Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0D01276g8.848ON50250226880.0
Kwal_27.102198.848ON50050614980.0
Kpol_1068.28.848ON49148414730.0
TDEL0A079708.848ON48948914700.0
KLTH0C03696g8.848ON47447814610.0
Ecym_46238.848ON48048114310.0
Suva_13.4728.848ON51049714130.0
KLLA0D01386g8.848ON48949214070.0
Smik_13.4968.848ON49449614050.0
YMR283C (RIT1)8.848ON51350414060.0
Skud_13.4558.848ON49450014000.0
KNAG0J002208.848ON49949813990.0
NDAI0K003508.848ON50450113960.0
NCAS0C003508.848ON48649113940.0
TPHA0I003008.848ON49349213880.0
ZYRO0G14344g8.848ON47248113610.0
KAFR0B039808.848ON48348513131e-178
AFR451C8.848ON40840711661e-157
ZYRO0F01738g5.175ON47086732.3
SAKL0E04994gsingletonON59160713.8
NCAS0A152402.436ON12343665.1
KNAG0K018403.147ON46052697.6
TPHA0G012208.772ON74865698.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0D01276g
         (502 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar ...  1040   0.0  
Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283...   581   0.0  
Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..381...   572   0.0  
TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON} Anc_8...   570   0.0  
KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} simila...   567   0.0  
Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar...   555   0.0  
Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {...   548   0.0  
KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} simila...   546   0.0  
Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {...   545   0.0  
YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON} ...   546   0.0  
Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {...   543   0.0  
KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.84...   543   0.0  
NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON...   542   0.0  
NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848...   541   0.0  
TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}...   539   0.0  
ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]...   528   0.0  
KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {O...   510   e-178
AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}...   453   e-157
ZYRO0F01738g Chr6 complement(139924..141310,141381..141406) [141...    33   2.3  
SAKL0E04994g Chr5 complement(405972..407747) [1776 bp, 591 aa] {...    32   3.8  
NCAS0A15240 Chr1 (2995132..2995503) [372 bp, 123 aa] {ON} Anc_2....    30   5.1  
KNAG0K01840 Chr11 (381573..382955) [1383 bp, 460 aa] {ON} Anc_3....    31   7.6  
TPHA0G01220 Chr7 complement(248183..250429) [2247 bp, 748 aa] {O...    31   8.1  

>SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar to
           uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 502

 Score = 1040 bits (2688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/502 (100%), Positives = 502/502 (100%)

Query: 1   MLKASCSSIDEVTRRTCVYPNYSRNMDTETLKSLNLIKKEIKKEYKSLRNRLQSIIWDHQ 60
           MLKASCSSIDEVTRRTCVYPNYSRNMDTETLKSLNLIKKEIKKEYKSLRNRLQSIIWDHQ
Sbjct: 1   MLKASCSSIDEVTRRTCVYPNYSRNMDTETLKSLNLIKKEIKKEYKSLRNRLQSIIWDHQ 60

Query: 61  FLTTYVIPTFPDYPLVPNERCGLWYCNPESFSQMSYFKSTDGHINQWDFSTRRLNFHLLP 120
           FLTTYVIPTFPDYPLVPNERCGLWYCNPESFSQMSYFKSTDGHINQWDFSTRRLNFHLLP
Sbjct: 61  FLTTYVIPTFPDYPLVPNERCGLWYCNPESFSQMSYFKSTDGHINQWDFSTRRLNFHLLP 120

Query: 121 SIAQHGGIVIIDSTRRGKKIPDALSKTIPIWCAVINTLILEASNRSEEVLFCPPGTVPQS 180
           SIAQHGGIVIIDSTRRGKKIPDALSKTIPIWCAVINTLILEASNRSEEVLFCPPGTVPQS
Sbjct: 121 SIAQHGGIVIIDSTRRGKKIPDALSKTIPIWCAVINTLILEASNRSEEVLFCPPGTVPQS 180

Query: 181 EYDRIKNRIPSLVEKLKNLGIVSGDELLKQFGGKILRPLWVYPGSSLFSSSTDIFTGKQT 240
           EYDRIKNRIPSLVEKLKNLGIVSGDELLKQFGGKILRPLWVYPGSSLFSSSTDIFTGKQT
Sbjct: 181 EYDRIKNRIPSLVEKLKNLGIVSGDELLKQFGGKILRPLWVYPGSSLFSSSTDIFTGKQT 240

Query: 241 RSQKWEKPEDQDFLPVILCTASYQCQDGVDKRYGFTYVQGAADDHELWAEGLTPDMFWDN 300
           RSQKWEKPEDQDFLPVILCTASYQCQDGVDKRYGFTYVQGAADDHELWAEGLTPDMFWDN
Sbjct: 241 RSQKWEKPEDQDFLPVILCTASYQCQDGVDKRYGFTYVQGAADDHELWAEGLTPDMFWDN 300

Query: 301 KNFLGDETKSEQELIEYVNKQKREATERTKEASGNDLNQCFSVDAITKELHLGTVVDGLE 360
           KNFLGDETKSEQELIEYVNKQKREATERTKEASGNDLNQCFSVDAITKELHLGTVVDGLE
Sbjct: 301 KNFLGDETKSEQELIEYVNKQKREATERTKEASGNDLNQCFSVDAITKELHLGTVVDGLE 360

Query: 361 LNEKLLSQLDSRYALTVVLSESVKIASIQENPNTKIFPLTSGNKKSSKELRSKLIEICPL 420
           LNEKLLSQLDSRYALTVVLSESVKIASIQENPNTKIFPLTSGNKKSSKELRSKLIEICPL
Sbjct: 361 LNEKLLSQLDSRYALTVVLSESVKIASIQENPNTKIFPLTSGNKKSSKELRSKLIEICPL 420

Query: 421 IQASLNSPLPILICCNTGKDMSVGVLLATLCQNYDEDWCIGSPNSFNKTIIRKHLTRLIS 480
           IQASLNSPLPILICCNTGKDMSVGVLLATLCQNYDEDWCIGSPNSFNKTIIRKHLTRLIS
Sbjct: 421 IQASLNSPLPILICCNTGKDMSVGVLLATLCQNYDEDWCIGSPNSFNKTIIRKHLTRLIS 480

Query: 481 HLKGRNVNPSRATLNSVNAYLM 502
           HLKGRNVNPSRATLNSVNAYLM
Sbjct: 481 HLKGRNVNPSRATLNSVNAYLM 502

>Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283C
           (RIT1) - Initiator methionine tRNA 2'-O-ribosyl
           phosphate transferase [contig 39] FULL
          Length = 500

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/506 (55%), Positives = 367/506 (72%), Gaps = 15/506 (2%)

Query: 5   SCSSIDEVTRRTCVY-------PNYSRNMDTETLKSLNLIKKEIKKEYKSLRNRLQSIIW 57
           SCS +  + R  C+        PN   NMD    ++LN + KEIKKE K+LRNRLQSI++
Sbjct: 2   SCSPLTHI-RDECILLDPVSCLPNL--NMDLTFDQTLNSLNKEIKKENKALRNRLQSILF 58

Query: 58  DHQFLTTYVIPTFPDYPLVPNERCGLWYCNPESFSQMSYFKSTDGHINQWDFSTRRLNFH 117
           DH+FL   V+  FP+YPL+PNERCGLWYC+PE +SQ SYFKSTDGH NQWDFS RRLN H
Sbjct: 59  DHRFLEEQVLALFPNYPLIPNERCGLWYCDPERYSQTSYFKSTDGHSNQWDFSLRRLNVH 118

Query: 118 LLPSIAQHGGIVIIDSTRRGKKIPDALSKTIPIWCAVINTLILEASNRSEEVLFCPPGTV 177
           LLP+I Q GGIVI+DSTRRGK++PDALSKT+PIWCAV+N+++LE     EEVLFCPP TV
Sbjct: 119 LLPTITQKGGIVIVDSTRRGKRMPDALSKTVPIWCAVLNSIMLEGRQSEEEVLFCPPNTV 178

