Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0D01232gna 1ON57457426530.0
Kwal_0.16singletonON56456119140.0
Kwal_23.4458na 2ON56554518460.0
KLLA0E14675gsingletonON57357518470.0
KLTH0G10736gsingletonON56856718170.0
KLLA0E24993gsingletonON56857018100.0
KLTH0B08140gna 2ON56856717960.0
Ecym_4621na 1ON57255317440.0
ABL116Cna 1ON54451215250.0
SAKL0G15136g5.112ON56955614900.0
SAKL0G14762gsingletonON56554414700.0
ZYRO0G01474gsingletonON57256314390.0
Suva_4.38na 3ON57154014170.0
NCAS0D016005.112ON57657514160.0
NDAI0C031505.112ON57454014040.0
TDEL0G013705.112ON56956713970.0
KNAG0K01030singletonON58154613930.0
YDL210W (UGA4)na 3ON57154013880.0
Smik_4.30na 3ON57154013860.0
Skud_4.46na 3ON57155013750.0
ZYRO0B15048gsingletonON58255613710.0
SAKL0E14806gna 4ON57856113590.0
KLLA0E12959gna 4ON57956613461e-180
KNAG0E008205.112ON57153613341e-179
KLTH0E01144gna 4ON57257613141e-175
Kwal_55.19721na 4ON57757013121e-175
Skud_7.2056.205ON5625523051e-28
NCAS0D037506.205ON5695453023e-28
SAKL0A04730g6.205ON5415003004e-28
KNAG0D051406.205ON5435042961e-27
Smik_7.2066.205ON5635652952e-27
YGL077C (HNM1)6.205ON5634982917e-27
TDEL0G014106.205ON5535232854e-26
KLLA0C15521g6.205ON5475282845e-26
AFL081W6.205ON5424792829e-26
KLTH0H04444g6.205ON5324882783e-25
ZYRO0G08602g6.205ON5695552783e-25
TPHA0E029206.205ON5865112758e-25
TBLA0A019606.205ON5945542741e-24
Ecym_22126.205ON5455132731e-24
Kpol_1033.416.205ON5865452732e-24
NDAI0I011406.205ON6004832642e-23
Suva_7.1936.205ON5633132571e-22
CAGL0H03399g6.205ON5565082543e-22
KAFR0K003606.205ON5383162241e-18
Kwal_56.240096.205ON3422942163e-18
TBLA0C057401.173ON6595451691e-11
CAGL0M08272g1.173ON6215181672e-11
ZYRO0F00242gsingletonON5354771572e-10
Kthe_YGOB_SAKL0H11484gna 5ON5562421563e-10
Ecym_81051.173ON5833671563e-10
ZYRO0G18700g1.173ON5915101465e-09
Smik_14.390na 5ON5544591431e-08
YNR056C (BIO5)na 5ON5613771421e-08
KLTH0F04576g1.173ON5493621421e-08
Kwal_55.19602na 5ON5582351412e-08
Kwal_33.138061.173ON5493611323e-07
Skud_14.392na 5ON5313751305e-07
SAKL0H11484gna 5ON5602261261e-06
AEL125C1.173ON5753621252e-06
KAFR0G003901.173ON6073741215e-06
NCAS0B083501.173ON6123631207e-06
SAKL0C05126g1.173ON5685311191e-05
TDEL0G04830singletonON5431451181e-05
NDAI0A008901.173ON6413661181e-05
KLLA0A06666g1.173ON5603561162e-05
Kpol_2002.701.173ON6225071162e-05
Suva_14.415na 5ON5321401143e-05
TPHA0E033501.173ON6473211127e-05
KLLA0B00385gna 5ON5642251000.002
KNAG0C009801.173ON7143681000.002
SAKL0D00836gna 6ON601192990.002
YKL174C (TPO5)1.173ON618360920.016
Kwal_33.14276na 6ON596126910.021
TBLA0B077605.158ON658100880.054
Suva_11.491.173ON619374840.12
TPHA0A002405.158ON603103820.22
Kpol_1010.325.158ON599107820.25
TDEL0C061701.84ON573154810.34
Smik_11.551.173ON619360790.61
Skud_11.511.173ON616368790.63
Suva_7.4855.158ON603153770.99
AER412W2.203ON9857701.2
TPHA0B010901.244ON606119751.6
Suva_16.18na 7ON58378751.8
YLL061W (MMP1)na 8ON58378751.8
Skud_11.2751.244ON60291742.0
CAGL0B03773g5.158ON60549742.1
TDEL0H04510singletonON584137742.1
Smik_12.2na 8ON58378742.1
ZYRO0D03762g1.244ON60072742.4
TDEL0E05700singletonON584137732.8
TPHA0G03770singletonON60478733.1
Skud_7.5255.158ON60380733.1
YKR039W (GAP1)1.244ON60291733.2
KLTH0C08052gna 7ON599187723.3
Kwal_23.4026singletonON534113714.5
Smik_11.3021.244ON55391714.6
KLLA0B06776gna 7ON588122714.7
Suva_11.2731.244ON60191715.2
YGR191W (HIP1)5.158ON603152705.7
Kwal_56.22951na 7ON596125705.8
TPHA0A047005.158ON56949706.3
TPHA0A025001.368ON59060706.4
NCAS0D018705.158ON59580706.7
CAGL0E01089g8.342ON85389707.0
KLTH0E15642g1.244ON59669697.6
NCAS0A071105.158ON592105698.0
KAFR0E018505.158ON56036698.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0D01232g
         (574 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0D01232g Chr4 complement(90918..92642) [1725 bp, 574 aa] {ON...  1026   0.0  
Kwal_0.16 s0 complement(7307..9001) [1695 bp, 564 aa] {ON} YDL21...   741   0.0  
Kwal_23.4458 s23 (729606..731303) [1698 bp, 565 aa] {ON} YDL210W...   715   0.0  
KLLA0E14675g Chr5 (1312581..1314302) [1722 bp, 573 aa] {ON} simi...   716   0.0  
