSVIVEGFEDGMGVEWDTRQVVATINR 139
           +ICL+ G+A+GLG  R +EL  S  LLL   R  SV V  F+DGM   WD   + +++++
Sbjct: 90  IICLSKGNAEGLGETRVRELNESAALLLHNERAVSVQVMDFQDGMDEIWDIDSITSSLSQ 149

Query: 140 HVS----DASPLLLTFDEHGVSGHVNHVSCNTAVSALVE-------QREQREQRFTALYL 188
            +     + + +++TFD +GVS H+NH SC  AV  LV+       +R ++    TALYL
Sbjct: 150 KIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAAVKKLVDDYAQPKTKRNEQPPHVTALYL 209

Query: 189 NS-KRYFPPKYGSFAVDLARIITGRQPPV-------------------FMSTFPQYLLSL 228
            S K     KY SF  ++ +I+     P                     M+T  QY+L+ 
Sbjct: 210 RSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQALPPNTAAEKDKLSLMNTHAQYVLAF 269

Query: 229 AAMCNAHVSQMVWFRWGWWLASRFVFVNEL 258
           A M NAH SQ+VWFR+GWW+ SRFVFVNE 
Sbjct: 270 ATMLNAHESQVVWFRYGWWIFSRFVFVNEF 299

>KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.846
           YMR281W
          Length = 278

 Score =  179 bits (453), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 95/253 (37%), Positives = 140/253 (55%), Gaps = 18/253 (7%)

Query: 22  ICVSQRIAAHNRQVFRNVFPS-----RTPTSVNLIVAHPDDETMFFSPTLLQLHVNYPPS 76
           I +S +I   N Q+     PS         S+ L+VAHPDDE MFFSPTLLQL  + PP+
Sbjct: 23  IVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHPDDEVMFFSPTLLQLDSHLPPN 82

Query: 77  VPLRVICLTNGDADGLGAVREQELRLSMQLLLPARNTSVIVEGFEDGMGVEWDTRQVVAT 136
               +I  ++GDA+GLG++R  EL  S+ +L+P RN  + +    DGM   WD + ++  
Sbjct: 83  CKFNIISYSDGDAEGLGSLRSNELAHSIDMLIPRRNKEIFIFNHTDGMNEVWDNKLMLHQ 142

Query: 137 INRHVSDA-SPLLLTFDEHGVSGHVNHVSCNTAVSALVEQREQREQRFTALYLNSKRYFP 195
           +   +SD+ + +LLTFD+ GVS H+NH +C+  V++ ++   +    F  L  +      
Sbjct: 143 LESILSDSQTNILLTFDQFGVSNHINHKACHQVVTSYIQSHAKNN--FALLLDSYSSNLL 200

Query: 196 PKYGSFAVDLARI-----ITGRQPP-----VFMSTFPQYLLSLAAMCNAHVSQMVWFRWG 245
            KY  FA  L  +     I G+  P        + +  Y+ + A M  AH SQMVWFR+G
Sbjct: 201 KKYTGFAWQLVFLAKNYWIHGKTLPNLDHLALFNPYSDYITAYATMLKAHKSQMVWFRYG 260

Query: 246 WWLASRFVFVNEL 258
           WW  SRFV+VN+L
Sbjct: 261 WWFFSRFVYVNDL 273

>NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON}
           Anc_8.846 YMR281W
          Length = 276

 Score =  177 bits (449), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 98/227 (43%), Positives = 133/227 (58%), Gaps = 21/227 (9%)

Query: 46  TSVNLIVAHPDDETMFFSPTLLQLHVNYPPSVPLRVICLTNGDADGLGAVREQELRLSMQ 105
           T++NL++AHPDDE MFF+PTLLQL    P S+P+ VIC +NGDA GLG  R+ EL+ S+ 
Sbjct: 53  TTLNLVIAHPDDEVMFFAPTLLQLDNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIH 112

Query: 106 LLLP-ARNTSVIVEGFEDGMGVEWDTRQVVATINRHVSDASPLLLTFDEHGVSGHVNHVS 164
            L+   R T+V V  F+DG    WD  Q+   + ++   A    LTFD HGVSGH NH++
Sbjct: 113 ALIQNQRQTNVTVLHFQDGNDQIWDIDQMTQYLPQNDHQA---FLTFDSHGVSGHKNHIA 169