Query: 178 PQSEYDRIKNRIPSLVEKLKNLGIVSGDELLKQFGGKILRPLWVYPGSSLFSSSTDIFTG 237
             SE++RIK+RIPSLV + K LG+ + DEL K   GKILRP+WVYPG+SL +S  D FTG
Sbjct: 179 SGSEFERIKSRIPSLVARFKELGLFTSDELFKILDGKILRPIWVYPGASLLNSHRDPFTG 238

Query: 238 KQTRSQKWEKPEDQDFLPVILCTASYQCQDGVDKRYGFTYVQGAADDHELWAEGLTPDMF 297
               +  WE  ++++F+PV+LCT SYQCQDGVDKR+GFTYVQGAADDHELWAEGLT ++F
Sbjct: 239 DIV-TPTWEA-QNENFMPVVLCTVSYQCQDGVDKRHGFTYVQGAADDHELWAEGLTAELF 296

Query: 298 WDNKNFLGDETKSEQELIEYVNKQKREATERTKEASGNDLNQCFSVDAITKELHLGTVVD 357
           W +     D   S+QEL  YVN          K      L+   + + +T+ELHLG V +
Sbjct: 297 WQHIEIFKDTALSDQELSTYVNNLVTSGDANNKLTKSLRLDDMLNANELTRELHLGQVAE 356

Query: 358 GLELNEKLLSQLDSRYALTVVLSESVKIASIQENPNTKIFPLTSGNKKSSKELRSKLIEI 417
            +EL++ L+ QL  +Y+L V+LS S+ +   +E  N +IF L SG+KKSS+ LR+ L +I
Sbjct: 357 NIELDKNLVDQLKLKYSLVVLLSTSISV--YEEAENIRIFKLQSGSKKSSRALRAALTQI 414

Query: 418 CPLIQASLNSPLPILICCNTGKDMSVGVLLATLCQNYD-EDWCIGSPNSFNKTIIRKHLT 476
           CPLI+A+L + LP+LICCN GKDMSV V+L+ LC+N++ E W +    S +K+II+KHL 
Sbjct: 415 CPLIEANLQNSLPVLICCNNGKDMSVCVVLSVLCRNFNVESWQLEQRPSVHKSIIKKHLA 474

Query: 477 RLISHLKGRNVNPSRATLNSVNAYLM 502
           ++I+ L GRN+NP R +LNSVN YLM
Sbjct: 475 KMITKLDGRNLNPPRVSLNSVNDYLM 500

>Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..3818)
           [1476 nt, 492 aa]
          Length = 491

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/484 (58%), Positives = 357/484 (73%), Gaps = 18/484 (3%)

Query: 33  SLNLIKKEIKKEYKSLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGLWYCNPESFS 92
           S+N I K+IKKEYKSL+NR+QSI+ D +FL   VIP FP++P++PNERCGLWYCNP+ F 
Sbjct: 10  SINQIHKDIKKEYKSLKNRIQSILLDARFLEDTVIPFFPEFPVIPNERCGLWYCNPKLFE 69

Query: 93  QMSYFKSTDGHINQWDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALSKTIPIWC 152
           Q SYFKSTDGHINQWDFSTRRLNFHLLP++AQ+GGIVI+DSTRRGKKIPDALSKT+PIWC
Sbjct: 70  QTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPIWC 129

Query: 153 AVINTLILEASNRSEE----VLFCPPGTVPQSEYDRIKNRIPSLVEKLKNLGIVSGDELL 208
           AV+N+L+LE+ ++  +    VLF PP TVP SEY RI  ++P L+E+L  L I+ G +L 
Sbjct: 130 AVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSDLY 189

Query: 209 KQFGGKILRPLWVYPGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFLPVILCTASYQCQDG 268
           KQF GK+LRP+W++PGSSL  S+TDIFTG+ T +  WE PED++ +P+ILCT SY+ QDG
Sbjct: 190 KQFNGKLLRPIWIHPGSSLLQSTTDIFTGEST-NDVWETPEDEEIIPIILCTVSYRAQDG 248

Query: 269 VDKRYGFTYVQGAADDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVNKQKREATER 328
           VDKR+GFTYVQGAADDHELW+ GL PDMFWDN     D  +SE  L   V         +
Sbjct: 249 VDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDL---LAAK 305

Query: 329 TKEASGNDLNQCFS-VDAITKELHLGTVVDGLELNEKLLSQLDSRYALTVVLSESVKIA- 386
            KE S  +  + F+ +D IT ++ LG + DGL + + L S+L S++++ +V SES K++ 
Sbjct: 306 QKEVSETETLEAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLSV 365

Query: 387 SIQENPNTK---IFPLTSGNKKSSKELRSKLIEICPLIQASLN-----SPLPILICCNTG 438
           S  E   T+   I  L SG+KKSSK LR  L E+   I+   +     S LPILICCN+G
Sbjct: 366 SKNEEKITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILICCNSG 425

Query: 439 KDMSVGVLLATLCQNYDEDWCIGSPNSFNKTIIRKHLTRLISHLKGRNVNPSRATLNSVN 498
            DMS+ ++L  LC++YD DW    PN  NK IIRKHLT+LISHLKGRNVNPSRATLNSVN
Sbjct: 426 TDMSIALVLMLLCKHYDLDWNTSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRATLNSVN 485

Query: 499 AYLM 502
            YLM
Sbjct: 486 EYLM 489

>TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON}
           Anc_8.848 YMR283C
          Length = 489

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/489 (57%), Positives = 362/489 (74%), Gaps = 17/489 (3%)

Query: 26  MDTETLKSLNLIKKEIKKEYKSLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGLWY 85
           MD   + SL  I K+IKKEYKSLRNRLQSI+ D+ FL T V+P FP+YPLVPNERCGLWY
Sbjct: 6   MDNNFIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWY 65

Query: 86  CNPESFSQMSYFKSTDGHINQWDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALS 145
           CNP+ F+Q SYFKSTDGH NQWDFS+RRLNFH++P+IA+  GI+I+DSTRRGKK+PDALS
Sbjct: 66  CNPKDFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALS 125

Query: 146 KTIPIWCAVINTLILEASNRS--EEVLFCPPGTVPQSEYDRIKNRIPSLVEKLKNLGIVS 203
           KTIPIWCAV+N L+LE+   S  +E L+ PP TV +SE+  IK+RIP LVEKLK+L +++
Sbjct: 126 KTIPIWCAVLNHLMLESQGGSVKQETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVIN 185

Query: 204 GDELLKQFGGKILRPLWVYPGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFLPVILCTASY 263
           G EL KQ GGK+LRP W+YPGSS+  S+TDIFTG+ T S KW  P D   +P+ILCT SY
Sbjct: 186 GKELHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVT-SDKW-IPVDNSIIPIILCTVSY 243

Query: 264 QCQDGVDKRYGFTYVQGAADDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVNKQKR 323
           Q QDGVDKR GFTYVQGAADDHELW+ GL   +FW N + LG++  SE+EL  +V++   
Sbjct: 244 QAQDGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQLSL 303

Query: 324 EATERTKEASGNDLNQCF-SVDAITKELHLGTVVDGLELNEKLLSQLDSRYALTVVLSES 382
              + +KE   +D    F  +D +T EL LG V+D LE N KL+ ++   ++L +VLS+S
Sbjct: 304 RGCDLSKEIQFSD---AFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQS 360

Query: 383 V----KIASIQENPN-TKIFPLTSGNKKSSKELRSKLIEICPLIQASL----NSPLPILI 433
           V    K+A ++       I  L SG+K SS+ L+++L++I PLI+  +        P+LI
Sbjct: 361 VNFPQKVAEMENASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRKPVLI 420