KLTH0G10736g Chr7 complement(902899..904605) [1707 bp, 568 aa] {...   704   0.0  
KLLA0E24993g Chr5 complement(2214864..2216570) [1707 bp, 568 aa]...   701   0.0  
KLTH0B08140g Chr2 complement(659691..661397) [1707 bp, 568 aa] {...   696   0.0  
Ecym_4621 Chr4 complement(1216034..1217752) [1719 bp, 572 aa] {O...   676   0.0  
ABL116C Chr2 complement(181138..181889,181944..182826) [1635 bp,...   592   0.0  
SAKL0G15136g Chr7 complement(1303874..1305583) [1710 bp, 569 aa]...   578   0.0  
SAKL0G14762g Chr7 complement(1265378..1267075) [1698 bp, 565 aa]...   570   0.0  
ZYRO0G01474g Chr7 complement(113623..115341) [1719 bp, 572 aa] {...   558   0.0  
Suva_4.38 Chr4 (72470..74185) [1716 bp, 571 aa] {ON} YDL210W (REAL)   550   0.0  
NCAS0D01600 Chr4 (299803..301533) [1731 bp, 576 aa] {ON} Anc_5.112    550   0.0  
NDAI0C03150 Chr3 complement(717726..719450) [1725 bp, 574 aa] {O...   545   0.0  
TDEL0G01370 Chr7 (274664..276373) [1710 bp, 569 aa] {ON} Anc_5.112    542   0.0  
KNAG0K01030 Chr11 (202385..204130) [1746 bp, 581 aa] {ON} Anc_8....   541   0.0  
YDL210W Chr4 (84270..85985) [1716 bp, 571 aa] {ON}  UGA4Permease...   539   0.0  
Smik_4.30 Chr4 (62468..64183) [1716 bp, 571 aa] {ON} YDL210W (REAL)   538   0.0  
Skud_4.46 Chr4 (81451..83166) [1716 bp, 571 aa] {ON} YDL210W (REAL)   534   0.0  
ZYRO0B15048g Chr2 complement(1226178..1227926) [1749 bp, 582 aa]...   532   0.0  
SAKL0E14806g Chr5 (1222639..1224375) [1737 bp, 578 aa] {ON} simi...   528   0.0  
KLLA0E12959g Chr5 complement(1146299..1148038) [1740 bp, 579 aa]...   523   e-180
KNAG0E00820 Chr5 (152560..154275) [1716 bp, 571 aa] {ON} Anc_5.112    518   e-179
KLTH0E01144g Chr5 complement(113309..115027) [1719 bp, 572 aa] {...   510   e-175
Kwal_55.19721 s55 complement(95893..97626) [1734 bp, 577 aa] {ON...   509   e-175
Skud_7.205 Chr7 complement(365478..367166) [1689 bp, 562 aa] {ON...   122   1e-28
NCAS0D03750 Chr4 complement(696686..698395) [1710 bp, 569 aa] {O...   120   3e-28
SAKL0A04730g Chr1 (432222..433847) [1626 bp, 541 aa] {ON} simila...   120   4e-28
KNAG0D05140 Chr4 complement(937630..939261) [1632 bp, 543 aa] {O...   118   1e-27
Smik_7.206 Chr7 complement(356650..358341) [1692 bp, 563 aa] {ON...   118   2e-27
YGL077C Chr7 complement(362225..363916) [1692 bp, 563 aa] {ON}  ...   116   7e-27
TDEL0G01410 Chr7 (285255..286916) [1662 bp, 553 aa] {ON} Anc_6.2...   114   4e-26
KLLA0C15521g Chr3 complement(1347098..1348741) [1644 bp, 547 aa]...   114   5e-26
AFL081W Chr6 (286339..287967) [1629 bp, 542 aa] {ON} Syntenic ho...   113   9e-26
KLTH0H04444g Chr8 (397467..399065) [1599 bp, 532 aa] {ON} simila...   111   3e-25
ZYRO0G08602g Chr7 complement(697178..698887) [1710 bp, 569 aa] {...   111   3e-25
TPHA0E02920 Chr5 (612901..614661) [1761 bp, 586 aa] {ON} Anc_6.2...   110   8e-25
TBLA0A01960 Chr1 complement(473787..475571) [1785 bp, 594 aa] {O...   110   1e-24
Ecym_2212 Chr2 (417948..419585) [1638 bp, 545 aa] {ON} similar t...   109   1e-24
Kpol_1033.41 s1033 complement(106505..108265) [1761 bp, 586 aa] ...   109   2e-24
NDAI0I01140 Chr9 (276535..278337) [1803 bp, 600 aa] {ON} Anc_6.205    106   2e-23
Suva_7.193 Chr7 complement(355063..356754) [1692 bp, 563 aa] {ON...   103   1e-22
CAGL0H03399g Chr8 complement(316110..317780) [1671 bp, 556 aa] {...   102   3e-22
KAFR0K00360 Chr11 (79233..80849) [1617 bp, 538 aa] {ON} Anc_6.20...    91   1e-18
Kwal_56.24009 s56 complement(812371..813399) [1029 bp, 342 aa] {...    88   3e-18
TBLA0C05740 Chr3 complement(1391698..1393677) [1980 bp, 659 aa] ...    70   1e-11
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    69   2e-11
ZYRO0F00242g Chr6 (26301..27908) [1608 bp, 535 aa] {ON} similar ...    65   2e-10
Kthe_YGOB_SAKL0H11484g Chr5 complement(59674..60886,60889..61346...    65   3e-10
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    65   3e-10
ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} simi...    61   5e-09
Smik_14.390 Chr14 complement(688421..690085) [1665 bp, 554 aa] {...    60   1e-08
YNR056C Chr14 complement(731618..733303) [1686 bp, 561 aa] {ON} ...    59   1e-08
KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {...    59   1e-08
Kwal_55.19602 s55 (43521..45197) [1677 bp, 558 aa] {ON} YNR056C ...    59   2e-08
Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {...    55   3e-07
Skud_14.392 Chr14 complement(699671..701266) [1596 bp, 531 aa] {...    55   5e-07
SAKL0H11484g Chr8 complement(983765..985447) [1683 bp, 560 aa] {...    53   1e-06
AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON} S...    53   2e-06
KAFR0G00390 Chr7 complement(115188..117011) [1824 bp, 607 aa] {O...    51   5e-06
NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON} Anc_1...    51   7e-06
SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {...    50   1e-05
TDEL0G04830 Chr7 complement(891989..893620) [1632 bp, 543 aa] {O...    50   1e-05
NDAI0A00890 Chr1 complement(181903..183828) [1926 bp, 641 aa] {O...    50   1e-05
KLLA0A06666g Chr1 complement(603169..604851) [1683 bp, 560 aa] {...    49   2e-05
Kpol_2002.70 s2002 complement(159457..161325) [1869 bp, 622 aa] ...    49   2e-05
Suva_14.415 Chr14 complement(716463..718061) [1599 bp, 532 aa] {...    49   3e-05
TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.1...    48   7e-05
KLLA0B00385g Chr2 complement(25847..27541) [1695 bp, 564 aa] {ON...    43   0.002
KNAG0C00980 Chr3 complement(191133..193277) [2145 bp, 714 aa] {O...    43   0.002
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...    43   0.002
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    40   0.016
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...    40   0.021
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...    39   0.054
Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {O...    37   0.12 
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...    36   0.22 
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....    36   0.25 
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...    36   0.34 
Smik_11.55 Chr11 complement(105857..107716) [1860 bp, 619 aa] {O...    35   0.61 
Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {O...    35   0.63 
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...    34   0.99 
AER412W Chr5 (1429639..1429935) [297 bp, 98 aa] {ON} Syntenic ho...    32   1.2  
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...    33   1.6  
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...    33   1.8  
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...    33   1.8  
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...    33   2.0  
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...    33   2.1  
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...    33   2.1  
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)     33   2.1  
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...    33   2.4  
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...    33   2.8  
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...    33   3.1  
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...    33   3.1  
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...    33   3.2  
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...    32   3.3  
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...    32   4.5  
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...    32   4.6  
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...    32   4.7  
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...    32   5.2  
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...    32   5.7  
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...    32   5.8  
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...    32   6.3  
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...    32   6.4  
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...    32   6.7  
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...    32   7.0  
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...    31   7.6  
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...    31   8.0  
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...    31   8.5  