Query: 165 CNTAVSALVEQREQREQRFTALYLNSKRY-FPPKYGSFAVDLARII----TGRQPP---- 215
           C+ AV  L    +      T L L+S  +    KY  F +DL ++       +Q P    
Sbjct: 170 CHNAVWNL----KNTNNNVTILTLDSIHHSLLAKYTFFIIDLVKLYWNLWKDQQQPQWES 225

Query: 216 ----VFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNEL 258
                F + + QY+L+ + M NAH SQ+VWFR+GWW  SRFVF N L
Sbjct: 226 HDKITFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHL 272

>ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} similar
           to uniprot|P23797 Saccharomyces cerevisiae YMR281W GPI12
           ER membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 280

 Score =  173 bits (439), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 106/260 (40%), Positives = 143/260 (55%), Gaps = 26/260 (10%)

Query: 22  ICVSQRIAAHNRQVFR-NVFPSRTPTSVNLIVAHPDDETMFFSPTLLQLHVNYPPSVPLR 80
           I  S RI + N  VF  N+       S++L+VAHPDDE MFF+PT+L+L    PP+V   
Sbjct: 19  IAFSVRIKSRNGSVFNDNLKFLDEIDSLSLVVAHPDDEVMFFAPTILELDSRLPPNVEFN 78

Query: 81  VICLTNGDADGLGAVREQELRLSMQLLLP--ARNTSVIVEGFEDGMGVEWDTRQVVATIN 138
           V+CL+ G AD LG  R QEL+ S+ LLL    R   +    + DG    WD   V +TI 
Sbjct: 79  VVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYPDGHEETWDQESVQSTIK 138

Query: 139 RHVSDA--SPLLLTFDEHGVSGHVNHVSCNTAVSALVEQREQREQRFTALYLNS-KRYFP 195
             V     S +LLTFD+ GVS HVNH++C+ AVS LV+     +    ALYL+S      
Sbjct: 139 DSVLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESNVK---AALYLDSYGDNIV 195

Query: 196 PKYGSFAVDLARII--------------TGRQPP---VFMSTFPQYLLSLAAMCNAHVSQ 238
            KY +F  ++ ++                  +P      MS +  Y+LS A+M ++H SQ
Sbjct: 196 LKYSAFFWEIWKLTRDWFLHRVLPTSSYNENKPATEITLMSDYSSYILSFASMLHSHKSQ 255

Query: 239 MVWFRWGWWLASRFVFVNEL 258
           MVWFR+GWW  SRFVFVN+L
Sbjct: 256 MVWFRYGWWTFSRFVFVNDL 275

>TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846
           YMR281W
          Length = 301

 Score =  171 bits (432), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 107/255 (41%), Positives = 140/255 (54%), Gaps = 39/255 (15%)

Query: 43  RTPTSVNLIVAHPDDETMFFSPTLLQLHVNYPPSVPLRVICLTNG-DADG--LGAVREQE 99
           ++  SVNLI+AHPDDE MFF+PTLLQL    P  VP  VICL+ G D DG  +G +R  E
Sbjct: 44  QSLKSVNLIIAHPDDEVMFFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNE 103

Query: 100 LRLSMQLLLPAR----NTSVIVEGFE--DGMGVEWDTRQVVATINRHVSDASPL------ 147
           +  S+ +LL  R    N  V +  FE  DGM  +WD  +VV  I   +S  S +      
Sbjct: 104 IMDSLTMLLGHRRAGLNREVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHW 163

Query: 148 LLTFDEHGVSGHVNHVSCNTAVSALVEQREQREQRFTALYLNS-KRYFPPKYGSF----- 201
           LLTFD  GVS H NH++C  A+  L +Q+      +  + LNS       KY SF     
Sbjct: 164 LLTFDAQGVSEHPNHIACYDAMMTL-KQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVF 222

Query: 202 ------AVDLARIITGRQPPV-----------FMSTFPQYLLSLAAMCNAHVSQMVWFRW 244
                   D  RI   +Q P            F++TFP Y+++L++M N+H SQMVWFR+
Sbjct: 223 KLLINIINDKFRIFELKQVPFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRY 282

Query: 245 GWWLASRFVFVNELH 259
           GWW  SRFVFVN+LH
Sbjct: 283 GWWSFSRFVFVNDLH 297

>CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281w GPI12 N-acetylglucosaminyl phosphatidylinositol
           deacetylase
          Length = 304

 Score =  160 bits (404), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 98/270 (36%), Positives = 137/270 (50%), Gaps = 40/270 (14%)