Query: 434 CCNTGKDMSVGVLLATLCQNYDEDWCIGSPNSFNKTIIRKHLTRLISHLKGRNVNPSRAT 493
           CCN+G DMS+G+LL  LC+NY+ DW + +P S +K +++KHL +LISHLKGRNVNP RAT
Sbjct: 421 CCNSGTDMSIGLLLVVLCRNYNMDWQLNTPTSVSKIVVKKHLAKLISHLKGRNVNPPRAT 480

Query: 494 LNSVNAYLM 502
           LNSVN+YLM
Sbjct: 481 LNSVNSYLM 489

>KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 474

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/478 (56%), Positives = 358/478 (74%), Gaps = 5/478 (1%)

Query: 26  MDTETLKSLNLIKKEIKKEYKSLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGLWY 85
           M+  + +++N + +EIKKEY+SLRNRLQSI++DH+FL   V   FPDYP++PNERCG+WY
Sbjct: 1   MELTSDQTINFLNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWY 60

Query: 86  CNPESFSQMSYFKSTDGHINQWDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALS 145
           C+P+ + Q SYFKSTDGH NQWDFS RRLNFHLLP++A  GGIV++DSTRRGK++PDALS
Sbjct: 61  CDPKDYLQTSYFKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALS 120

Query: 146 KTIPIWCAVINTLILEASNRSEEVLFCPPGTVPQSEYDRIKNRIPSLVEKLKNLGIVSGD 205
           KT+PIWCAV+N+L+LE      EVLFCPP TV + E++RIK+RIP LV K K + I++G 
Sbjct: 121 KTVPIWCAVLNSLLLEYQGLEGEVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGA 180

Query: 206 ELLKQFGGKILRPLWVYPGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFLPVILCTASYQC 265
           ++ + F GKILRPLWV+PG+SL SS  D FTG +  SQKW   E ++F+PV+LCT SYQC
Sbjct: 181 DIDRLFKGKILRPLWVFPGASLLSSQRDPFTG-EVLSQKWHTAELENFIPVVLCTVSYQC 239

Query: 266 QDGVDKRYGFTYVQGAADDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVNKQKREA 325
           QDGVDKR+GFTYVQGAADDHELWA+GLT ++FW + + L +   S+QEL  +V + K   
Sbjct: 240 QDGVDKRHGFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFV-EDKIHP 298

Query: 326 TERTKEASGNDLNQCFSVDAITKELHLGTVVDGLELNEKLLSQLDSRYALTVVLSESVKI 385
            E     +G  L+Q    D +T+ELHLG +   + L E L+ +L  +Y+L ++LS +V +
Sbjct: 299 QEPNSAENGLSLDQILYTDILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTL 358

Query: 386 ASIQENPNTKIFPLTSGNKKSSKELRSKLIEICPLIQASLNSPLPILICCNTGKDMSVGV 445
           +  ++    KIF L S  KKSSK LR++LI+ICPL +A L + LP+L+CCNTGKDMSV V
Sbjct: 359 S--EDEAAIKIFKLQSECKKSSKALRTELIKICPLAEAYLPNSLPMLVCCNTGKDMSVCV 416

Query: 446 LLATLCQNYD-EDWCIGSPNSFNKTIIRKHLTRLISHLKGRNVNPSRATLNSVNAYLM 502
            LA LC+NY+   W +    S +K  I+KHL+++I+ L+GRNVNP RA+LNSVNAYLM
Sbjct: 417 SLAILCRNYNVGSWDLNVQQSIHKIDIKKHLSKIITKLEGRNVNPPRASLNSVNAYLM 474

>Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR451C
          Length = 480

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/481 (55%), Positives = 350/481 (72%), Gaps = 8/481 (1%)

Query: 27  DTETLKSLNLIKKEIKKEYKSLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGLWYC 86
           D   L +L  IKKEI+++  SLRNRLQS+ +D +F+   V+P FP+YPLVPNERCGLWYC
Sbjct: 3   DESGLDTLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYC 62

Query: 87  NPESFSQMSYFKSTDGHINQWDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALSK 146
           NP  + Q  YFKSTDGH NQWDFSTRRLNFH+L  +A+ GGI+I+DSTRRGKK+PDALSK
Sbjct: 63  NPGKYEQTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSK 122

Query: 147 TIPIWCAVINTLILEASNRSEEV--LFCPPGTVPQSEYDRIKNRIPSLVEKLKNLGIVSG 204
           TIPIWCAV+N L+L+   + + +  LFCPPGTV + E+D I +++P LVEKLK L I+SG
Sbjct: 123 TIPIWCAVLNNLMLDYKGKEDSIPSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIISG 182

Query: 205 DELLKQFGGKILRPLWVYPGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFLPVILCTASYQ 264
           +EL   F GK+LRP WVYPGS L  +S DIFTG +     W+   +Q+ +PVILCTASYQ
Sbjct: 183 EELYNMFQGKVLRPFWVYPGSPLLDTSRDIFTG-EVLGNVWQ--SEQNSIPVILCTASYQ 239

Query: 265 CQDGVDKRYGFTYVQGAADDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVNKQKR- 323
           CQDG DK +GFTYVQGAADDHELWA GL P++FW N  FLGD  KSE EL ++V +  R 
Sbjct: 240 CQDGEDKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGRT 299

Query: 324 -EATERTKEASGNDLNQCF-SVDAITKELHLGTVVDGLELNEKLLSQLDSRYALTVVLSE 381
            + T ++ + S  + +  F  VD ITK L+LGTV +G+ L E +  +L S+Y+L ++ S+
Sbjct: 300 EKLTAQSNKQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCIICSQ 359

Query: 382 SVKIASIQENPNTKIFPLTSGNKKSSKELRSKLIEICPLIQASLNSPLPILICCNTGKDM 441
           SV   +       K++P+ + +KKSS++LR  LIEI  LI+  +   LPILICCNTGKD+
Sbjct: 360 SVTAKADCNCERIKVYPINNNSKKSSRDLRVALIEISGLIKQHITDQLPILICCNTGKDI 419

Query: 442 SVGVLLATLCQNYDEDWCIGSPNSFNKTIIRKHLTRLISHLKGRNVNPSRATLNSVNAYL 501
           S+G++L  LCQ+YD  W +    + NKTI++KHL R+I+ L G N+NPSR+TL +VNA+L
Sbjct: 420 SIGIMLTALCQHYDLQWHLEEQETVNKTIVKKHLARIITKLSGININPSRSTLKNVNAFL 479

Query: 502 M 502
           +
Sbjct: 480 L 480

>Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {ON}
           YMR283C (REAL)
          Length = 510

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/497 (55%), Positives = 354/497 (71%), Gaps = 21/497 (4%)

Query: 26  MDTETLKSLNL--IKKEIKKEYKSLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGL 83
           MD E L SL+L  I K+++KE KS+RNRLQSI+ D++FL   V+P FP +P+VPNERCGL
Sbjct: 15  MDEEILLSLSLSQINKDVRKENKSVRNRLQSILLDNRFLRDRVLPIFPRFPIVPNERCGL 74

Query: 84  WYCNPESFSQMSYFKSTDGHINQWDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDA 143
           WYC P SF Q SYFKSTDGH+NQWDFSTRRLNFHLL  I ++ GI+I+DSTRRGKKIPDA
Sbjct: 75  WYCEPSSFEQTSYFKSTDGHVNQWDFSTRRLNFHLLEIIQENKGIIIVDSTRRGKKIPDA 134

Query: 144 LSKTIPIWCAVINTLILEASNRS---EEVLFCPPGTVPQSEYDRIKNRIPSLVEKLKNLG 200
           LSKT+PIWCAV+NT++L+ +  +   ++VL+ PP TVP+SEYD IK +IP LV+KL+ L 
Sbjct: 135 LSKTVPIWCAVLNTIMLQETEENVDIDKVLYVPPETVPKSEYDMIKRKIPELVDKLQKLN 194

