Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0D01298g8.847ON55155125850.0
KLTH0C03718g8.847ON55147510291e-133
Kwal_27.102248.847ON5464649601e-123
ZYRO0G14322g8.847ON5504728681e-109
TDEL0B005108.847ON5504767761e-95
Kpol_1068.38.847ON5664896533e-77
Ecym_46188.847ON5274105421e-61
Skud_13.4548.847ON5804195442e-61
TPHA0I002908.847ON5694845423e-61
Smik_13.4958.847ON5764235391e-60
Suva_13.4718.847ON5814204812e-52
YMR282C (AEP2)8.847ON5804184785e-52
KLLA0D01408g8.847ON5184304571e-49
CAGL0M03069g8.847ON5484674063e-42
NCAS0C003708.847ON4954314024e-42
NDAI0K003408.847ON6245473996e-41
TBLA0B033108.847ON6134813758e-38
KAFR0B039708.847ON4744013654e-37
KNAG0J002308.847ON4744303621e-36
ABL119C8.847ON5373982595e-23
Kwal_34.160351.467ON115264800.45
SAKL0B04334g4.181ON8772720.50
KLLA0B05643g4.181ON8753691.4
NDAI0H01410singletonON311110741.5
Kpol_1045.227.418ON276745715.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0D01298g
         (551 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly s...  1000   0.0  
KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly...   400   e-133
Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282...   374   e-123
ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]...   338   e-109
TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847...   303   1e-95
Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..599...   256   3e-77
Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {O...   213   1e-61
Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {...   214   2e-61
TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}...   213   3e-61
Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {...   212   1e-60
Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {...   189   2e-52
YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON} ...   188   5e-52
KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly...   180   1e-49
CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa] ...   160   3e-42
NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847...   159   4e-42
NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON...   158   6e-41
TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {O...   149   8e-38
KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {O...   145   4e-37
KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.84...   144   1e-36
ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON} S...   104   5e-23
Kwal_34.16035 s34 (169267..172725) [3459 bp, 1152 aa] {ON} YJR04...    35   0.45 
SAKL0B04334g Chr2 complement(388170..388406,388471..388497) [264...    32   0.50 
KLLA0B05643g Chr2 (509019..509045,509123..509359) [264 bp, 87 aa...    31   1.4  
NDAI0H01410 Chr8 (346035..346970) [936 bp, 311 aa] {ON}                33   1.5  
Kpol_1045.22 s1045 complement(45581..53884) [8304 bp, 2767 aa] {...    32   5.9  

>SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score = 1000 bits (2585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/551 (88%), Positives = 487/551 (88%)

Query: 1   MLSKKHCTHQLLLKGCXXXXXXXXXXXXXXXXPQQAIGXXXXXXXXXXXXXXXXXXRXXX 60
           MLSKKHCTHQLLLKGC                PQQAIG                  R   
Sbjct: 1   MLSKKHCTHQLLLKGCSSTLLTSISHISTSASPQQAIGTLADTTATKTTLPTEKTPRSLK 60

Query: 61  XXXXXXXXXXXXXXHKWGTTAEQIKPSLPRNNLRQHLQDNEHAKFLVELLLECKSDEGFA 120
                         HKWGTTAEQIKPSLPRNNLRQHLQDNEHAKFLVELLLECKSDEGFA
Sbjct: 61  IKLLLKEEKYSKQLHKWGTTAEQIKPSLPRNNLRQHLQDNEHAKFLVELLLECKSDEGFA 120

Query: 121 NRMFSEKLITKLEYSVFVNKLLSNTNLKSELTNLIPGTVHTEVLFKLYEIYRDSVVGNAT 180
           NRMFSEKLITKLEYSVFVNKLLSNTNLKSELTNLIPGTVHTEVLFKLYEIYRDSVVGNAT
Sbjct: 121 NRMFSEKLITKLEYSVFVNKLLSNTNLKSELTNLIPGTVHTEVLFKLYEIYRDSVVGNAT 180

Query: 181 LTPVQLYDLNQFIKRFTGDAQLAKAQQVLGFVLENYGSIPRDPQTLINYLELKCGAMPRN 240
           LTPVQLYDLNQFIKRFTGDAQLAKAQQVLGFVLENYGSIPRDPQTLINYLELKCGAMPRN
Sbjct: 181 LTPVQLYDLNQFIKRFTGDAQLAKAQQVLGFVLENYGSIPRDPQTLINYLELKCGAMPRN 240

Query: 241 WSIPLSRPELGKTLGSQSFMSNLAHSYKVLETEALLPLIDEMMKDRAWHYKRNCDLEAAV 300
           WSIPLSRPELGKTLGSQSFMSNLAHSYKVLETEALLPLIDEMMKDRAWHYKRNCDLEAAV
Sbjct: 241 WSIPLSRPELGKTLGSQSFMSNLAHSYKVLETEALLPLIDEMMKDRAWHYKRNCDLEAAV 300

Query: 301 IYSLGYMGQFALLERYIKHTWGXXXXXXXXXXXXXPKNLYPTSNLLISIVSCYAMKGNLH 360
           IYSLGYMGQFALLERYIKHTWG             PKNLYPTSNLLISIVSCYAMKGNLH
Sbjct: 301 IYSLGYMGQFALLERYIKHTWGVSVSSNTSTEVEVPKNLYPTSNLLISIVSCYAMKGNLH 360

Query: 361 QALQIIDSFLSKFPQIELEPLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWHNKQK 420
           QALQIIDSFLSKFPQIELEPLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWHNKQK
Sbjct: 361 QALQIIDSFLSKFPQIELEPLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWHNKQK 420

Query: 421 RSLPIDLGILNERYYVLKRTNNFTEALRIHDEALAGLYMKRNLIDPEVDVIKKFQKLILK 480
           RSLPIDLGILNERYYVLKRTNNFTEALRIHDEALAGLYMKRNLIDPEVDVIKKFQKLILK
Sbjct: 421 RSLPIDLGILNERYYVLKRTNNFTEALRIHDEALAGLYMKRNLIDPEVDVIKKFQKLILK 480

Query: 481 KMAGRGYYHKPLKYISEWCLNKRNELEMREYFDRHRKAYITRIEQRKQKQETAQVTFDAE 540
           KMAGRGYYHKPLKYISEWCLNKRNELEMREYFDRHRKAYITRIEQRKQKQETAQVTFDAE
Sbjct: 481 KMAGRGYYHKPLKYISEWCLNKRNELEMREYFDRHRKAYITRIEQRKQKQETAQVTFDAE 540

Query: 541 EEDDMLLGRLW 551
           EEDDMLLGRLW
Sbjct: 541 EEDDMLLGRLW 551

>KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  400 bits (1029), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 202/475 (42%), Positives = 297/475 (62%), Gaps = 8/475 (1%)

Query: 82  EQIKP--SLPRNNLRQHLQDNEHAKFLVELLLECKSDEGFANRMFSEKLITKLEYSVFVN 139
           EQ+    S P N LR  L   ++  FLVEL L+ + DE F  +MF    ++  E+S F+ 
Sbjct: 80  EQVSSGFSSPCNKLRSFLHSRDYMAFLVELTLQSRMDENFGAKMFQNNDLSIAEFSAFIE 139

Query: 140 KLLSNTNLKSELTNLIPGTVHTEVLFKLYEIYRDSVVGNATLTPVQLYDLNQFIKRFTGD 199
            LLS  NL  +L+  +P    TE++F LY++Y  +V     L+P+QL+D N+FI+ F   
Sbjct: 140 GLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYLKTVTP-GPLSPLQLHDFNKFIRFFIRS 198

Query: 200 AQLAKAQQVLGFVLE-NYGSIPRDPQTLINYLELKCGAMPRNWSIPLSRPELGKTLGSQS 258
           AQL KAQ VL  +L+ N   +P D  T  +YL+L+CGA+PRNW +          LG++ 
Sbjct: 199 AQLRKAQTVLDCILKSNNNQLPCDSATATHYLQLRCGALPRNWKVLDENLGRSTRLGARK 258

Query: 259 FMSNL-AHSYKVLETEALLPLIDEMMKDRA-WHYKRNCDLEAAVIYSLGYMGQFALLERY 316
               L +HSYK L+ +++L  +  +   ++ W ++++  LE+AV+YSLG+MGQ  LLE +
Sbjct: 259 NRYQLVSHSYKALDHKSVLTFMSLLSDPKSVWFHRKSAALESAVVYSLGFMGQLKLLEEH 318

Query: 317 IKHTWGXXXXXXXXXXXXXPKNLYPTSNLLISIVSCYAMKGNLHQALQIIDSFLSKFPQI 376
           +   WG               +  P+S +L+++++ YA   N+  AL +ID F++K+P +
Sbjct: 319 VWRNWGISLQEHNQVTDASFTS--PSSEVLVAVLTSYASNKNISSALHLIDGFMAKYPTL 376

Query: 377 ELEPLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWHNKQKRSLPIDLGILNERYYV 436
           EL+ +FWRRLFQWSTR+W++KTDP+GELS GCW+VM++WH  + R LP D  +LNER+ V
Sbjct: 377 ELDHVFWRRLFQWSTRVWSEKTDPRGELSRGCWRVMREWHAARNRQLPADAVLLNERFVV 436