Query: 22  ICVSQRIAAHNRQVFRNVFPSRTPTSV-NLIVAHPDDETMFFSPTLLQL--HVNYPPSVP 78
           I  + ++   N++    + P+     V NL++AHPDDE MFFSPT+LQL  HV       
Sbjct: 37  IYFTPKVEDLNKENLTKLLPTHDNFGVLNLVIAHPDDEIMFFSPTILQLIDHVQ-----E 91

Query: 79  LRVICLTNGDADGLGAVREQELRLSMQLLL---PARNTSVIVEGFEDGMGVEWDTRQVVA 135
           L V+CL+NGDADGLG +R +EL+ ++  L      RN S+ +  + DG    W    V  
Sbjct: 92  LNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQNEVWS--GVAT 149

Query: 136 TINRHVSDASP------LLLTFDEHGVSGHVNHVSCNTAVSALVEQREQREQRFTALYLN 189
            + +++  + P      ++LTFD  G+SGH NH++CN  V + ++  +     F  L   
Sbjct: 150 DLKKYILTSEPGVKQKDIILTFDREGISGHRNHIACNEGVISYLKTIKSNSFVFLELKSL 209

Query: 190 SKRYFPPKYGSFAVDLARIITGR---------------------QPPVFMSTFPQYLLSL 228
           S      KY      L  II  +                         F+STF QY LS 
Sbjct: 210 STWQIISKYSGVVPKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNVCFISTFDQYALSF 269

Query: 229 AAMCNAHVSQMVWFRWGWWLASRFVFVNEL 258
           AAMC AH SQMVWFR+ WW  SR+VFVN+L
Sbjct: 270 AAMCYAHKSQMVWFRYLWWSFSRYVFVNDL 299

>Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON}
           complement(6124..6999) [876 nt, 292 aa]
          Length = 291

 Score =  143 bits (361), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 127/241 (52%), Gaps = 32/241 (13%)

Query: 46  TSVNLIVAHPDDETMFFSPTLLQLHVNYPPSVPLRVICLTNG---DADGLGAVREQELRL 102
           +SVNL++AHPDDE MFFSPTL+QL    P  V + VIC + G   D    G  R +EL+ 
Sbjct: 46  SSVNLVIAHPDDEVMFFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKK 105

Query: 103 SMQLLLP-ARNTSVIVEGFEDGMGVEWDTRQVVATINRHVSDASP-----LLLTFDEHGV 156
           S+ +L+   R  +V    ++DG    WD   +V  +   ++ +       LL+TFDEHGV
Sbjct: 106 SVSMLIEHDRPVTVHQLDYKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGV 165

Query: 157 SGHVNHVSCNTAVSALVEQREQREQRFTALYLNSKRY-FPPKYGSFAVDLARI------- 208
           S H NH++C+ AV  L+E+    E  F A  L S       KY  FA ++ +        
Sbjct: 166 SDHPNHIACHNAVHRLIEE----EPLFMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQ 221

Query: 209 -ITGRQP----------PVFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNE 257
            I G+             V  +T  +Y+++ A M NAH SQ+VWFR+GWW  SR  + NE
Sbjct: 222 RIKGQTSLNKNMDVPYEYVLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANE 281

Query: 258 L 258
           L
Sbjct: 282 L 282

>TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.846
           YMR281W
          Length = 319

 Score =  141 bits (356), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 91/263 (34%), Positives = 128/263 (48%), Gaps = 52/263 (19%)

Query: 46  TSVNLIVAHPDDETMFFSPTLLQLHVNYPPSVPLRVICLTNGDADGLGAVRE----QELR 101
            S++LI+AHPDDE MFFSPTLLQL+      +   V+CL+ G  D  G+ ++     EL 
Sbjct: 55  NSLSLIIAHPDDEIMFFSPTLLQLNNYLEKDIMFNVVCLSQG-LDSTGSFKDPQRVHELN 113

Query: 102 LSMQLLLP-------ARNTSVIVEGFEDGMGVEWDTRQVVATI--NRHVSDAS-PLLLTF 151
            S+ LL          RN  +I   + DGM   W+   +V  +  N + +D    LLLTF
Sbjct: 114 DSLNLLFNRGSNNEHNRNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGINLLLTF 173

Query: 152 DEHGVSGHVNHVSCNTAVSALVEQREQREQRFTALYLNS-KRYFPPKYGSFAVDLARIIT 210
           D+ GVS H NH++CN AV+ L+ +    +     ++LNS  + F  KY  F   L  II 
Sbjct: 174 DKSGVSNHKNHLACNEAVTKLL-KYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIK 232