Query: 201 IVSGDELLKQFGGKILRPLWVYPGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFLPVILCT 260
            +    L K F GKILRP+WV+PGSSL + S D FTG+    + WE PEDQ+ +P+ILCT
Sbjct: 195 AIDSKTLNKLFKGKILRPIWVHPGSSLLNHSVDCFTGEIEEQEIWESPEDQNIIPIILCT 254

Query: 261 ASYQCQDGVDKRYGFTYVQGAADDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVNK 320
            SYQ QDG+DKRYGFTYVQGAADDHELW+ GL   MFW + ++LGD   S+ +L  Y+  
Sbjct: 255 VSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWSHIDYLGDTNNSDDQLCAYITD 314

Query: 321 --QKREATERTKEASGNDLNQCF-SVDAITKELHLGTVVDGLELNEKLLSQLDSRYALTV 377
              K+   + + +  GN L+  F ++D IT E+ LG V+ GL +NEKL  +L   Y   +
Sbjct: 315 LIGKKLEYQLSIQDKGN-LDDIFENIDKITNEISLGKVIQGLTINEKLEKELKVHYEKVI 373

Query: 378 VLSESVKIA----SIQENPN---TKIFPLTSGNKKSSKELRSKLIEICPLIQASLNSPL- 429
           + S SV IA    S++E+       ++ L SG+KKSSK LRS    I   +Q    +P  
Sbjct: 374 IFSNSVAIAAHADSVEESRTDSFISVYKLQSGDKKSSKALRSTFPMIHQEVQPVFANPAK 433

Query: 430 ---PILICCNTGKDMSVGVLLATLCQNYDEDWCIGSP-NSFNKTIIRKHLTRLISHLKGR 485
              PIL+CCNTG DMS+GV+L+ LC  Y+E+W + S     NK IIRKHLT+LISHL GR
Sbjct: 434 GMKPILVCCNTGTDMSIGVILSILCAKYNEEWILTSELPVVNKIIIRKHLTKLISHLHGR 493

Query: 486 NVNPSRATLNSVNAYLM 502
           NVNPSRATLNSVN++LM
Sbjct: 494 NVNPSRATLNSVNSFLM 510

>KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 489

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/492 (54%), Positives = 349/492 (70%), Gaps = 18/492 (3%)

Query: 26  MDTETLKSLNLIKKEIKKEYKSLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGLWY 85
           MD ETL+ +  I KE++KE KSL+NRLQSII+D+ FL   V PTF  YP+VPNERCGLWY
Sbjct: 1   MDKETLREIKEISKELRKEDKSLKNRLQSIIFDNNFLKEQVFPTF-QYPVVPNERCGLWY 59

Query: 86  CNPESFSQMSYFKSTDGHINQWDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALS 145
           C+P+ +   SYFKSTDGH+NQWDFSTRRLNFHLLP + ++GG+VI+DSTRRGKKIPDALS
Sbjct: 60  CDPKIYDTTSYFKSTDGHMNQWDFSTRRLNFHLLPLLGENGGLVILDSTRRGKKIPDALS 119

Query: 146 KTIPIWCAVINTLILEASNRS----EEVLFCPPGTVPQSEYDRIKNRIPSLVEKLKNLGI 201
           KT+PIWCAV+N L+LEA  +     EE+LF PP TVP+SE+DR+  ++P LV+KLK L I
Sbjct: 120 KTVPIWCAVLNYLMLEADGKQWPFEEEILFVPPSTVPESEFDRMFAKLPELVQKLKKLDI 179

Query: 202 VSGDELLKQF-----GGKILRPLWVYPGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFLPV 256
           +   +L K         K+LRP+WVYPGSSL     D+F+G+   +  WE P   + +PV
Sbjct: 180 IDVKKLRKSLQIEEGHDKLLRPIWVYPGSSLLQLKHDLFSGEVIENTHWEPP--SNIIPV 237

Query: 257 ILCTASYQCQDGVDKRYGFTYVQGAADDHELWAEGLTPDMFWDNKNFLGDETKSEQELIE 316
           ILCT SYQCQDG DKRYGFTYVQGAADDHELWAE LTP +FW+N + LGD +KS+ EL +
Sbjct: 238 ILCTVSYQCQDGTDKRYGFTYVQGAADDHELWAENLTPQLFWENIDELGDISKSDAELKD 297

Query: 317 YVNKQKREATERTKEASGNDLNQCFSVDAITKELHLGTVVDGLELNEKLLSQLDSRYALT 376
             N     A  +       D+++   +D IT  LHLG +     +  K +  L+ +Y+  
Sbjct: 298 SYNAVILRAKVQNSLDISGDISKMLEIDTITARLHLGKITSQFRITPKTVKYLNQKYSAV 357

Query: 377 VVLSESVKIASIQENPNT-KIFPLTSGNKKSSKELRSKLIEICPLIQASLNSP-----LP 430
           V+  E++ +  I E P +  IFPL SG+KKSS+ELRS LI+I  LI+  L+ P     LP
Sbjct: 358 VLCHEAISVTEITELPRSIHIFPLPSGSKKSSRELRSHLIKINALIEEQLSRPDTAANLP 417

Query: 431 ILICCNTGKDMSVGVLLATLCQNYDEDWCIGSPNSFNKTIIRKHLTRLISHLKGRNVNPS 490
           ILI C++GKD+SV +LL  LC+ Y+ DW +   +S NKTII+KHL ++I  L+GRNVNPS
Sbjct: 418 ILIACDSGKDISVSILLVALCKYYNLDWELQPQDSVNKTIIKKHLAKIIESLQGRNVNPS 477

Query: 491 RATLNSVNAYLM 502
           RA+LNSVN++LM
Sbjct: 478 RASLNSVNSFLM 489

>Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/496 (54%), Positives = 354/496 (71%), Gaps = 21/496 (4%)

Query: 26  MDTETLKSLNLIKKEIKKEYKSLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGLWY 85
           MD E   SL  I ++++KE KS+RNRLQSI+ D++FL   VIP FP +PLVPNERCG+WY
Sbjct: 1   MDEEICLSLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWY 60

Query: 86  CNPESFSQMSYFKSTDGHINQWDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALS 145
           C P ++ Q SYFKSTDGH+NQWDFSTRRLNFHLL +I  + GI+I+DSTRRGKKIPDALS
Sbjct: 61  CKPSTYKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 120

Query: 146 KTIPIWCAVINTLILEASNRS---EEVLFCPPGTVPQSEYDRIKNRIPSLVEKLKNLGIV 202
           KT+PIWCAV+NT++L+ +  +   ++ L+ PP TVP+SEYD IK +IP LV KL+ L I+
Sbjct: 121 KTVPIWCAVLNTIMLQETEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNII 180

Query: 203 SGDELLKQFGGKILRPLWVYPGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFLPVILCTAS 262
              +L + F GKILRP+WV+PGSSL + S D FTG+  + + WE PEDQ+ +P+ILCT S
Sbjct: 181 DSKKLNELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVS 240

Query: 263 YQCQDGVDKRYGFTYVQGAADDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVN--- 319
           YQ QDG+DKRYGFTYVQGAADDHELW+ GL   MFW +  FL D+  S+ +L +Y+    
Sbjct: 241 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLV 300

Query: 320 KQKREATERTKEASGNDLNQCFS-VDAITKELHLGTVVDGLELNEKLLSQLDSRYALTVV 378
            +K ++    ++  G  L++ F  VD IT E+ LG VV GL +NEKL  +L S Y   ++
Sbjct: 301 AKKLKSQMYIQDKGG--LDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLI 358

Query: 379 LSESVKIA-------SIQENPNTKIFPLTSGNKKSSKELRSKLIEICPLIQASLNSPL-- 429
           LS+SV +A       + + NP   ++ L SG+KKSSK LRS L +I   ++ +  +    
Sbjct: 359 LSDSVTVAEDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEE 418