Query: 437 LKRTNNFTEALRIHDEALAGLYMKRNLIDPEVDVIKKFQKLILKKMAGRGYYHKPLKYIS 496
           L RTNN+ +A+ + ++  +  + K NL   E  + +KF KLILK MA  GYYHKPLK+I 
Sbjct: 437 LSRTNNYRDAIEVVEQCYSSFFQKANLSRHEAVLFQKFAKLILKNMAHLGYYHKPLKFIK 496

Query: 497 EWCLNKRNELEMREYFDRHRKAYITRIEQRKQKQETAQVTFDAEEEDDMLLGRLW 551
           EW  NK  E  +R YF++HR AY  R ++R +  + AQ  FD EEED MLLGRLW
Sbjct: 497 EWSPNKLLEHTLRAYFEKHRNAYSARKQRRTEAAQKAQKRFDDEEEDSMLLGRLW 551

>Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282C
           (AEP2) - basic, hydrophilic 67.5 kDa protein [contig 39]
           FULL
          Length = 546

 Score =  374 bits (960), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 188/464 (40%), Positives = 291/464 (62%), Gaps = 6/464 (1%)

Query: 91  NNLRQHLQDNEHAKFLVELLLECKSDEGFANRMFSEKLITKLEYSVFVNKLLSNTNLKSE 150
           N LR  L   ++ KF++EL ++ K +  F++++F + L+T  E+S  +N LL+  NL ++
Sbjct: 86  NRLRSLLNTKDYIKFMIELTIQSKLNSNFSHKIFEDNLLTPNEFSTLLNGLLTERNLSTK 145

Query: 151 LTNLIPGTVHTEVLFKLYEIYRDSVVGNATLTPVQLYDLNQFIKRFTGDAQLAKAQQVLG 210
           L  ++P    TE++F LY+ Y  ++    +L P+QL+DLN F++ F   AQL KAQ VL 
Sbjct: 146 LETVLPSVQSTEMIFGLYQTYLMTIPA-GSLNPLQLHDLNSFVQYFIETAQLGKAQIVLD 204

Query: 211 FVL-ENYGSIPRDPQTLINYLELKCGAMPRNWSIPLSRPELGKTLGSQSFMSN-LAHSYK 268
            +L  N   +P D  T I+YL+L+CGA+PRNW +  SR      LGS    S  ++H+YK
Sbjct: 205 RILASNNDQLPCDTTTGIHYLQLRCGALPRNWKVFDSRVGHSCRLGSHRNKSQPVSHTYK 264

Query: 269 VLETEALLPLIDEMMKDRA-WHYKRNCDLEAAVIYSLGYMGQFALLERYIKHTWGXXXXX 327
            L+  ++L  ++ +  + + W +K++  LEAAVIYSLG+MGQ  LL+ +I   WG     
Sbjct: 265 ALDQSSVLEFVNVLNDENSEWFHKKSPTLEAAVIYSLGFMGQLTLLKEHIAVRWGITELG 324

Query: 328 XXXXXXXXPKNLYPTSNLLISIVSCYAMKGNLHQALQIIDSFLSKFPQIELEPLFWRRLF 387
                      + P+  +LI+I + +A    +   L+++D+F++K+ +I L+ +FWRRLF
Sbjct: 325 ASLATEV--NEVPPSPEVLIAIFTSFASHQEVTLGLRLMDAFITKYSEINLDIVFWRRLF 382

Query: 388 QWSTRLWNQKTDPKGELSNGCWQVMKQWHNKQKRSLPIDLGILNERYYVLKRTNNFTEAL 447
           QW+  +W+ KTDP+G+LS GCW+VM +WH K  + L  D  +LNERY+VL +TNN+ EAL
Sbjct: 383 QWTNLVWDVKTDPRGDLSRGCWRVMTEWHEKGSKKLQPDTTLLNERYFVLAQTNNYKEAL 442

Query: 448 RIHDEALAGLYMKRNLIDPEVDVIKKFQKLILKKMAGRGYYHKPLKYISEWCLNKRNELE 507
            +  ++   LY K  L   E+ +++K+ KL+LK MA  GYYHKPL +I+EW  NK  E  
Sbjct: 443 TVISQSFPQLYEKPTLSSKEMAIVQKYSKLVLKSMAELGYYHKPLTFITEWSPNKAVEDS 502

Query: 508 MREYFDRHRKAYITRIEQRKQKQETAQVTFDAEEEDDMLLGRLW 551
           +R YF +HR  +  R E+ +++    Q T+D EEED+MLLGRLW
Sbjct: 503 LRVYFKKHRDGFTKRKERLREESRRKQNTYDDEEEDNMLLGRLW 546

>ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282C AEP2 Mitochondrial protein likely
           involved in translation of the mitochondrial OLI1 mRNA
           exhibits genetic interaction with the OLI1 mRNA 5'-
           untranslated leader
          Length = 550

 Score =  338 bits (868), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 184/472 (38%), Positives = 290/472 (61%), Gaps = 17/472 (3%)

Query: 89  PRNNLRQHLQDNEHAKFLVELLLECKSDEGFANRMFSEKLITKLEYSVFVNKLLSNTNLK 148
           P + +R++L++ ++ K L+ L ++   +  + + +F+   +TK EYS+F+NKLLS   L 
Sbjct: 87  PNSKIREYLKNGQYTKLLIRLSVDNHLNNEYISGLFTTGGLTKSEYSLFINKLLSEEELD 146

Query: 149 SELTNLIPGTVHTEVLFKLYEIYRDSVVGNATLTPVQLYDLNQFIKRFTGDAQLAKAQQV 208
            +L+N+IP T HTE+++KLYE Y D +V    LTP+QLYDLN F+K F  +AQL+KA  V
Sbjct: 147 VKLSNVIPDTPHTELIYKLYEFYCDHIVDQHNLTPLQLYDLNLFLKTFIAEAQLSKAHNV 206

Query: 209 LGFVL----ENYGSIPRDPQTLINYLELKCGAMPRNWSI-PLS-RPELGKTLGSQSFMSN 262
           L F+L     N      D + LI +L LKCGA+ + W I P S R     TLG ++   +
Sbjct: 207 LDFILLRRPLNDLLANTDVEILIQFLRLKCGALSKFWKIQPASQRNSTAITLGEKASDCH 266

Query: 263 LAHSYKVLETEALLPLIDEMMKDRAWHYKRNCDLEAAVIYSLGYMGQFALLERYIKHTWG 322
           LA SYK    + LL +I+ ++ +  W  +R+  L+AA+IYSLGY+GQ  L+E+Y+  TW 
Sbjct: 267 LAKSYKFQNEKVLLQIINSVLGEHNWKNRRSPKLDAAIIYSLGYLGQTDLIEKYVNRTWS 326

Query: 323 XXXXXXXXXXXXXPKNLYPTSNLLISIVSCYAMK-GNLHQALQIIDSFLSKFPQIELEPL 381
                             P S+LL+++++ Y +K GN+ + L+++D F+  +P++EL+PL
Sbjct: 327 PSKDEGVKTN--------PNSDLLVAVLTSYCVKEGNMRKGLEVLDRFIRDYPEVELDPL 378

Query: 382 FWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWHNKQKRSLPIDLGILNERYYVLKRTN 441
           FWRRL Q S+ LW++K D K  LS+GCW +MKQWH +++R +P D GI+ E Y +  RT 
Sbjct: 379 FWRRLLQLSSLLWDKKRDRKATLSHGCWTIMKQWHAQRQRKIPYDYGIMKELYPIFVRTK 438

Query: 442 NFTEALRIHDEALAGLYMKRNL-IDP-EVDVIKKFQKLILKKMAGRGYYHKPLKYISEWC 499
           N   AL +  ++  G +++    I P E+ ++ K+Q+ ILK +A +G YHK  ++  EW 
Sbjct: 439 NKNGALEVITKSFFGAFIQPEFTIRPNELSLLCKYQRFILKMIALKGNYHKGFEFCQEWS 498

Query: 500 LNKRNELEMREYFDRHRKAYITRIEQRKQKQETAQVTFDAEEEDDMLLGRLW 551
            +  N+ E++ YF + R  +  R   + +++   Q  +D  EEDDMLLGRLW
Sbjct: 499 FSSTNKFELQSYFMKWRGIHEQRRTSQSKQKAALQEKYDEMEEDDMLLGRLW 550

>TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847
           YMR282C
          Length = 550

 Score =  303 bits (776), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 170/476 (35%), Positives = 286/476 (60%), Gaps = 16/476 (3%)

Query: 85  KPSLPRNNLRQHLQDNEHAKFLVELLLECKSDEGFANRMFSEKLITKLEYSVFVNKLLSN 144
           + ++  N LR++L+  E+  FL+ ++++   +  +   +F  K ++  E+S F+N+LL  
Sbjct: 82  RDTVSTNQLREYLRRKEYVDFLIHVMVQNHLNRNYIKSLFETKELSTSEFSTFINRLLLE 141