Query: 211 GR-----------------------------------QPPVFMSTFPQYLLSLAAMCNAH 235
            +                                       F + F +Y+LS + M NAH
Sbjct: 233 LKFFRSISLFYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAH 292

Query: 236 VSQMVWFRWGWWLASRFVFVNEL 258
            SQMVWFR+ WW+ SRF F+N+L
Sbjct: 293 ESQMVWFRYLWWIFSRFAFINDL 315

>TDEL0C05140 Chr3 complement(920322..922364) [2043 bp, 680 aa] {ON}
           Anc_3.372 YBR117C
          Length = 680

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 25/47 (53%)

Query: 194 FPPKYGSFAVDLARIITGRQPPVFMSTFPQYLLSLAAMCNAHVSQMV 240
           +  KY     DLAR ++G+ P  + S  P Y  + +A+    +S+M+
Sbjct: 319 YQKKYAQLGKDLARRLSGKLPEKWDSKLPTYTPADSAIATRKLSEMI 365

>Ecym_5610 Chr5 complement(1235299..1237371) [2073 bp, 690 aa] {ON}
           similar to Ashbya gossypii ADR274C
          Length = 690

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 67/156 (42%), Gaps = 12/156 (7%)

Query: 50  LIVAHPDDETMFFSPTLLQLHVNYPPSVPLRVICLTNGDADGLGAVREQELRLSMQLLLP 109
           L V H DD   +  P + +   + PPS    V+  TN     +    E+ +  +MQL + 
Sbjct: 506 LEVYHADD-YRYQKPIINEPRYSLPPSCCNEVLIDTNTKYVVICQTSEKSIHANMQLAIK 564

Query: 110 ARNTSVIVEGFEDGM---GVEWDTRQVVATINRHVS----DASPLLLTFDEHGVSGHVNH 162
           A+N + IV      +   G+ +  ++ +  I  H+      + P  L    +  +G +  
Sbjct: 565 AQNKNAIVSLKRTTLKYGGLRFHNKKELFPIGNHLKVPIIVSRPTSLHVTVYSTTGPLK- 623

Query: 163 VSCNTAVSALVEQREQREQRFTALYLNSKRYFPPKY 198
           + CN +V    E +E   Q    + L+++ Y  PK+
Sbjct: 624 IQCNVSVD---ESQELLVQDEGFISLDNRPYILPKF 656

>TPHA0F03440 Chr6 (738544..739749) [1206 bp, 401 aa] {ON} 
          Length = 401

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 33/158 (20%), Positives = 68/158 (43%), Gaps = 22/158 (13%)

Query: 52  VAHPD-DETMFFSPTLLQL----HVNYPPSVPLRVICLTNGDADGLGAVR------EQEL 100
           ++ PD    + ++P L  +    + + P +  + V        + +G VR       Q+L
Sbjct: 97  LSQPDLSNELLYAPKLNHITSSSYEHEPSNTSILVTDKQKSIKNSIGRVRFKEEFETQDL 156

Query: 101 RLSMQLLLPARNTSVIVEGFEDGMGVEWDTRQVVATINRHVSDASPLLLTFDEHGVSGHV 160
            +++Q + P +NTS      +D  G+E +T + V       S +S L L   +  ++   
Sbjct: 157 EVTLQNITPIKNTS------KDTFGLETETTKTVKKNGALSSQSSKLRLKELKREIA--- 207

Query: 161 NHVSCNTAVSALVEQREQREQRFTALYLNSKRYFPPKY 198
             ++C+   ++ +EQ  +   +F   YL  +     KY
Sbjct: 208 --LNCDLFYNSFIEQHIKHNAQFPGNYLKHQNNRKDKY 243

>Kwal_23.4081 s23 (561871..562794) [924 bp, 307 aa] {ON} YKL183W
           (LOT5) -  [contig 255] FULL
          Length = 307

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 126 VEWDTRQVVATINRHVSDASPLLLTFDEHGVS-GHVNHVSCNTAVSALVE 174
           VE   R   A I+RH +D    L TF E G++ G     +CN+A++  ++
Sbjct: 161 VELILRPKYAEIDRHYNDQVESLFTFKEFGLNRGDTLVANCNSAIATCMD 210

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.136    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,597,864
Number of extensions: 968542
Number of successful extensions: 2990
Number of sequences better than 10.0: 27
Number of HSP's gapped: 3006
Number of HSP's successfully gapped: 28
Length of query: 260
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 153
Effective length of database: 41,212,137
Effective search space: 6305456961
Effective search space used: 6305456961
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)