Query: 430 --PILICCNTGKDMSVGVLLATLCQNYDEDWCIGSP-NSFNKTIIRKHLTRLISHLKGRN 486
             P+L+CCNTG DMS+GV+L+ LC  Y E+W +       NK IIRKHLT+LISHL GRN
Sbjct: 419 MRPMLVCCNTGTDMSIGVILSILCTKYTEEWMLTQELPEVNKIIIRKHLTKLISHLHGRN 478

Query: 487 VNPSRATLNSVNAYLM 502
           VNPSRATLNSVN++LM
Sbjct: 479 VNPSRATLNSVNSFLM 494

>YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON}
           RIT12'-O-ribosyl phosphate transferase, modifies the
           initiator methionine tRNA at position 64 to distinguish
           it from elongator methionine tRNA
          Length = 513

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/504 (54%), Positives = 348/504 (69%), Gaps = 37/504 (7%)

Query: 26  MDTETLKSLNLIKKEIKKEYKSLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGLWY 85
           MD     SL+ I K+I+KE KS+RNRLQSI+ D++FL   VIP FP YPL+PNERCGLWY
Sbjct: 20  MDENIYLSLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLWY 79

Query: 86  CNPESFSQMSYFKSTDGHINQWDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALS 145
           CNP SF Q SYFKSTDGH+NQWDFSTRRLNFHLL +I  + GI+I+DSTRRGKKIPDALS
Sbjct: 80  CNPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 139

Query: 146 KTIPIWCAVINTLILEASNRS---EEVLFCPPGTVPQSEYDRIKNRIPSLVEKLKNLGIV 202
           KT+PIWCAV+NTL+L+ + ++   ++VL+ PP TVP+SEYD IK +IP LV KL+ L I+
Sbjct: 140 KTVPIWCAVLNTLMLQETEKNVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLNII 199

Query: 203 SGDELLKQFGGKILRPLWVYPGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFLPVILCTAS 262
              +L + F GK+LRP+WV+PGSSL   S D FTG+    + WE PEDQ+ +P+ILCT S
Sbjct: 200 DSKKLNELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCTVS 259

Query: 263 YQCQDGVDKRYGFTYVQGAADDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVNKQK 322
           YQ QDG+DKRYGFTYVQGAADDHELW+ GL  +MFW +  +LGD + S+ +L +Y+    
Sbjct: 260 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYI---- 315

Query: 323 REATERTKEASGNDLNQCF------------SVDAITKELHLGTVVDGLELNEKLLSQLD 370
                    A+    NQC+            ++D IT E+ LG V  GL +N+ L  +L 
Sbjct: 316 ------MDLAAAKLRNQCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLK 369

Query: 371 SRYALTVVLSESVKIASIQE-------NPNTKIFPLTSGNKKSSKELRSKLIEICPLIQA 423
           S Y   ++ S SV +A   +       +P   I+ L SG+KKSSK LRS    I   IQ+
Sbjct: 370 SEYGKVIIFSNSVTVAEDTDDEEESGTDPFISIYKLQSGDKKSSKALRSTFPRIHGEIQS 429

Query: 424 SLNSP----LPILICCNTGKDMSVGVLLATLCQNYDEDWCIGSP-NSFNKTIIRKHLTRL 478
              +      P+LICCNTG DMS+GV+L+ LC  Y E+W + S     +K I+RKHLT+L
Sbjct: 430 LFTNRDEKIKPMLICCNTGTDMSIGVILSILCTKYTEEWMLTSELPDISKLIVRKHLTKL 489

Query: 479 ISHLKGRNVNPSRATLNSVNAYLM 502
           ISHLKGRNVNPSRATLNSVN++LM
Sbjct: 490 ISHLKGRNVNPSRATLNSVNSFLM 513

>Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/500 (54%), Positives = 355/500 (71%), Gaps = 29/500 (5%)

Query: 26  MDTETLKSLNLIKKEIKKEYKSLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGLWY 85
           MD E L SL+ I K++++E KS+RNRLQSI+ D++FL   V+  FP +P+VPNERCGLWY
Sbjct: 1   MDKEILLSLSQINKDVRRENKSVRNRLQSILLDNKFLQERVVSIFPHFPIVPNERCGLWY 60

Query: 86  CNPESFSQMSYFKSTDGHINQWDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALS 145
           C P +F + SYFKSTDGH+NQWDFSTRRLNFHLL +I    GI+IIDSTRRGKKIPD+LS
Sbjct: 61  CEPSTFKRTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDKKGIIIIDSTRRGKKIPDSLS 120

Query: 146 KTIPIWCAVINTLILEASNRS---EEVLFCPPGTVPQSEYDRIKNRIPSLVEKLKNLGIV 202
           KT+PIWCAV+NT++L+        ++VL+ PP TVP+SEYD IK +IP LV KLK L +V
Sbjct: 121 KTVPIWCAVLNTIMLQKEKEDVDIDKVLYVPPETVPKSEYDMIKRKIPELVAKLKKLNVV 180

Query: 203 SGDELLKQFGGKILRPLWVYPGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFLPVILCTAS 262
             ++L   F GKILRP+WV+PGSSL + S D FTG+    + WE P+DQ+ +P+ILCT S
Sbjct: 181 DSEKLNDLFMGKILRPIWVHPGSSLLNHSVDYFTGELKEQETWEAPKDQNIIPIILCTVS 240

Query: 263 YQCQDGVDKRYGFTYVQGAADDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVNK-- 320
           YQ QDG+DKRYGFTYVQGAADDHELW+ GL  +MFW + ++LGD  KS+ +L +Y+    
Sbjct: 241 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSEMFWSHVDYLGDTDKSDDQLHDYITDLV 300

Query: 321 QKREATERTKEASGNDLNQCF-SVDAITKELHLGTVVDGLELNEKLLSQLDSRYALTVVL 379
            K+   + + +  G+ L++ F ++D IT E+ LG V+ GL ++ KL  +L  RY   +V 
Sbjct: 301 AKKLENQLSIKDKGS-LDEIFGNIDIITNEISLGKVIQGLTISVKLKQELKLRYDKVIVF 359

Query: 380 SESVKIASI-----QENPNT--KIFPLTSGNKKSSKELRSKLIEICPLIQASLNSPL--- 429
           S+SV I        + +PN+   +F L SG+KKSSK LR+    I P I   L S     
Sbjct: 360 SDSVAITEDTDHEEESSPNSFISVFKLQSGDKKSSKTLRT----IFPRIHEELQSAFANR 415

Query: 430 -----PILICCNTGKDMSVGVLLATLCQNYDEDWCIGSPN--SFNKTIIRKHLTRLISHL 482
                PILICCNTG DMS+GV+L+ LC  Y EDW + +P     NK IIR+HLT+LISHL
Sbjct: 416 DGGTKPILICCNTGTDMSIGVILSILCTKYTEDWKL-TPELPEVNKIIIRRHLTKLISHL 474

Query: 483 KGRNVNPSRATLNSVNAYLM 502
           +GRNVNPSRATLNSVN++LM
Sbjct: 475 RGRNVNPSRATLNSVNSFLM 494

>KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.848
           YMR283C
          Length = 499

 Score =  543 bits (1399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/498 (54%), Positives = 358/498 (71%), Gaps = 15/498 (3%)

Query: 18  VYPNYSRNMDTETLKSLNLIKKEIKKEYKSLRNRLQSIIWDHQFLTTYVIPTFPDYPLVP 77
           + P  +  MD   L SL  I KE+K++ +SLRNR+QSI+ D++FL T V   FPD+PL+P
Sbjct: 4   LLPKGTGAMDRNLLTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIP 63

Query: 78  NERCGLWYCNPESFSQMSYFKSTDGHINQWDFSTRRLNFHLLPSIAQHGGIVIIDSTRRG 137
           NERCGLWYCNP  F+Q SYFKSTDGH NQWDFSTRRLNFHLLP++ + GG+VI+DSTRRG
Sbjct: 64  NERCGLWYCNPSHFAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRG 123