Query: 145 TNLKSELTNLIPGTVHTEVLFKLYEIYRDSVVGNAT--LTPVQLYDLNQFIKRFTGDAQL 202
            +L  +L+N+IP TVHTE++F LY+IY   V+ ++   LTP+Q++D+N+FIKRF  +AQL
Sbjct: 142 KDLDLKLSNIIPDTVHTEIIFNLYQIYCTYVIKDSQNGLTPLQVHDINRFIKRFIDEAQL 201

Query: 203 AKAQQVLGFVLENYG--SIPR--DPQTLINYLELKCGAMPRNWSIPLSRPELGKTLGSQS 258
            KAQ+ L F+++  G  +I +  D +T+  +L+L+CGA+ + W +  +     K LG  S
Sbjct: 202 KKAQECLQFLIDKQGLHNILQSGDVETITQFLQLRCGALQKFWRVDSNST---KVLGEDS 258

Query: 259 FMSNLAHSYKVLETEALLPLIDEMMKDRAWHYKRNCDLEAAVIYSLGYMGQFALLERYIK 318
                  SY +L+ +  L +++ ++KD++W  + +  +++A++YSL  +GQ  L+++YI+
Sbjct: 259 KHFKSPKSYNLLKEQPFLEIVNFLLKDKSWRLRSSPIIDSAIVYSLSNLGQTKLIDQYIQ 318

Query: 319 HTWGXXXXXXXXXXXXXPKNLYPTSNLLISIVSCYAMK-GNLHQALQIIDSFLSKFPQIE 377
             WG                  P   +LI+IVS Y +K G+  + L+I+D F+ K+PQ E
Sbjct: 319 LKWGISEDGHVAV----KNEAVPGHEVLINIVSAYCLKNGDTGKGLRILDQFMKKYPQTE 374

Query: 378 LEPLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWHNKQKRSLPIDLGILNERYYVL 437
           LE LFWRRL Q S   W+++ D K  + +GCW +MKQWH ++  S+  D G L   Y + 
Sbjct: 375 LEKLFWRRLLQLSFHNWDKQKDKKALVCHGCWNIMKQWHEQKGVSITYDSGTLRLLYQLF 434

Query: 438 KRTNNFTEALRIHDEALAGLYMKR--NLIDPEVDVIKKFQKLILKKMAGRGYYHKPLKYI 495
           K T N   A  +     + +Y K+   +   E+D++  FQKL LK MA +G Y++PL+ I
Sbjct: 435 KFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLMFQKLALKTMALKGRYNEPLQLI 494

Query: 496 SEWCLNKRNELEMREYFDRHRKAYITRIEQRKQKQETAQVTFDAEEEDDMLLGRLW 551
            EW ++K N+  + +YF RHR+ Y    ++ + KQ+  Q  +D  EE+DMLLGRLW
Sbjct: 495 KEWNVDKINQHYLLDYFMRHRRKYDLTRDKARAKQQQQQAQYDNMEEEDMLLGRLW 550

>Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..5995)
           [1701 nt, 567 aa]
          Length = 566

 Score =  256 bits (653), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 151/489 (30%), Positives = 261/489 (53%), Gaps = 26/489 (5%)

Query: 88  LPRNNLRQHLQDNEHAKFLVELLLECKSDEGFANRMFSEKLITKLEYSVFVNKLLSNT-- 145
           LP N  R +L++NE  KF + LL   + D+ F   +F    +T  E S+F+N++  +   
Sbjct: 79  LPENIWRNYLKNNEIDKFTLHLLASLRGDDDFVKNLFKSGDLTYNELSIFINRIYKSNGH 138

Query: 146 NLKSELTNLIPGTVHTEVLFKLYEIYRDSV---VGNATLTPVQLYDLNQFIKRFTGDAQL 202
           ++K  + N      +TE++++++E+Y  ++    G   L  + L DLN FI  F  +AQL
Sbjct: 139 DIKRVIQNH-HSLSYTELIYEIFELYTSTIPKESGIIKLNALHLKDLNLFITIFIKEAQL 197

Query: 203 AKAQQVLGFVLENYGSIPR--DPQTLINYLELKCGAMPRNWSIPLSRPELGKT------L 254
           +KAQ VL ++++  GSI +  D  T++N+L L+CG +P+ W +P +   + K       L
Sbjct: 198 SKAQNVLQYIIDAEGSIEKITDHDTMVNFLRLRCGGLPKFWLVPQASYAVTKQTKKNSRL 257

Query: 255 GSQSFMSNLAHSYK-VLETEALLPLIDEMMKDRAWHYKRNCDLEAAVIYSLGYMGQFALL 313
            S S  +    SYK  +    L  +I+ ++  + W  K +  L++ ++YSL +  Q  ++
Sbjct: 258 SSNSPNTRFPSSYKSTVPNTVLFEVINMILNKKVWKSKHSGILDSTIVYSLAHTFQKQMM 317

Query: 314 ERYIKHTWGXXXXXXXXXXXXXPKNLY--PTSNLLISIVSCYAMKG-NLHQALQIIDSFL 370
           + +IK  WG              K +   P++ +LI+I+S Y  K  N+  A++I+D F+
Sbjct: 318 DGFIKEHWGISSHGDPLDLFIKKKKVASAPSNEILIAIMSSYIYKDRNIDGAMKILDKFI 377

Query: 371 SKFPQIELEPLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWHNK---QKRSLPIDL 427
             +P I L+ +FWRRL QW  RLW+ K D +G    GCW +MK W+     +   LP D 
Sbjct: 378 RMYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTFGYGCWNMMKNWNGAGTGKDVVLPYDF 437

Query: 428 GILNERYYVLKRTNNFTEALRIHDEALAGLYMKRNLI--DPEVDVIKKFQKLILKKMAGR 485
            I  E Y + KRTNN   A  I    L     ++N+     E++++ K+Q L +  +  R
Sbjct: 438 QIYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNVAVKKAELNLLNKYQTLAMNWLIER 497

Query: 486 GYYHKPLKYISEWCLNKRNELEMREYFDRHRKAYITRIEQRKQK---QETAQVTFDAEEE 542
             + K   +I EW +++ N +++RE F + ++  + ++  R +K   Q+  Q  +D  EE
Sbjct: 498 RQFKKAAFFIEEWSIDRNNRIQLREAFKKRKQLMLRKLSTRDKKSQSQKKRQDRYDEMEE 557

Query: 543 DDMLLGRLW 551
           +DM++GRLW
Sbjct: 558 EDMIIGRLW 566

>Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {ON}
           similar to Ashbya gossypii ABL119C
          Length = 527

 Score =  213 bits (542), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 115/410 (28%), Positives = 216/410 (52%), Gaps = 8/410 (1%)

Query: 133 EYSVFVNKLLSNTNLKSELTNLIPGTVHTEVLFKLYEIYRDSVV--GNATLTPVQLYDLN 190
           E+S+F N+LL  +     L   IP  +   +  KLY+ Y   +        TP++L+DLN
Sbjct: 101 EFSIFFNRLLPTSGSSFSLKEAIPENMVVPLANKLYQFYMAILEREKKTRFTPMELHDLN 160

Query: 191 QFIKRFTGDAQLAKAQQVLGFVLENYGS--IPRDPQTLINYLELKCGAMPRNWSIPLSRP 248
           +F   F  + +L  A++VL  +L   GS  +PRD QTL+ Y +L  G++   W  P  + 
Sbjct: 161 KFSNWFLNENKLKLARKVLQQILRQTGSEQLPRDHQTLVTYFQLYLGSLASLWPTPKVQS 220

Query: 249 ELGKTLGSQSFMSNLAHSYKVLETEALLPLIDEMMKDRAWHYKRNCDLEAAVIYSLGYMG 308
                L   S        Y  L    +  ++ +++++  W + R+ +L+A ++YSL +  
Sbjct: 221 ACYDKLVRGSRRPKYV-VYNSLPEGIMYDVLQKLLENDDWKHLRSSELDAKILYSLCHYN 279

Query: 309 QFALLERYIKHTWGXX---XXXXXXXXXXXPKNLYPTSNLLISIVSCYAMKGNLHQALQI 365
           +  L E +++  WG                    YP S +LI+IV+ ++ + +L +A+++
Sbjct: 280 RMDLFEGFMERAWGIVDHPKKVEKEVPVDISSGTYPGSEVLIAIVTSFSYRNDLEKAVRL 339

Query: 366 IDSFLSKFPQIELEPLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWHNKQKRSLPI 425
           +D+FL+K+PQ++L   FW +LF W+  ++++K DP G L   CW  M  W+  +  S+P 
Sbjct: 340 VDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPLGSLQKACWLRMLSWYKSRGESVPY 399

Query: 426 DLGILNERYYVLKRTNNFTEALRIHDEALAGLYMKRNLIDPEVDVIKKFQKLILKKMAGR 485
              + + RY +LK+T+N+ +A+ +  + ++ +Y K       + V++K+QK ++++++ R
Sbjct: 400 SSYLASCRYEILKQTSNYKDAMAMFPDYMSAVYAKSAAAKHNLTVVRKYQKFVIRELSAR 459

Query: 486 GYYHKPLKYISEWCLNKRNELEMREYFDRHRKAYITRIEQRKQKQETAQV 535
           G      ++I +W  N+ NE E+++ F RH   Y  R E+R+      Q+
Sbjct: 460 GKRDACTQFIEQWRFNEENEKELQDTFQRHWNKYTIRQEKRRSSARNKQL 509

>Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {ON}
           YMR282C (REAL)
          Length = 580

 Score =  214 bits (544), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 132/419 (31%), Positives = 226/419 (53%), Gaps = 31/419 (7%)

Query: 160 HTEVLFKLYEIY-------RDSV-VGNATLTPVQLYDLNQFIKRFTGDAQLAKAQQVLGF 211
           ++E  FKL+ +Y       RD V + N  L   +++DLN  IK F    QL+KAQ++L F
Sbjct: 166 YSEFWFKLFSLYAEKVDTRRDQVNLRNTALDSCEIFDLNLLIKNFIELGQLSKAQKILSF 225

Query: 212 VLENYGSI---PR--DPQTLINYLELKCGAMPRNWSIP----LSRPELGKT--LGSQSFM 260
           +L+    I   PR  D  T++++L+L+CGA+   W IP      + +L +   LG+++  
Sbjct: 226 ILDRNPDILLSPRNADIGTIVHFLQLRCGALTAYWKIPDNSGRKQNQLRRMVRLGAKNTS 285

Query: 261 SNLAHSYKVLETEALLPLIDEMMKDRAWHYKRNCDLEAAVIYSLGYMGQFALLERYIKHT 320
             L+ +YK ++ + LL + D +++D+   +  + DL + +I S G++GQ  +LER I+H 
Sbjct: 286 IRLSSTYKAMDHQTLLKIADLVLQDK--RFLNSEDLLSTLIQSFGHLGQTQILERCIEHI 343

Query: 321 WGXXXXXXXXXXXXXPKNLYPTSNLLISI-VSCYAMKGNLHQALQIIDSFLSKFPQIELE 379
           W              P+  YP+S +LISI VS +    +LH+ L I+DSF+  +P+++L+
Sbjct: 344 WQISSQEFPSHVAIKPRGCYPSSKILISILVSFHLNDKDLHRGLSILDSFIKHYPEVKLD 403

Query: 380 PLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWHNKQKRSLPIDLGILNERYYVLKR 439
            LFWRRL Q S   W    D +      CW +MK W+  ++ S  +D   L + Y V+K+
Sbjct: 404 ALFWRRLLQLSHFAWTPVNDKRAASIVKCWHLMKHWYESKELSPSVDYETLRQLYEVMKK 463

Query: 440 TNNFTEALRIHDEALAGLYMKRNLIDPEV--DVIKKFQKLILKKMAGRGYYHKPLKYISE 497
           T NF+  + +     +G+   R   +PE    ++ K+QK I+K++  RG      K+I +
Sbjct: 464 TGNFSLGIDVLKSFKSGIEKMRT-ANPEKLEAILIKYQKCIIKQLVNRGKISAARKFIGD 522

Query: 498 WCLNKRNELEMREY-----FDRHRKAYITRIEQRKQKQETAQVTFDAEEEDDMLLGRLW 551
           +  N+R   ++  +     F R +K     IE +K++   A   +D +E+D M++G LW
Sbjct: 523 FGFNRRAAKDLNIFCSNRIFSRSKKIK-NDIENKKKRDGLAPGNYDDDEDDGMIIGSLW 580

>TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}
           Anc_8.847 YMR282C
          Length = 569

 Score =  213 bits (542), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 142/484 (29%), Positives = 239/484 (49%), Gaps = 39/484 (8%)

Query: 93  LRQHLQDNEHAKFLVELLLECKSDEGFANRMFSEKLITKLEYSVFVNKLLSNTNL--KSE 150
           L Q LQ N+++   +  LLE K              +T  E+S+F+N+L+        S 
Sbjct: 100 LEQLLQHNDNSYMFLRELLESKQ-------------LTFNEFSIFLNRLIDRKGFIYDSI 146

Query: 151 LTNLIPGTVHTEVLFKLYEIYRDSVVGNATLTPVQLYDLNQFIKRFTGDAQLAKAQQVLG 210
           +    P   H+E++FKL+++Y +++ G+  L+ + L D+N FI+ F  +  L +A+ VL 
Sbjct: 147 VLKEFPNGKHSEMVFKLFQLYGNAI-GSDKLSLLSLRDMNLFIEFFINEGHLGRAEIVLT 205

Query: 211 FVLENYGSIPR--DPQTLINYLELKCGAMPRNWSIPLSRPELG------------KT-LG 255
           FVL    SI    D  T+ +YL+L+CGA+PR W       EL             KT LG
Sbjct: 206 FVLNKTRSILDLYDVDTVTHYLQLRCGALPRYWMFQNKSAELAYKDKFGNRLSKYKTRLG 265

Query: 256 SQSFMSNLAHSYKVLETEALLPLIDEMMKDRAWHYKRNCDLEAAVIYSLGYMGQFALLER 315
            ++F   L + YK+L+   +L + ++++ D  W    +  L+A V+YSL Y GQ + +  
Sbjct: 266 RKNFAVKLTNRYKILDPLGVLKIANKIITDDKWKSNHSAKLDATVVYSLCYSGQLSNIPS 325

Query: 316 YIKHTWGXXXXXXXXXXXXXPKNLYPTSNLLIS-----IVSCYAMKG-NLHQALQIIDSF 369
           YI   W               +     S  L S     I+S Y+    ++ +A+ IID  
Sbjct: 326 YINSRWNVDISMSDGNSDVGTQISNEASKPLPSEVMEAILSSYSYDDKSIERAINIIDKI 385

Query: 370 LSKFPQIELEPLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWHNKQKRSLPIDLGI 429
           ++ +P +EL   FWRRL QWS   W+ K D KG L  GC++ +K++H  +   +  D G+
Sbjct: 386 MNSYPNLELNQQFWRRLMQWSVLCWDHKLDRKGSLVYGCFKTLKKYHEMRSIRINFDEGL 445

Query: 430 LNERYYVLKRTNNFTEALRIHDEALAGLYMKRN--LIDPEVDVIKKFQKLILKKMAGRGY 487
           L E Y ++  T N   A  +  E +   + KR+  +   E  ++  FQK  +  M G+  
Sbjct: 446 LQELYTLVYYTKNSRIAAEVVSEFMPQFFYKRSDEITFGERKLLFYFQKRSIDGMLGKKD 505

Query: 488 YHKPLKYISEWCLNKRNELEMREYFDRHRKAYITRIEQRKQKQETAQVTFDAEEEDDMLL 547
           Y     +I +W ++ +N+ E+ +Y+       + ++ +   +Q+  +   D  +EDD LL
Sbjct: 506 YFTASNFIEKWSMDNQNKEELFKYYKDSIAKKLQKVRRNSLQQKIKEKLEDHSDEDDTLL 565

Query: 548 GRLW 551
           GRLW
Sbjct: 566 GRLW 569

>Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {ON}
           YMR282C (REAL)
          Length = 576

 Score =  212 bits (539), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 125/423 (29%), Positives = 223/423 (52%), Gaps = 39/423 (9%)

Query: 160 HTEVLFKLYEIYRDSV--------VGNATLTPVQLYDLNQFIKRFTGDAQLAKAQQVLGF 211
           ++E  FK++ +Y + V        + N TL   +++D+N  I+ F    QL KAQ++L F
Sbjct: 162 YSEFWFKIFSLYAEKVDAKRNHINLRNTTLDACEIFDINLLIRNFIELGQLGKAQKILTF 221

Query: 212 VLENYGSIPRDPQ-----TLINYLELKCGAMPRNWSIPLSRPELGKTL------GSQSFM 260
           +++    I   P      T++++L+L+CGA+   W IP +  +  K L      G+++  
Sbjct: 222 IIDRNPDILLSPNNADIGTMVHFLKLRCGALAAYWKIPDNSGQDQKQLRKIVRLGAKNTS 281

Query: 261 SNLAHSYKVLETEALLPLIDEMMKDRAWHYKRNCDLEAAVIYSLGYMGQFALLERYIKHT 320
             L+ +YKV++ + LL + D ++ ++   +  + DL + +I S G++GQ  +LER I+H 
Sbjct: 282 IRLSSTYKVMDHQTLLKIADLVLHEK--RFLNSEDLLSTLIQSFGHLGQTQILERCIEHI 339

Query: 321 WGXXXXXXXXXXXXXPKNLYPTSNLLISI-VSCYAMKGNLHQALQIIDSFLSKFPQIELE 379
           W              P+  YP+S +LISI VS +    +LH+ L I+DSF+  +P+++L+
Sbjct: 340 WHITTQEFPSHVAIKPRGCYPSSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLD 399

Query: 380 PLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWHNKQKRSLPIDLGILNERYYVLKR 439
            LFWRRLFQ S   W    D K      CW +MKQWH  +  SL +D   L + Y ++K+
Sbjct: 400 ALFWRRLFQLSNFAWTPAKDKKATSVIRCWHLMKQWHVSKGLSLSVDYETLRQLYDIMKK 459

Query: 440 TNNFTEALRIHDEALAGLYMKRNLIDPEVDVI-KKFQKLILKKMAGRGYYHKPLKYISEW 498
           T NF   + +     +G+   R     +++++  K+QK I+K++  RG      ++I+++
Sbjct: 460 TGNFPLGIDVLKSFKSGIERLRETNSDKLNIVLIKYQKYIIKQLVDRGRISAVREFINDF 519