>SAKL0D01232g Chr4 complement(90918..92642) [1725 bp, 574 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 574

 Score = 1026 bits (2653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/574 (89%), Positives = 512/574 (89%)

Query: 1   MSDSSSYVEKNQIKTSARELHPIVSANANGEVQQITSLRTITSKRAGEVNYINAKAAHDD 60
           MSDSSSYVEKNQIKTSARELHPIVSANANGEVQQITSLRTITSKRAGEVNYINAKAAHDD
Sbjct: 1   MSDSSSYVEKNQIKTSARELHPIVSANANGEVQQITSLRTITSKRAGEVNYINAKAAHDD 60

Query: 61  TELLAEIGYKQELNRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGA 120
           TELLAEIGYKQELNRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGA
Sbjct: 61  TELLAEIGYKQELNRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGA 120

Query: 121 FILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYG 180
           FILSVGAGMAELASAIPTSGGL       APPKFKKVLSFLIGNSNSLALIACLCSIDYG
Sbjct: 121 FILSVGAGMAELASAIPTSGGLYYYTYYYAPPKFKKVLSFLIGNSNSLALIACLCSIDYG 180

Query: 181 LAQEILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXX 240
           LAQEILSIVVISKDGDFEITNAKTYGVYAGCII              KLQTFSIVSN   
Sbjct: 181 LAQEILSIVVISKDGDFEITNAKTYGVYAGCIIATTLLTSVATVAVSKLQTFSIVSNVLL 240

Query: 241 XXXXXXXXXXGVSQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSC 300
                     GVSQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSC
Sbjct: 241 IIFFLIVLPIGVSQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSC 300