Query: 138 KKIPDALSKTIPIWCAVINTLILEASNRS---EEVLFCPPGTVPQSEYDRIKNRIPSLVE 194
           KKIPDALSKT+P+WCAV+N+L+LE+  +     +VLF PP TVP+SE D++  ++P LVE
Sbjct: 124 KKIPDALSKTVPLWCAVLNSLMLESVGKKFNVNDVLFVPPETVPESERDQMAKKLPDLVE 183

Query: 195 KLKNLGIVSGDELLKQFGGKILRPLWVYPGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFL 254
           KLK L +  G +  +   GK+LRP WV+PGSSL  S TDIFTG+Q ++ KWE   D++ +
Sbjct: 184 KLKILNVFDGTKTSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGEQIQN-KWEVSRDENIV 242

Query: 255 PVILCTASYQCQDGVDKRYGFTYVQGAADDHELWAEGLTPDMFWDNKNFLGDETKSEQEL 314
           P+ILCT SYQ QDG+DKR GFTYVQGAADDHELW+ GL  ++FW N +   + +  + EL
Sbjct: 243 PIILCTVSYQAQDGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSEL 302

Query: 315 IEYVNK---QKREATERTKEASGNDLNQCFSVDAITKELHLGTVVDGLELNEKLLSQLDS 371
            E V+K   Q+    +R+ +A   D      +D +T  L LG + D + L+ + ++ L+ 
Sbjct: 303 YEIVDKMVTQQNNNMQRSAQAGSLD-KIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEK 361

Query: 372 RYALTVVLSESVKI--ASIQENPNTKIFPLTSGNKKSSKELRSKLIEICPLI-QASLNSP 428
            Y+  +VLSE+V +   + Q+N   KIF LTSG+KKSSK LR+ L +I   I  A +  P
Sbjct: 362 CYSTVIVLSETVHLDKDASQDNEMVKIFRLTSGSKKSSKNLRAMLPDISKTINNAIILQP 421

Query: 429 L-PILICCNTGKDMSVGVLLATLCQNYDEDWCIGSPN---SFNKTIIRKHLTRLISHLKG 484
           + P+LICCNTGKDMS+GVLLA LCQNYDE W +   +   S +K +IR+HLT+LI+HL G
Sbjct: 422 IKPLLICCNTGKDMSIGVLLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKLIAHLNG 481

Query: 485 RNVNPSRATLNSVNAYLM 502
           RNVNPSRATLNS+N++LM
Sbjct: 482 RNVNPSRATLNSINSFLM 499

>NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON}
           Anc_8.848 YMR283C
          Length = 504

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/501 (54%), Positives = 363/501 (72%), Gaps = 36/501 (7%)

Query: 33  SLNLIKKEIKKEYKSLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGLWYCNPESFS 92
           SL+ I K+IKKEYKSLRNRLQSI+ D++FL   +I TFP+YP++PNERCGLWY +P  ++
Sbjct: 9   SLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLWYVSPSQYN 68

Query: 93  QMSYFKSTDGHINQWDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALSKTIPIWC 152
           Q SYFKSTDGH NQWDFSTRRLNFHLL +IA+  GI IIDSTRRGKKIPDALSKTIPIWC
Sbjct: 69  QTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDALSKTIPIWC 128

Query: 153 AVINTLILEASN------RSEEVLFCPPGTVPQSEYDRIKNRIPSLVEKLKNLGIVSGDE 206
           AV+N ++L          + E+ LF PP TVP+SEYD I  +IP+LVEKL  L I++ +E
Sbjct: 129 AVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDKLEIINANE 188

Query: 207 LLKQFGGKILRPLWVYPGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFLPVILCTASYQCQ 266
           L+  F GK+LRPLW+YPGSS+  SS D+FTG++T++  WE PE  + +P++LCT SYQ Q
Sbjct: 189 LISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAPE--NIIPIVLCTISYQAQ 246

Query: 267 DGVDKRYGFTYVQGAADDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVNK----QK 322
           DGVDKRYGFTYVQGAADDHELW+ GLTP++FW + N+LG+ T S+ EL+EYV      + 
Sbjct: 247 DGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRHMIEMKI 306

Query: 323 REATERTKEASGNDLNQCF--SVDAITKELHLGTVVDGLELNEKLLSQLDSRYALTVVLS 380
           +++  +T E +   ++  F   VD IT E+ LG + + +++ + +L +    ++L V+LS
Sbjct: 307 KDSAAKTVELT---MDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLVVILS 363

Query: 381 ESVKIASI----QENPNTKIFPLTSGNKKSSKELRSKLIEICPLIQASLNSPLPILICCN 436
           E+V + S     Q++ + KI+ LTSG+KKSSK LR+++ +I  +++ +L +  PILICCN
Sbjct: 364 ETVTLNSDDKDEQQSDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTNGKPILICCN 423

Query: 437 TGKDMSVGVLLATLCQNYDED------WCIGSPNS---------FNKTIIRKHLTRLISH 481
           TG D+S+G++L  LC+NY  D      W      +          +KTIIRK+LT LISH
Sbjct: 424 TGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKNLTTLISH 483

Query: 482 LKGRNVNPSRATLNSVNAYLM 502
           L+GRNVNPSRATLNSVN YLM
Sbjct: 484 LEGRNVNPSRATLNSVNDYLM 504

>NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848
           YMR283C
          Length = 486

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/491 (54%), Positives = 353/491 (71%), Gaps = 19/491 (3%)

Query: 26  MDTETLKSLNLIKKEIKKEYKSLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGLWY 85
           MD   L+SL  I K+I+KE KS+RNRLQSI+ D++FL   V+P FPD+P++PNERCGLWY
Sbjct: 1   MDPLLLESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWY 60

Query: 86  CNPESFSQMSYFKSTDGHINQWDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALS 145
             PE F Q SYFKSTDGH NQWDFSTRRLNFHL P++   GGI+I+DSTRRGKKIPDALS
Sbjct: 61  VPPEDFKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALS 120

Query: 146 KTIPIWCAVINTLILEASNRSE-----EVLFCPPGTVPQSEYDRIKNRIPSLVEKLKNLG 200
           KTIPIWCAV+N ++L +   S+     +VLF PP T+ ++EYD I  RIP LV KL  L 
Sbjct: 121 KTIPIWCAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLD 180

Query: 201 IVSGDELLKQFGGKILRPLWVYPGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFLPVILCT 260
           IV G+EL     GK+LRP WVYPGSSL  SS D+FTG+ T    W  P+  + +P+ILCT
Sbjct: 181 IVDGNELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEIT-GDSWNVPQHANIIPIILCT 239

Query: 261 ASYQCQDGVDKRYGFTYVQGAADDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVNK 320
            SY+ QDG DKR+GFTYVQGAADDHELW+EGLTP +FW + NF  +   +E+++ ++V  
Sbjct: 240 ISYRAQDGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVET 299

Query: 321 QKREATERTKEASGNDLNQCFS-VDAITKELHLGTVVDGLELNEKLLSQLDSRYALTVVL 379
             +E  +  +++   D+N  F  +D +T +L LG + D + + + L  +L  R+AL+++L
Sbjct: 300 LVQEQDDAGEQS---DINDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIIL 356

Query: 380 SESVKIASIQENPN----TKIFPLTSGNKKSSKELRSKLIEICPLIQASLNSPL--PILI 433
           SE+V++  + +N N    T IF L SG+KKSSK LR+K+ EI  L+++ +N+ L  PILI
Sbjct: 357 SENVELDPV-DNENLPISTHIFKLQSGSKKSSKLLRNKIEEIIGLVESQMNNALNKPILI 415

Query: 434 CCNTGKDMSVGVLLATLCQNYDEDWCIGSPNS--FNKTIIRKHLTRLISHLKGRNVNPSR 491
           CCNTG DMS+G+LLA LC+NY E W +G   +   +K +IRK LTRLISHL+GR +N SR
Sbjct: 416 CCNTGTDMSIGILLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLISHLEGRTINTSR 475