Query: 499 CLNK----------RNELEMREYFDRHRKAYITRIEQRKQKQETAQVTFDAEEEDDMLLG 548
             ++           N L +R       K   ++IE +K++ +     FD +E+D M++G
Sbjct: 520 GFDRTITKNLNIFCTNRLLLRS------KKNKSKIENKKERNKLEPSGFDDDEDDGMIIG 573

Query: 549 RLW 551
            LW
Sbjct: 574 SLW 576

>Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {ON}
           YMR282C (REAL)
          Length = 581

 Score =  189 bits (481), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 123/420 (29%), Positives = 216/420 (51%), Gaps = 33/420 (7%)

Query: 160 HTEVLFKLYEIYRDSV--------VGNATLTPVQLYDLNQFIKRFTGDAQLAKAQQVLGF 211
           ++E  FKL+ +Y + V        + N  L   +++D+N  IK F    QL KAQ+VL F
Sbjct: 167 YSEFWFKLFSLYAEKVDVKRNQINLRNTALDSSEIFDMNLIIKNFIELGQLGKAQKVLSF 226

Query: 212 VLENYGSIPRDPQ-----TLINYLELKCGAMPRNWSIP------LSRPELGKTLGSQSFM 260
           +L+    I   P+     T+I++L+L+CGA+   W +P       SR  +   LG+++  
Sbjct: 227 ILDRNSDILLSPKNADIGTIIHFLQLRCGALAAYWKMPDNSEQKYSRKMV--RLGAKNTS 284

Query: 261 SNLAHSYKVLETEALLPLIDEMM-KDRAWHYKRNCDLEAAVIYSLGYMGQFALLERYIKH 319
             +  SYK ++ + LL + D ++ K+R  + +   DL + +I S G++GQ  +LER I+H
Sbjct: 285 IRITSSYKAMDHQTLLKIADLVLQKERLLNSE---DLLSTLIQSFGHLGQTQILERCIEH 341

Query: 320 TWGXXXXXXXXXXXXXPKN--LYPTSNLLISIVSCYAMKGN-LHQALQIIDSFLSKFPQI 376
            W              PK     P+S +LISI+  + +  N LH+ L I+DSF+  +P++
Sbjct: 342 IWQISLQEFPSHATIKPKTRGCCPSSKILISILVSFHLNDNDLHRGLSILDSFIKHYPEV 401

Query: 377 ELEPLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWHNKQKRSLPIDLGILNERYYV 436
           +++ LFWRRLFQ S   W    D +      CW +MKQWH  +  SL +D   L + Y +
Sbjct: 402 KVDELFWRRLFQLSHFAWTPTHDKRATSIVRCWHLMKQWHESKGFSLSVDYETLRQLYDL 461

Query: 437 LKRTNNFTEALRIHDEALAGLYMKRNLIDPEVD-VIKKFQKLILKKMAGRGYYHKPLKYI 495
            K+T N++  + +      G+     +   +++ ++ K QK I+K++  RG      ++I
Sbjct: 462 TKKTGNYSLGIDVLQNFKPGITRTSAMKTEKINGIVIKHQKYIIKQLVNRGKTSAAREFI 521

Query: 496 SEWCLNKRNELEMREYFDR----HRKAYITRIEQRKQKQETAQVTFDAEEEDDMLLGRLW 551
           +++  +     E+  +         K    + E RK++  + Q  FD +++D M++G LW
Sbjct: 522 NDFSFDIGAVKELNVFCTNRILLRSKKLKNKTENRKERNRSGQGNFDDDDDDGMVIGSLW 581

>YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON}
           AEP2Mitochondrial protein, likely involved in
           translation of the mitochondrial OLI1 mRNA; exhibits
           genetic interaction with the OLI1 mRNA 5'-untranslated
           leader
          Length = 580

 Score =  188 bits (478), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 125/418 (29%), Positives = 217/418 (51%), Gaps = 29/418 (6%)

Query: 160 HTEVLFKLYEIYRDSV--------VGNATLTPVQLYDLNQFIKRFTGDAQLAKAQQVLGF 211
           ++E  FKL+ +Y + V        + N  L   +++D N  IK F    QL KAQ++L F
Sbjct: 166 YSEFWFKLFSLYAEKVDAKRNQVNLRNTKLDACEIFDANLMIKNFIELGQLGKAQKILSF 225

Query: 212 VLENYGSIPRDPQ-----TLINYLELKCGAMPRNWSIPLSRPE----LGKT--LGSQSFM 260
           +L+    I   P+     T++++L+L+CGA+   W IP +  +    L K   LG+++  
Sbjct: 226 ILDRNPDILLSPKNADISTIVHFLQLRCGALAPYWKIPDNSEQKQGFLRKMVRLGAKNTS 285

Query: 261 SNLAHSYKVLETEALLPLIDEMMKDRAWHYKRNCDLEAAVIYSLGYMGQFALLERYIKHT 320
             L+ +YK ++ + LL + D  ++++        DL + +I S G++GQ  +LER I+H 
Sbjct: 286 IRLSSTYKAMDHQTLLKIADLALQEKKLLNSE--DLLSTLIQSFGHLGQTQILERCIEHI 343

Query: 321 WGXXXXXXXXXXXXXPKNLYPTSNLLISI-VSCYAMKGNLHQALQIIDSFLSKFPQIELE 379
           W               +  YP+S +L+SI VS Y    +LH+ L I+DSF+  +P ++L+
Sbjct: 344 WQISPQEFPSHVVIKHRGCYPSSKILVSILVSFYFNDHDLHRGLSILDSFIKHYPDVKLD 403

Query: 380 PLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWHNKQKRSLPIDLGILNERYYVLKR 439
            LFWRRLFQ S   W    D K      CW +MKQW+  ++    +D   L + Y ++K+
Sbjct: 404 ALFWRRLFQLSHFAWTPANDKKATSVVRCWHLMKQWYASKRLRPSVDYETLRQLYDIMKK 463

Query: 440 TNNFTEALRIHDEALAGLYMKRNLIDPEV-DVIKKFQKLILKKMAGRGYYHKPLKYISEW 498
           T NF   + +      G+   R     +V ++I K+QK I+K++  RG +    ++I  +
Sbjct: 464 TGNFPLGIDVLRSFKPGIERTRAENAGKVNNIIIKYQKCIIKELVNRGRFSAVREFIDSY 523

Query: 499 CLNKR-----NELEMREYFDRHRKAYITRIEQRKQKQETAQVTFDAEEEDDMLLGRLW 551
             +++     N       F R +K    +IE +K++++    +FD +E+D M++G LW
Sbjct: 524 GFDRKMTKDLNIFCANRMFLRSKKMK-NKIENKKEREKVRLDSFDDDEDDGMIIGSLW 580

>KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 518

 Score =  180 bits (457), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 127/430 (29%), Positives = 202/430 (46%), Gaps = 27/430 (6%)

Query: 124 FSEKLITKLEYSVFVNKLLSNTNLKSELTNLIPGTVHTEVLFKLYEIYRDSVV-----GN 178
           +S + +T  +YSVFVN+L+   +   EL N       TEV   LY IYR  VV     GN
Sbjct: 92  YSNEKLTPEDYSVFVNQLMDVYSKDIELLN------KTEVWKSLYHIYRVFVVNAVDDGN 145

Query: 179 ATLTPVQLYDLNQFIKRFTGDAQLAKAQQVLGFVLENY--GSIPRDPQTLINYLELKCGA 236
           A +    LYDLNQF++ F     L  A+ V   +L+N   G IP+D QT+  YL L CGA
Sbjct: 146 AMV----LYDLNQFVRMFINLNDLPLARNVFQLILKNSKNGEIPKDVQTICMYLRLYCGA 201

Query: 237 MPRNWSIPLSRPELGKTLGSQSFMSNLAH-------SYKVLETEALLPLIDEMMKDRAWH 289
           +   W+   SR      +GS S  SN +        +Y  +       L+ ++++D  + 
Sbjct: 202 LSELWTTQTSRNFYQDLIGSLS-GSNASSIRIPSHIAYPTIGVPQFQLLLRKLVEDPEYS 260

Query: 290 YKRNCDLEAAVIYSLGYMGQFALLERYIKHTWGXXXXXXXXXXXXXPKNLYPTSNLLISI 349
             RN ++++ +I +LG+  +   L++YI   +G              K L P S LL S+
Sbjct: 261 KLRNTEMDSLIIQALGHYKEVPFLKQYISIFYGIDENVTITETHPGIKKLTPDSQLLKSV 320

Query: 350 VSCYAMKGNLHQALQIIDSFLSKFPQIELEPLFWRRLFQWSTRLWNQKTDPKGELSNGCW 409
           +S Y    N+   + +I SF+ K+P++ L+  FWR    WS R WN+  D KG      W
Sbjct: 321 ISAYGHNNNITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNKYKDSKGSQPKKAW 380

Query: 410 QVMKQWHNKQKRSLPIDLGILNERYYVLKRTNNFTEALRIHDEALAGLYMK--RNLIDPE 467
            +M  W+    +++P D  I+  R   LK   +   A+R   +    +++K  +N    E
Sbjct: 381 NLMLNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFKRIFIKTEKNTFIVE 440

Query: 468 VDVIKKFQKLILKKMAGRGYYHKPLKYISEWCLNKRNELEMREYFDRHRKAYITRIEQRK 527
             V+  +Q+ I+K +  +    K + +I+EW ++  N   +  YF           EQ+K
Sbjct: 441 RLVLYAYQRFIIKNLVNQNENAKCVDFINEWRIDFENGRYLERYFKELTHPKNESDEQKK 500

Query: 528 QKQETAQVTF 537
              E     F
Sbjct: 501 LNDEDDDYNF 510

>CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282c AEP2 required for the expression of
           subunit-9 of atp synthase
          Length = 548

 Score =  160 bits (406), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 139/467 (29%), Positives = 219/467 (46%), Gaps = 49/467 (10%)

Query: 116 DEGF---ANRMFSEKLITKLEYSVFVNKLLSNTNLKSELTNLIPGTVHTEVLFKLYEIYR 172
           DEG    A ++  +  ++  E+S  +  +L+ TNL         G  H   L KL +IY 
Sbjct: 100 DEGSVEDAIQLLQDSNVSIQEFSSMIQPVLNRTNL--------VGKYHMGYLSKLMQIYI 151

Query: 173 D--SVVGNATLTPVQLYDLNQFIKRFTGDAQLAKAQQVLGFVLENYGSIPRD-------P 223
                    ++  +   D+N+FIKRF   +QL +AQ  L F+L+ Y     D        
Sbjct: 152 SLTRTHNGGSVDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDK 211

Query: 224 QTLINYLELKCGAMPRNWSIPLS-----RPELGKTLGSQSFMSNLAHSYKVLETEALLPL 278
           QT+ ++L L+ GA+   W I +S     +    K  GS     N+  +Y VL++  L  +
Sbjct: 212 QTIAHFLMLRSGALQDLWKIDVSNGNNKKQAFYKINGSHR---NVKSTYNVLDSVKLFEI 268

Query: 279 IDEMMK--DRAWHYKR---NCDLEAAVIYSLGYMGQFALLERYIKHTWGXXXXXXXXXXX 333
           +  +++  D+  H +    +  +   VI  LGY+GQ  L+E  I   W            
Sbjct: 269 VRYILRYNDKDNHSQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIW------ELDSVS 322

Query: 334 XXPK-NLYPTSNLLISIVSCYAMKG-NLHQALQIIDSFLSKFPQIELEPLFWRRLFQWST 391
             PK N+  TS+LL +IVS Y+  G ++   L I D F  K P I ++  FW  L +W+ 
Sbjct: 323 VPPKYNITVTSDLLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNI 382

Query: 392 RLWNQKTDPKGELSNGCWQVMKQWHNKQKRS--LPIDLGILNERYYVLK----RTNNFTE 445
            L N K     +LS   W++MK W N       +  ++  LN  Y VL     +  +   
Sbjct: 383 ILPN-KWRSTIDLSKRTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEW 441

Query: 446 ALRIHDEALAGLYMKRNLIDPEVDVIKKFQKLILKKMAGRGYYHKPLKYISEWCLNKRNE 505
              I   +L  LY K +L   E+ ++KKFQ   +KKM   G+Y K L++I EW  +  N+
Sbjct: 442 IYDIFQHSLVTLYSKNSLTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANK 501

Query: 506 LEMREYFDRHRKAYITRIEQRKQKQET-AQVTFDAEEEDDMLLGRLW 551
            ++   F   R  Y+ +    ++K+ T  Q  +D EE++DMLLG LW
Sbjct: 502 QQLTNLFVVLRNRYLQKRGYNQEKEMTKVQKKYDEEEQEDMLLGGLW 548

>NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847
           YMR282C
          Length = 495

 Score =  159 bits (402), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 125/431 (29%), Positives = 220/431 (51%), Gaps = 51/431 (11%)

Query: 133 EYSVFVNKLLSNTNLKSELTNLIPGTVHTEVLFKLYEIYRDSVVGNATLTPVQLYDLNQF 192
           EYS+F+ K+LS          +    V+  V+F+L+EIY     G  +L  +Q+YDLN+ 
Sbjct: 104 EYSLFLGKVLS----------MKDSDVNVNVVFQLFEIYARMYCGEGSLNALQIYDLNKL 153

Query: 193 IKRFTGDAQLAKAQQVLGFVLENYGSIP-----RDPQTLINYLELKCGAMPRNWSIPLSR 247
           IK F    QL + Q VL F++  YG I      RD  +L N+L+LK G++ ++W      
Sbjct: 154 IKYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRDLISLNNHLKLKNGSLVKDWKFE--- 210

Query: 248 PELGKTLGS-QSFMSNLAHSYKVLETEALLPLIDEMMKDRAWHYKRNCDLEAAVIYSLGY 306
              GK L   QS    L  +YK L+  +LL + D ++ D     K    L  ++IYSLG+
Sbjct: 211 ---GKNLRYLQSRQGRL--NYKFLDGWSLLKIADLVLNDPM---KCQNVLTNSIIYSLGH 262

Query: 307 MGQFALLERYIKHTWGXXXXXXXXXXXXXPKN--LYPTSNLLISIVSCYAMK-GNLHQAL 363
           + Q  LL+ +I   W              P+N  LYP +N +I+I++ Y    GN+ ++ 
Sbjct: 263 LRQVELLDHFIDQMW---------MQETRPRNGLLYPDTNNIIAIITSYCYNYGNMDKSF 313

Query: 364 QIIDSFLSKFPQIELEPLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWHNKQKRSL 423
            ++D  L K+  ++ +  FWRRLFQW   +  +    KG +   CW +M++    +   +
Sbjct: 314 DVLDRILEKYSGLKFDKFFWRRLFQWC--ILTEPNANKGFILGQCWSLMEKQEKVEFDGV 371

Query: 424 PIDLGILNERYYVLKRTNNFTEALRIHDEALAGLYMKRNLIDP-EVDVIKKFQKLILKKM 482
            ++L  L E+   + +  +   ALR+    +  L  K N I+  +++++ K+QK +  K+
Sbjct: 372 LLEL--LREK---IVKVRDVPLALRVLKMIVIEL-KKVNFINELDMELLLKYQKFVFSKL 425

Query: 483 AGRGYYHKPLKYIS--EWCLNKRNELEMREYFDRHRKAYITRIEQRKQKQETAQVTFDAE 540
                  K ++ +S  ++ +NK N+  MR Y+  +++    + ++  Q  +  Q  +D  
Sbjct: 426 GEINKTVKAMELLSCDDYTINKENKAFMRAYYFENKREKRKKNKRSNQ-YDDLQRKYDEM 484

Query: 541 EEDDMLLGRLW 551
           +E+DM++G+LW
Sbjct: 485 DEEDMIIGKLW 495

>NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON}
           Anc_8.847 YMR282C
          Length = 624

 Score =  158 bits (399), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 153/547 (27%), Positives = 259/547 (47%), Gaps = 97/547 (17%)

Query: 84  IKPSLPRNNLRQHL-----QDNEHAKFLVELLLEC---KSDEGFANRMFSEK-----LIT 130
           +KP++  +  R+ L        ++ K L  +L  C    +++    ++  E      L++
Sbjct: 96  LKPTIHNSKARKGLLHLLLAQKDNGKVLTTILDHCLYSPNEQATTRQLVKENNHLTTLLS 155

Query: 131 KLEYSVFVNKLLSN-TNLKSE-----LTNLIPGTVHT-EVLFKLYEIYRDSVVGNAT-LT 182
             E S+F+ ++L N   + SE     LTN     ++  EV+F L+ I +D    N   L 
Sbjct: 156 HEEMSIFICRVLKNFPTIISEKKYEILTNEGRYELYKPEVIFSLFNICKDEYCNNTNQLN 215

Query: 183 PVQLYDLNQFIKRFTGDAQLAKAQQVLGFVLENYGSI-----PRDPQTLINYLELKCGAM 237
           P+ +YDLNQFIK F  + QL KAQ VL ++++ +G I      +D  TL N+L+LK GA+
Sbjct: 216 PLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGGIEQLIKSKDLTTLDNHLKLKNGAI 275

Query: 238 PRNWSIPLSRPELGKTLGSQSFMSNLAH------SYKVLETEALLPLIDEMMKDRAWHYK 291
            +NW  PL+  E    L  +  + + +H      +YK L+  +LL +ID ++ D     K
Sbjct: 276 YKNWK-PLTDSESNTFLQYRLSLEDKSHNFKGFKNYKFLDGWSLLKIIDMVLTD-----K 329

Query: 292 RNC--DLEAAVIYSLGYMGQFALLERYIKHTWGX--XXXXXXXXXXXXPKNLYPTSNLLI 347
            +C   L  +++YSLG + Q   +E +IK  W                  NL P +N LI
Sbjct: 330 THCLNILNESILYSLGTLRQIEFMEHFIKQIWDVHPDDAVEERNHQLDKYNLPPDTNELI 389