Query: 301 IHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQIL 360
           IHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQIL
Sbjct: 301 IHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQIL 360

Query: 361 YNALGKKWAMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSP 420
           YNALGKKWAMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSP
Sbjct: 361 YNALGKKWAMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSP 420

Query: 421 LRATWFXXXXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAF 480
           LRATWF               STASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAF
Sbjct: 421 LRATWFGGAGALCIGLLCLIGSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAF 480

Query: 481 YMGNFWSPVINWTSXXXXXXXXXXXXXPSSQHNITADTMNYTCVFVGFVWFGSIAYYYFY 540
           YMGNFWSPVINWTS             PSSQHNITADTMNYTCVFVGFVWFGSIAYYYFY
Sbjct: 481 YMGNFWSPVINWTSIIFEIFIIIMMMFPSSQHNITADTMNYTCVFVGFVWFGSIAYYYFY 540

Query: 541 KHRTFHGPKSNLTDDEFVDAVGQDVIDEILSNQK 574
           KHRTFHGPKSNLTDDEFVDAVGQDVIDEILSNQK
Sbjct: 541 KHRTFHGPKSNLTDDEFVDAVGQDVIDEILSNQK 574

>Kwal_0.16 s0 complement(7307..9001) [1695 bp, 564 aa] {ON} YDL210W
           (UGA4) - GABA-specific transport protein [contig 75]
           FULL
          Length = 564

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/561 (65%), Positives = 414/561 (73%)

Query: 12  QIKTSARELHPIVSANANGEVQQITSLRTITSKRAGEVNYINAKAAHDDTELLAEIGYKQ 71
            IK    E+    S NA GE+ +  SLRTITSKRAGEVNYINAK AHDDTELLAEIGYKQ
Sbjct: 3   DIKQPVGEITREFSPNAVGEIHEYRSLRTITSKRAGEVNYINAKTAHDDTELLAEIGYKQ 62

Query: 72  ELNRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFILSVGAGMAE 131
           EL+RHFST+QVFGIAFSIMGLLPSIAS+L MAF GG +S VWGWLISG F+L +G  M+E
Sbjct: 63  ELSRHFSTLQVFGIAFSIMGLLPSIASVLLMAFPGGMVSFVWGWLISGFFVLLIGCSMSE 122

Query: 132 LASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVVI 191
           LASAIPTSGGL       AP +FK +LSFLIGNSN+LAL A LCS+ YG AQE+L+IVVI
Sbjct: 123 LASAIPTSGGLYYYTYYYAPKRFKSLLSFLIGNSNTLALTAGLCSVTYGFAQEVLAIVVI 182

Query: 192 SKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXXXG 251
           SKDG+FE+TN   YGVYA  I+              +LQT SIVSN             G
Sbjct: 183 SKDGNFELTNGMIYGVYAAGIVATMMVTSVATVAVSRLQTVSIVSNLALIAFFLIVLPIG 242

Query: 252 VSQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNAT 311
           VS++  + FN G FIFGN+ N   W DGW+FM+ GFQP VW IGAFDSCIHMSEEAKNAT
Sbjct: 243 VSKTKWLDFNDGSFIFGNWTNETTWPDGWQFMMTGFQPAVWTIGAFDSCIHMSEEAKNAT 302

Query: 312 KAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKKWAMT 371
           KAVP GIL SISVCW+VGFFI IAI ACMG +I AILD+ YG PLAQILYNALGKKW M 
Sbjct: 303 KAVPAGILGSISVCWVVGFFICIAIAACMGPDIDAILDSAYGSPLAQILYNALGKKWTMA 362

Query: 372 FMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXXXXX 431
           FMTLIAFCQF+MG S LTAISRQIWAFARDDGL FS  IK VN KLSSPLRATWF     
Sbjct: 363 FMTLIAFCQFVMGCSILTAISRQIWAFARDDGLMFSKHIKVVNKKLSSPLRATWFGAAGA 422