Query: 492 ATLNSVNAYLM 502
           ATLNSVN YLM
Sbjct: 476 ATLNSVNNYLM 486

>TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}
           Anc_8.848 YMR283C
          Length = 493

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/492 (54%), Positives = 353/492 (71%), Gaps = 26/492 (5%)

Query: 33  SLNLIKKEIKKEYKSLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGLWYCNPESFS 92
           S+N I K+I+KE KSL+NR+ SI+ D +FL   VIP FP YPLVPNERCGLWYC   +F+
Sbjct: 6   SVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCKRANFT 64

Query: 93  QMSYFKSTDGHINQWDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALSKTIPIWC 152
             SYFKSTDGHINQWDFSTRRLNFHL+P I +  GI+IIDSTRRGKKIPDALSKT+PIWC
Sbjct: 65  TTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPIWC 124

Query: 153 AVINTLILE----ASNRSEEVLFCPPGTVPQSEYDRIKNRIPSLVEKLKNLGIVSGDELL 208
           AV+NT+IL+      ++S EVLF PP TV +SEY+RIKN+IP LVEKL  L ++ G +L 
Sbjct: 125 AVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKKLY 184

Query: 209 KQFGGKILRPLWVYPGSSLFSSSTDIFTGKQTRSQKWEKP-EDQDFLPVILCTASYQCQD 267
           +QF G +LRP+W++PGSS+  S  D FTG+   +  WE+P +++  +P++LCT SYQ QD
Sbjct: 185 EQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNSSWEEPSKEEKIIPIVLCTVSYQVQD 244

Query: 268 GVDKRYGFTYVQGAADDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVNKQKREATE 327
           GVD R GFTYVQGAADDHELW+ GL+P +FWDN   L +   SE+ L +YV +       
Sbjct: 245 GVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIELLNNLELSEEMLEDYVEEI---LLS 301

Query: 328 RTKEASGNDLNQCF-SVDAITKELHLGTVVDGLELNEKLLSQLDSRYALTVVLSESVKIA 386
            + + +  +++  F S+D IT+EL+LG +VDGLE+ + L+   +  Y+L ++LS S+K+A
Sbjct: 302 ESMKITNLEVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIKLA 361

Query: 387 SIQENPNT-----------KIFPLTSGNKKSSKELRSKLIEICPLIQASLNSP----LPI 431
           S ++N  +           K+F L SG+KKSSKELRS L EIC L+   L+S      PI
Sbjct: 362 SDEQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTKKPI 421

Query: 432 LICCNTGKDMSVGVLLATLCQNYDEDWCIGSPNS-FNKTIIRKHLTRLISHLKGRNVNPS 490
           L+CCN G DMS+ V+L TL + Y ++W   S ++  NK  IRKHLT++ISHL GRNVNPS
Sbjct: 422 LVCCNNGSDMSIAVILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRNVNPS 481

Query: 491 RATLNSVNAYLM 502
           RATLNSVN +LM
Sbjct: 482 RATLNSVNDFLM 493

>ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]
           {ON} similar to uniprot|P23796 Saccharomyces cerevisiae
           YMR283C RIT1 Modifies initiator methionine tRNA to
           distinguish it from elongator methionine tRNA Initiator
           methionine tRNA 2'-O-ribosyl phosphate transferase
          Length = 472

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/481 (54%), Positives = 345/481 (71%), Gaps = 13/481 (2%)

Query: 26  MDTETLKSLNLIKKEIKKEYKSLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGLWY 85
           MD +   SLN I ++IKKEY SLRNR+QSI++D+ F+   VIP FP+YPL+PNERCGLWY
Sbjct: 1   MDPDLAFSLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWY 60

Query: 86  CNPESFSQMSYFKSTDGHINQWDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALS 145
           C+P+ F Q SYFKSTDGH NQWDFSTRRLN HLLP + +  GI+I+DSTRRGK +PDALS
Sbjct: 61  CDPKDFDQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALS 120

Query: 146 KTIPIWCAVINTLILEASNRSEEVLFCPPGTVPQSEYDRIKNRIPSLVEKLKNLGIVSGD 205
           KTIPIWCAV+N+L+        EVLF PP  V QSE+D IK RIPSLV++L+ L I+   
Sbjct: 121 KTIPIWCAVLNSLM---QPDKSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDILDAQ 177

Query: 206 ELLKQFGGKILRPLWVYPGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFLPVILCTASYQC 265
           +L  +F GKILRP WVYPGS +  SSTD FTG+    Q WE   ++  +P+ILCTASY+ 
Sbjct: 178 DLRNKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQ-WEPGPNEQIIPIILCTASYRA 236

Query: 266 QDGVDKRYGFTYVQGAADDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVNKQKREA 325
           QDGVDKR+GFTYVQGAADDHELW+ GL P + W+N ++  D  ++++EL  +V K   E 
Sbjct: 237 QDGVDKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHV-KTLIEL 295

Query: 326 TERTKEASGNDLNQCFSVDAITKELHLGTVVDGLELNEKLLSQLDSRYALTVVLSESVKI 385
            E T     N L     +D ITKEL LG + D   +   +  +LDS+++L ++LS+SV +
Sbjct: 296 AETTDHR--NHLADIVEMDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQSVTL 353

Query: 386 ASIQENPNTKIFPLTSGNKKSSKELRSKLIEICPLIQASLNSPL----PILICCNTGKDM 441
           +  +     K + L SG+K+SSK+LR+ LIEI  ++ A LN  +    PI++CCN+G D+
Sbjct: 354 S--KPFDFIKTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVKRKPIMVCCNSGTDI 411

Query: 442 SVGVLLATLCQNYDEDWCIGSPNSFNKTIIRKHLTRLISHLKGRNVNPSRATLNSVNAYL 501
           SVGV+L  LC+ Y +DW +G P+S NK +IR+HL ++I+ +K RNVNPSRATLNS+N++L
Sbjct: 412 SVGVILMILCKYYSQDWLLGKPDSVNKFVIRRHLVQIINKIKRRNVNPSRATLNSINSFL 471

Query: 502 M 502
           M
Sbjct: 472 M 472

>KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {ON}
           Anc_8.848 YMR283C
          Length = 483

 Score =  510 bits (1313), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 267/485 (55%), Positives = 347/485 (71%), Gaps = 15/485 (3%)

Query: 31  LKSLNLIKKEIKKEYKSLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGLWYCNPES 90
           + SL+ IKK+IK EY+SL+NRLQSII D+ FL   V+P FP+YP++PNERCGLWYC+P+ 
Sbjct: 1   MDSLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKH 60

Query: 91  FSQMSYFKSTDGHINQWDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALSKTIPI 150
           F Q SYFKSTDGHINQWDFSTRRLNFHLLP +A+  GI+I+DSTRRGKKIPDALSKTIPI
Sbjct: 61  FEQTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPI 120

Query: 151 WCAVINTLILE-ASNRS---EEVLFCPPGTVPQSEYDRIKNRIPSLVEKLKNLGIVSGDE 206
           WCAV+N LILE ASN     E+VLF PP TV  SEY RI  +I  LV KLK L ++   E
Sbjct: 121 WCAVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKE 180

Query: 207 LLKQFGGKILRPLWVYPGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFLPVILCTASYQCQ 266
           L     GK++RP WVYPGSSL  +  D FTG+ T  ++W  PE+++ +P+ILCT SYQ Q
Sbjct: 181 LYNMTNGKLIRPFWVYPGSSLLHTIVDPFTGEPT-GERWSVPENENIIPIILCTVSYQAQ 239

Query: 267 DGVDKRYGFTYVQGAADDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVNKQKREAT 326
           DGVDKR GF YVQGAADDHELW+ GL P  FW+N ++L D  K++  L E+V+    E  
Sbjct: 240 DGVDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLTLEEN 299