Query: 348 SIVSCYAMK-GNLHQALQIIDSFLSKFPQIELEPL--------FWRRLFQWSTRLWNQK- 397
           +I++ Y     ++ +A  ++D  + K+P    EP+        FW ++ QW  ++ ++  
Sbjct: 390 AILTSYCQTYKSMDRAFLLLDKLIQKYP----EPMKSRLNDNKFWIKMLQWGIKIADKNG 445

Query: 398 TDPKGELSNGCWQVMKQWHNKQKR--------------SLPIDL--GILNERYYV---LK 438
            +  G   + C ++M++W  K K+              S+ I+L   I+ ER  V   LK
Sbjct: 446 NNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSILINLLHNIMKERKNVDIGLK 505

Query: 439 RTNNFTEALRIHDEALAGLYMKRNLIDPEVDVIKKFQKLILKKMAGRGYYHKPLKYISEW 498
              NF + L++        Y +RNL      V+   QK I +K+A  G Y+K L  I   
Sbjct: 506 AIENFVQKLKL---GSVNKYYERNL----THVLYGLQKCIFRKIAESGSYNKGLALIDNG 558

Query: 499 CLNKRNELE--MREYF-----------DRHRKAYITRIEQRKQKQ-ETAQVTFDAEEEDD 544
              + + +E  +REY+            R  KA  + I+ R+Q + E  Q  +D  EE+ 
Sbjct: 559 AYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQ-SNIQDREQDEFEKLQQKYDEIEEEG 617

Query: 545 MLLGRLW 551
           M++G+LW
Sbjct: 618 MIIGKLW 624

>TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {ON}
           Anc_8.847 YMR282C
          Length = 613

 Score =  149 bits (375), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 120/481 (24%), Positives = 231/481 (48%), Gaps = 70/481 (14%)

Query: 102 HAKFLVELLLECKSDEGFANRMFSEKLITKLEYSVFVNKLLSNTNLKSELTNLIPGTVHT 161
           + KF+ EL+     D    N++ ++ L   +  S+ +N L+   + + + ++ +    H+
Sbjct: 125 YKKFVDELIQWHYLDAKALNKLVNKHL-NDMNLSIVINLLVKYNHFQPKDSDRLSFKSHS 183

Query: 162 EVLFKLYEIYRDSVV------------------GNATLTPVQLYDLNQFIKRFTGDAQLA 203
           E++FK+Y+IY + +                    +  L P+QLYDLN+ I  F    QL 
Sbjct: 184 ELIFKVYQIYIERIEHPILNSNNNSHIQSIAEHSSTPLNPIQLYDLNKVITWFIKAGQLK 243

Query: 204 KAQQVLGFVLENYGS----IPRDPQTLINYLELKCGAMPRNWSI-PLSRPEL---GK--- 252
           KA   L ++L+ Y +    IP D +T+IN+L+L CG +P NW I P++   +   GK   
Sbjct: 244 KATTALMYILKRYNAEIFQIP-DSKTIINFLKLYCGGLPTNWRIEPINHRFIKNQGKRSF 302

Query: 253 TLGSQSFMSNLAHSYKVLETEALLPLIDEMMKD--------RAWHYKRNCDLEAAVIYSL 304
            LG+ S    L  SYK +  +  + +++ + K+        + +H+ R  + ++ +IYSL
Sbjct: 303 KLGNNSSYYRLPSSYKAVYEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEFDSTLIYSL 362

Query: 305 GYMGQFALLERYIKHTWGXXXXXXXXXXXXXPKNLYPTSNLLISIVSCYAMKG--NLHQA 362
             +G+F L E+Y K  W                ++  TS+++I+I S Y      N+ +A
Sbjct: 363 TSLGRFDLAEQYFKDNW----------LSDSCDDVELTSDIVIAIFSSYVYNNSNNIEKA 412

Query: 363 LQIIDSFLSKFPQIELEPLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWH------ 416
            ++I   + ++P + L    W R+ +W+ ++W+  TD  GE+    +  M  ++      
Sbjct: 413 NKLIQEIIKRYPDLHLNISTWCRIIRWNIQMWDTTTDFNGEIPYDSFYTMLTYYSNYCSR 472

Query: 417 NKQKRS--LPIDLGILNERYYVLKRTNNFTEALRIHDEALAGLYMK--RNLIDPEVDVIK 472
           N   +S  +P +  +L + Y++     +  + L I D        K    +   +  ++ 
Sbjct: 473 NSTFKSCHIPYNKMLLGDLYHLFNTKISLNKCLFIMDNCFKKSLFKTPSKVTTKDYQILL 532

Query: 473 KFQKLILKKMAG--RGYYHKPLKYISEWCLNKRNELEMREYFDRHRKAYITRIEQRKQKQ 530
           K+QK+ILK +    +   +KPL +I ++ L+  N+ ++ EY        + R+E RK ++
Sbjct: 533 KYQKMILKYLINDRKLTSNKPLDFIEKYSLDTNNKEQLLEY-------RLERLEYRKSRK 585

Query: 531 E 531
           E
Sbjct: 586 E 586

>KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {ON}
           Anc_8.847 YMR282C
          Length = 474

 Score =  145 bits (365), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 100/401 (24%), Positives = 184/401 (45%), Gaps = 51/401 (12%)

Query: 162 EVLFKLYEIYRDSVVGNATLTPVQLYDLNQFIKRFTGDAQLAKAQQVLGF-------VLE 214
           E++F+L+E Y   +  +  LT +Q+ D+N+FI  F    QL KAQ V+ +       VLE
Sbjct: 114 EIIFQLFETYVKLISSHEELTILQVEDMNKFINYFVEFKQLKKAQLVMKYLILKSPRVLE 173

Query: 215 NYGSIPRDPQTLINYLELKCGAMPRNWSIPLSRPELGKTLGSQSFMSNLAHSYKVLE--T 272
            Y     D  T  NYL+L CGA    W                        +YK+ +   
Sbjct: 174 KY-----DVSTTRNYLKLNCGACHELWYT----------------------NYKIFDFNN 206

Query: 273 EALLPLIDEMMKDRAWHYKRNCDLEAAVIYSLGYMGQFALLERYIKHTWGXXXXXXXXXX 332
             L  L+   + ++  ++      +  +I+SLGY G+   LE YI   WG          
Sbjct: 207 TTLDKLVKYSLDNKIGYW------DVEIIHSLGYSGRIRSLEDYILKKWGISLCDRAQVN 260

Query: 333 XXXPKNLYPTSNLLISIVSCYAMKGN-LHQALQIIDSFLSKFPQIELEPLFWRRLFQWST 391
                N  P S +L +I++ +  +   + +A++I++ F++ +P + L+  FW+       
Sbjct: 261 ---TTNEAPESEVLEAIINGFFYRDKRMFRAIKILNEFVNVYPDLNLKITFWKTFMNNCI 317

Query: 392 RLWNQKTDPKGELSNGCWQVMKQWHNKQKRSLPIDLGILNERYYVLKRTNNFTEALRIHD 451
           + W++K D KG +    W+ MK+W+    R +P ++  L       K+ NN   A  I  
Sbjct: 318 KEWDEKVDQKGVVIVEYWETMKRWYTVHNRRIPFNINFLKVMRTCFKKNNNLVLATDIFQ 377

Query: 452 EALAGLYM-KRNLIDPEVDVIKKFQKLILKKMAGRGYYHKPLKYISEWCLNKRNELEMRE 510
                 Y     + D E++VIK++Q  IL ++  +  +   L +I++ C +  N+ ++  
Sbjct: 378 NCFHNFYFCATRMNDSELNVIKEYQNFILSRLIEKKGFSNALTFINDHCFSLENKRQLMN 437

Query: 511 YFDRHRKAYITRIEQRKQKQETAQVTFDAEEEDDMLLGRLW 551
           Y+   ++  + ++     + E  + T+D   E+D ++G+LW
Sbjct: 438 YYHGRKEHKLKKM----TRNENLEKTYDDMVEEDFIIGKLW 474

>KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.847
           YMR282C
          Length = 474

 Score =  144 bits (362), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 109/430 (25%), Positives = 207/430 (48%), Gaps = 49/430 (11%)

Query: 130 TKLEYSVFVNKLLSNTNLKSELTNLIPGTVHTEVLFKLYEIYRDSVVGNAT-LTPVQLYD 188
           T +++SV +N++L++ N +      +    + E  F ++  Y+ ++   +  LT +QL+D
Sbjct: 86  TAMQFSVLLNRVLASQNYRH-----LDSKENVEKFFAIFMRYKGAIALQSNKLTQIQLHD 140

Query: 189 LNQFIKRFTGDAQLAKAQQVLGFVLENYGSIPRDPQTLINYLELKCGAMPRNWSIPLSRP 248
            N     F    QL KAQ ++ F+L+    +  D   + NY +L+CG+            
Sbjct: 141 FNLMCDYFIACNQLKKAQLIMDFLLQQ--DVKFDVFMIKNYTKLRCGS------------ 186

Query: 249 ELGKTLGSQSFMSNLAHSYKVLETEALLPLIDEMMKDRAWHYKRNCDLEAAVIYSLGYMG 308
               + G Q+  +    +YKV +   +  LI ++  DR + +  N      ++ SLGY  
Sbjct: 187 ----SFGKQTLNNK---AYKVFDQNTVFQLIGKVEADRKFAFWNN-----EIVSSLGYTN 234