Query: 432 XXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFWSPVIN 491
                      TAS ALFSMYIAANY +WM PNLLRMTTGK++F PGAFYMG+FWSP++N
Sbjct: 423 LVIGLLCLIGGTASNALFSMYIAANYLSWMMPNLLRMTTGKDVFKPGAFYMGDFWSPIVN 482

Query: 492 WTSXXXXXXXXXXXXXPSSQHNITADTMNYTCVFVGFVWFGSIAYYYFYKHRTFHGPKSN 551
           WTS             P+ +  IT DTMNYT V  G VW GS+AY+  YKH+ FHGPKSN
Sbjct: 483 WTSIAFELFIIVMMMFPTEKTGITPDTMNYTIVICGAVWLGSLAYFLTYKHKYFHGPKSN 542

Query: 552 LTDDEFVDAVGQDVIDEILSN 572
           L+D EF  AVGQDVID+ILS+
Sbjct: 543 LSDAEFDKAVGQDVIDQILSH 563

>Kwal_23.4458 s23 (729606..731303) [1698 bp, 565 aa] {ON} YDL210W
           (UGA4) - 1:1 [contig 2] FULL
          Length = 565

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/545 (64%), Positives = 405/545 (74%)

Query: 30  GEVQQITSLRTITSKRAGEVNYINAKAAHDDTELLAEIGYKQELNRHFSTIQVFGIAFSI 89
           GE++QI SLRTITSKRAGEVN+I+AK A DD ELLAEIGYKQELNRHFST+QVFG+AFSI
Sbjct: 19  GEIRQIGSLRTITSKRAGEVNFIDAKGARDDKELLAEIGYKQELNRHFSTVQVFGVAFSI 78

Query: 90  MGLLPSIASILGMAFAGGAISLVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXX 149
           MGLLPSIAS+L + FAGGA++LVWGWLI+G FI+++G  MAELASAIPTSGGL       
Sbjct: 79  MGLLPSIASVLSIGFAGGAVALVWGWLIAGFFIMTIGLSMAELASAIPTSGGLYYYTYYY 138

Query: 150 APPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGVYA 209
           AP +FK  LSF+IGNSNSLAL A LCSI YGLA EILSIVV+SKDG+FEITN KTYGVY 
Sbjct: 139 APQRFKSFLSFVIGNSNSLALTAGLCSITYGLALEILSIVVVSKDGNFEITNGKTYGVYV 198

Query: 210 GCIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXXXGVSQSDDVTFNGGKFIFGN 269
           G I               K+QT SI+SN             GVS +  + FN G FIFG 
Sbjct: 199 GGIAATAVVTSVATVAVSKMQTLSIISNVALIAFFLIVLPIGVSNTKGLEFNDGSFIFGK 258

Query: 270 FENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVG 329
           F N   W DGW+F++AG QP +W IGAFDSCIHMSEEAKNATKAVPIGI++SI VCW++G
Sbjct: 259 FMNETSWPDGWQFLMAGLQPAIWTIGAFDSCIHMSEEAKNATKAVPIGIISSIFVCWVLG 318

Query: 330 FFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKKWAMTFMTLIAFCQFIMGASTLT 389
           FFI IAI ACMG +I AIL + +G PLAQILYNALGKKW +TFM+LIAFCQF MG S LT
Sbjct: 319 FFICIAIAACMGPDIDAILGSSFGSPLAQILYNALGKKWTITFMSLIAFCQFAMGCSILT 378

Query: 390 AISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXXXXXXXXXXXXXXXSTASAALF 449
           AISRQIWAFARDDGL F  + K VN KLSSP+RATWF                TA+ ALF
Sbjct: 379 AISRQIWAFARDDGLMFPKYFKVVNKKLSSPIRATWFGAACALVIGLLCLIGGTAANALF 438

Query: 450 SMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFWSPVINWTSXXXXXXXXXXXXXPS 509
           S+ I  NY AWMTPNLLRMT GK++F PG F+MG FWSP++NWTS             P+
Sbjct: 439 SLGIGGNYLAWMTPNLLRMTVGKDLFRPGQFHMGEFWSPIVNWTSIVFQIFIIFMIMFPA 498