Query: 327 ERTKEASGNDLNQCFSVDAITKELHLGTVVDGLELNEKLLSQLDSRYALTVVLSESVKIA 386
              K+AS + ++   S++ +T E+ LG ++D   ++ KL  +L  +++L ++LSE+++I 
Sbjct: 300 HE-KKASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETIEIT 358

Query: 387 SIQENPN--TKIFPLTSGNKKSSKELRSKLIEIC----PLIQASLN-SPLPILICCNTGK 439
            ++E      K+F L SG+KKSSK LR +L EI     P  Q + N +  PILICCN+G 
Sbjct: 359 KLEEATTKIIKLFKLQSGSKKSSKSLRLQLPEIFDTINPYFQDASNLAKKPILICCNSGN 418

Query: 440 DMSVGVLLATLCQNYDEDWCIGSPNSF--NKTIIRKHLTRLISHLKGRNVNPSRATLNSV 497
           DMSV V+L  L + Y E W + + +    +KT+IRKHL +LIS L+GRNVNPSRATLNS+
Sbjct: 419 DMSVAVILTILSKKYSEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSRATLNSI 478

Query: 498 NAYLM 502
           N+YLM
Sbjct: 479 NSYLM 483

>AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR283C
           (RIT1)
          Length = 408

 Score =  453 bits (1166), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 217/407 (53%), Positives = 287/407 (70%), Gaps = 5/407 (1%)

Query: 96  YFKSTDGHINQWDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALSKTIPIWCAVI 155
           YFKSTDGH+N WDFS RRLNFHLLP +A+  G +I+DSTRRGKKIPDALSKTIPIWCAV+
Sbjct: 7   YFKSTDGHVNGWDFSVRRLNFHLLPLLAERSGAIIVDSTRRGKKIPDALSKTIPIWCAVL 66

Query: 156 NTLILEASNRSEEVLFCPPGTVPQSEYDRIKNRIPSLVEKLKNLGIVSGDELLKQFGGKI 215
           NTLILE +  S EVLFCPPGTV Q EY+RI+ ++P LV+KLK +  +SG EL    GG++
Sbjct: 67  NTLILEHTEGSGEVLFCPPGTVSQLEYNRIQAKLPELVQKLKRVDAISGAELCSLLGGRL 126

Query: 216 LRPLWVYPGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFLPVILCTASYQCQDGVDKRYGF 275
           LRP WVYPG+++  ++ D+FTG ++  + W+ P     +P+ILCTAS QCQDGVDK  G+
Sbjct: 127 LRPFWVYPGAAMLGTTRDLFTG-ESLQEPWQPPP--GVIPLILCTASRQCQDGVDKSQGY 183

Query: 276 TYVQGAADDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVNKQKREATERTKEASGN 335
            YVQGAADDHELWA GLTP +FW N   L D++  EQ L  +V +          EA  +
Sbjct: 184 AYVQGAADDHELWANGLTPSLFWANVQLLADDSMPEQLLQGHVERIVELHKSTHTEAVAH 243

Query: 336 DLNQCFSVDAITKELHLGTVVDGLELNEKLLSQLDSRYALTVVLSESVKIASIQENPNTK 395
           +L  C   D +T+ L LG+V    ++++K    L+ +Y+L V+   S+++++   +P  +
Sbjct: 244 EL-PCRETDVVTEHLRLGSVAP-CQISDKQAELLEQQYSLVVLCGSSIELSAAAPHPRIR 301

Query: 396 IFPLTSGNKKSSKELRSKLIEICPLIQASLNSPLPILICCNTGKDMSVGVLLATLCQNYD 455
           I+PL SG KKSS+ LR  LIEI PLI  +L   LP+LICC++G D+SVG++LA LC+NYD
Sbjct: 302 IYPLNSGCKKSSRALRPALIEIIPLISTALCEALPVLICCSSGSDISVGIVLAALCKNYD 361

Query: 456 EDWCIGSPNSFNKTIIRKHLTRLISHLKGRNVNPSRATLNSVNAYLM 502
            +W         KTII+KHL +L S + GR +NPSR TLNSVNA+LM
Sbjct: 362 LEWRHEDQKDMTKTIIKKHLIKLTSKIHGRIINPSRTTLNSVNAFLM 408

>ZYRO0F01738g Chr6 complement(139924..141310,141381..141406) [1413
           bp, 470 aa] {ON} similar to uniprot|P46957 Saccharomyces
           cerevisiae YJR006W HYS2 DNA polymerase III (delta) 55
           kDa subunit essential for cell viability involved in DNA
           replication and DNA repair
          Length = 470

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 45/86 (52%), Gaps = 5/86 (5%)

Query: 128 IVIIDSTRRGKKIPDALSKTIPIWCAVINTLILEASNRSEEVL-FCPPGTVPQS---EYD 183
           +++ D + R   + D +SKT  +   VI  L +EA   + +VL  C P  +PQS   ++D
Sbjct: 139 VMLEDESGRVLLVGDYISKTPFVTGTVIGVLGMEAEAGTFQVLDICYPTPLPQSPLPKHD 198

Query: 184 RIKNRIPSLVEKLKNLGIVSGDELLK 209
           +  NR  +L+  L NL   S   LLK
Sbjct: 199 KHDNRKIALISGL-NLNSTSPGRLLK 223

>SAKL0E04994g Chr5 complement(405972..407747) [1776 bp, 591 aa] {ON}
           conserved hypothetical protein
          Length = 591

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 3/60 (5%)

Query: 266 QDGVDKRYGFTYVQGA-ADDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVNKQKRE 324
           +D V+  Y FT  +G  AD H  +A G   D F ++  + G++ ++  + +E+V K  RE
Sbjct: 433 EDIVEYNYNFTGTEGGYADTHPAFASG--QDAFLESLEWAGEKNETYWQAVEFVAKTSRE 490

>NCAS0A15240 Chr1 (2995132..2995503) [372 bp, 123 aa] {ON} Anc_2.436
           YMR112C
          Length = 123

 Score = 30.0 bits (66), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 26/43 (60%)

Query: 384 KIASIQENPNTKIFPLTSGNKKSSKELRSKLIEICPLIQASLN 426
           ++  + EN  T++ P+T+ NKK+  +   KLIE   L++  LN
Sbjct: 70  EVKLLDENIGTRLLPITNVNKKAVGQDDEKLIEQIALLKKVLN 112

>KNAG0K01840 Chr11 (381573..382955) [1383 bp, 460 aa] {ON} Anc_3.147
           YDL044C
          Length = 460

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 318 VNKQKREATERTKEASGNDLNQCFSVDAITKELHLGTVVDGLELNEKLLSQL 369
             KQKR+  +R   ASG+ L Q   +  I+K+LH+   +  +E  E+  ++L
Sbjct: 188 AGKQKRKTLDRVDGASGSALEQTAPLPEISKDLHID--LQKVEAEERFKAEL 237

>TPHA0G01220 Chr7 complement(248183..250429) [2247 bp, 748 aa] {ON}
           Anc_8.772 YMR237W
          Length = 748

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 12/65 (18%)

Query: 371 SRYALTVVLSESVKIASIQENPNTKIFPLTSGNKKSSKELRSKLIEICPLIQASLNSPLP 430
           +R  L   + ES+++ +I  NP+ K+   T       KEL S +I++C            
Sbjct: 633 ARRLLEYCVKESIRVKNISNNPDIKVNTTTEEVTNRIKELNSSIIDLC------------ 680

Query: 431 ILICC 435
           + ICC
Sbjct: 681 VKICC 685

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,833,104
Number of extensions: 2532973
Number of successful extensions: 8631
Number of sequences better than 10.0: 41
Number of HSP's gapped: 8826
Number of HSP's successfully gapped: 41
Length of query: 502
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 388
Effective length of database: 40,409,475
Effective search space: 15678876300
Effective search space used: 15678876300
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)