Query: 309 QFALLERYIKHTW-----GXXXXXXXXXXXXXPKNLYPTSNLLISIVSCYAMKG-NLHQA 362
              L+E YI   W                      +YP+S +L +IVS YA     + +A
Sbjct: 235 NITLMEIYIWDLWRISIHDHSTENIKIDHLQQGDAMYPSSKVLATIVSSYARHDQTMKRA 294

Query: 363 LQIIDSFLSKFPQIELEPLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWHNKQKRS 422
           + I++ F   +P++ L   FW  L   + +    K DP   L+  CW +MK+WH ++ + 
Sbjct: 295 VDIVERFAKSYPKLLLNVHFWSTLLNCAIKCGGSK-DPSQFLA--CWNLMKKWHTQRSKL 351

Query: 423 LPIDLGILNERYYVLKRTNNFTEALRIHDEALAGLYMKR-NLIDPEVDVIKKFQKLILKK 481
           +P    +L      +++T+N    + I    L  LY+KR N+ + E DV+ K+QK IL+K
Sbjct: 352 MPFQSALLVTILRYMRQTSNLHGTVDILQYWLGPLYLKRGNIPEFERDVLIKYQKQILRK 411

Query: 482 MAGRGYYHKPLKYISEWCLNKRNELEMREYFDRHRKAYITRIEQRKQKQETAQVTFDAEE 541
           +  +  Y+    +I +W ++  N+ ++  +++       +R++ R+ K    +   D ++
Sbjct: 412 LVDKRKYNWCTAFIDQWSIDASNKEDLEAFYE-------SRVDVRESKTRREKAYDDMDD 464

Query: 542 EDDMLLGRLW 551
           ++DM++GRLW
Sbjct: 465 DEDMIIGRLW 474

>ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR282C
           (AEP2)
          Length = 537

 Score =  104 bits (259), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 94/398 (23%), Positives = 173/398 (43%), Gaps = 19/398 (4%)

Query: 124 FSEKLITKLEYSVFVNKLLSNTNLKSELTNLIPGTVHTEVLFKLYEIYR----DSVVGNA 179
            SE L  +  +SVF+++LL      S+L +L+       +L KLY  YR    D+ +G  
Sbjct: 123 LSELLSQEEGFSVFIHRLLPTYTPSSDLKHLVSKDGTIALLQKLYGFYREQFADAPIGRP 182

Query: 180 TLTPVQLYDLNQFIKRFTGDAQLAKAQQVLGFVLEN---YGSIPRDPQTLINYLELKCGA 236
           +  P +L+D N F + F  +++L  A+ V   ++ N      +PRD +T+I  L+L  GA
Sbjct: 183 S--PGRLHDANSFARWFMAESKLRLARTVFAELVGNPTELAKLPRDTETIITLLQLHLGA 240

Query: 237 MPRNWSIPLSRPELGKTLGSQSFMSNLAHSYKVLETEALLPLIDEMMKDRAWHYKRNCDL 296
               W  P +    G  L + + M+ +  +Y  L  E LL L+  +  D  W    + DL
Sbjct: 241 KHIFWRDPGNSVGRGGQLFTPAHMA-VVTAYNSLGEETLLRLLRLLQSDPQWKSVCSPDL 299

Query: 297 EAAVIYSLGYMGQFALLERYIKHTWGXXXXXXXXXXXXXPKN-LYPTSNLLISIVSCYAM 355
           +  +I +L +  +  L+     H                P   L P   L+ ++V+ +A 
Sbjct: 300 DRNIILALAFHNRLDLV-----HAQAARYYAPAAPGHGLPSTPLLPDGALVGAVVTAFAF 354

Query: 356 KGNLHQALQIIDSFLSKFPQIELEPLFWRRLFQWSTRLWNQKTDPKG-ELSNGCWQVMKQ 414
           K  L Q L I   FL +F  +  E   W+ +F W  R     T  +G  L +  W  M+ 
Sbjct: 355 KHQLAQGLAIAYQFLDRFTHLPNEHELWKIIFTWLAR--RHPTGSQGAALYDEAWSKMRT 412

Query: 415 WHNKQKRSLPIDLGILNERYYVLKRTNNFTEALRIHDEALAGLYMKRNLIDPEVDVIKKF 474
            + +  +  P D  I    Y +++R ++      + ++ ++ LY +  +   +  ++ K 
Sbjct: 413 RYAEHGQPTPYDYSIARASYRIVRRDSSLRRVRALLNDYMSPLYQQPAVAPRDRLLLLKC 472

Query: 475 QKLILKKMAGRGYYHKPLKYISEWCLNKRNELEMREYF 512
           Q  I+ ++           ++ +W L+      + E+ 
Sbjct: 473 QAHIVGRLVRARRNSAAADFVDQWALDSEARSHLLEHI 510

>Kwal_34.16035 s34 (169267..172725) [3459 bp, 1152 aa] {ON} YJR041C
           - Protein required for cell viability [contig 271] FULL
          Length = 1152

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 7/64 (10%)

Query: 263 LAHSYKVL----ETEALLPLIDEMMKDRAWHYKRNCDLEAAVIYSLGYMGQFALLERYIK 318
           LAH Y VL    E+  + P +D+++KD A HYKR  DL  +++     +G F+     I 
Sbjct: 843 LAH-YVVLRERVESSMIYPALDQLIKDSASHYKRFNDLFYSLLLCFKDLGGFSACS--IF 899

Query: 319 HTWG 322
             WG
Sbjct: 900 EIWG 903

>SAKL0B04334g Chr2 complement(388170..388406,388471..388497) [264
           bp, 87 aa] {ON} highly similar to uniprot|P31787
           Saccharomyces cerevisiae YGR037C ACB1 Acyl-CoA-binding
           protein, transports newly synthesized acyl-CoA esters
           from fatty acid synthetase (Fas1p-Fas2p) to
           acyl-CoA-consuming processes
          Length = 87

 Score = 32.3 bits (72), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 5/72 (6%)

Query: 148 KSELTNLIPGTVHTEVLFKLYEIYRDSVVGNATLTPVQLYDLNQFIK-----RFTGDAQL 202
           K+   N +P T   + L KLY +Y+ + VG+ T     +++L    K        G +Q 
Sbjct: 9   KASAVNNLPTTPSNDELLKLYGLYKQATVGDNTKEKPGIFNLKDRYKWDAWEELKGTSQE 68

Query: 203 AKAQQVLGFVLE 214
              QQ + FV E
Sbjct: 69  EAEQQYIKFVDE 80

>KLLA0B05643g Chr2 (509019..509045,509123..509359) [264 bp, 87 aa]
           {ON} highly similar to uniprot|P31787 Saccharomyces
           cerevisiae YGR037C ACB1 Acyl-CoA-binding protein,
           transports newly synthesized acyl-CoA esters from fatty
           acid synthetase (Fas1p-Fas2p) to acyl-CoA-consuming
           processes
          Length = 87

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 148 KSELTNLIPGTVHTEVLFKLYEIYRDSVVGNATLTPVQLYDLNQFIKRFTGDA 200
           K++  N +P T + + L KLY +Y+ + VG+ T     +++L     R+  DA
Sbjct: 9   KAKAVNELPSTPNNDELLKLYALYKQATVGDNTKEKPGMFNLKD---RYKWDA 58

>NDAI0H01410 Chr8 (346035..346970) [936 bp, 311 aa] {ON} 
          Length = 311

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 44/110 (40%), Gaps = 19/110 (17%)

Query: 440 TNNFTEALRIHDEALAGLYMKRNLIDPEVDVIKKFQKLILKKMAGRGYYHKPLKYISEWC 499
           + N T   + HD    G Y+ +  +DP  D   + ++   +K  G     KPLK      
Sbjct: 183 SQNITSPHKYHDNDNKGEYLSK--LDPNQDSSCQKEQ-TQRKEDGPYKLEKPLK------ 233

Query: 500 LNKRNELEMREYFDRHRKAYITRIEQRKQKQETAQVTFDAEEEDDMLLGR 549
                      Y+D +   Y+  IE RK KQ    +  D+   DD  +G+
Sbjct: 234 ----------NYYDTYYSKYLDHIESRKVKQRKRSLRVDSINSDDTEIGK 273

>Kpol_1045.22 s1045 complement(45581..53884) [8304 bp, 2767 aa] {ON}
           complement(45583..53886) [8304 nt, 2768 aa]
          Length = 2767

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 4/45 (8%)

Query: 263 LAHSYKVLETEALLPLIDEMMKDRAWHYKRNCDLEAAVIYSLGYM 307
           L+H Y++L +  ++ L+D    D   H KRN    + VIY L YM
Sbjct: 745 LSHEYQLLPSSEVIKLLD----DYKMHLKRNKKTNSNVIYELQYM 785

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,230,594
Number of extensions: 2316836
Number of successful extensions: 6788
Number of sequences better than 10.0: 33
Number of HSP's gapped: 6886
Number of HSP's successfully gapped: 33
Length of query: 551
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 436
Effective length of database: 40,294,809
Effective search space: 17568536724
Effective search space used: 17568536724
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)