Query: 510 SQHNITADTMNYTCVFVGFVWFGSIAYYYFYKHRTFHGPKSNLTDDEFVDAVGQDVIDEI 569
            +  IT DTMNYT V  G VWFGS+ YY  YK++ FHGPKSNLTD+EF + VGQDVID+I
Sbjct: 499 EKVGITPDTMNYTVVICGGVWFGSMIYYAVYKYKVFHGPKSNLTDEEFSEVVGQDVIDQI 558

Query: 570 LSNQK 574
           LS+QK
Sbjct: 559 LSHQK 563

>KLLA0E14675g Chr5 (1312581..1314302) [1722 bp, 573 aa] {ON} similar
           to uniprot|P32837 Saccharomyces cerevisiae YDL210W UGA4
           Permease that serves as a gamma-aminobutyrate (GABA)
           transport protein involved in the utilization of GABA as
           a nitrogen source catalyzes the transport of putrescine
           and delta-aminolevulinic acid (ALA) localized to the
           vacuolar membrane
          Length = 573

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/575 (60%), Positives = 419/575 (72%), Gaps = 9/575 (1%)

Query: 1   MSDS-SSYVEKNQIKTSARELHPIVSANANGEVQQITSLRTITSKRAGEVNYINAKAAHD 59
           MSDS SS  +KN    +++E+           V  +TSLRTITS+R G+VNYINAK AHD
Sbjct: 1   MSDSVSSLSDKNNFVITSQEV--------KNRVDVVTSLRTITSRRVGDVNYINAKTAHD 52

Query: 60  DTELLAEIGYKQELNRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISG 119
           DTELLAEIGYKQEL RHFS  QVFG+AFSIMGLLPSIASILG+A  GG++SLVWGW ISG
Sbjct: 53  DTELLAEIGYKQELQRHFSKTQVFGVAFSIMGLLPSIASILGVALPGGSVSLVWGWAISG 112

Query: 120 AFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDY 179
           AF+L+ G  M+ELASAIPTSGGL       APPK K  LSF++GN NSLALI+CLCSI+Y
Sbjct: 113 AFVLANGLAMSELASAIPTSGGLYYYTHYYAPPKVKNFLSFIVGNCNSLALISCLCSINY 172

Query: 180 GLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXX 239
           GLA EILSIVV+  +G+F ITNA TYGVYA CII              +LQTFSIVSN  
Sbjct: 173 GLAGEILSIVVVGSNGNFNITNANTYGVYAACIIATAVVTSVATTAVSRLQTFSIVSNLL 232

Query: 240 XXXXXXXXXXXGVSQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDS 299
                      GV++S D+ FN   +IFG+FEN  DW +GW+FM+AGFQP +WVIG FDS
Sbjct: 233 LICIFFVVLPVGVARSKDMEFNDAAYIFGDFENLSDWNNGWQFMLAGFQPLIWVIGGFDS 292

Query: 300 CIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQI 359
           C+HMSEEAKNAT +VP GI+ SISVCW +GFFI I I AC   +++A+++T + QPLAQ+
Sbjct: 293 CLHMSEEAKNATASVPFGIIGSISVCWFLGFFICIVIAACSSQDVAALVNTKFHQPLAQV 352

Query: 360 LYNALGKKWAMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSS 419
           L++ALGKKW +  MTLIAFCQF+M AS+LTAISRQIWAFARDDGLPFS WIK VN KLSS
Sbjct: 353 LFDALGKKWTIAIMTLIAFCQFLMAASSLTAISRQIWAFARDDGLPFSSWIKVVNVKLSS 412

Query: 420 PLRATWFXXXXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGA 479
           PLRATW                  AS+ALFS+YI+ANYF+WM PNLLRMT GK++F+PGA
Sbjct: 413 PLRATWVGAGVALAIGCLCLIGPVASSALFSLYISANYFSWMLPNLLRMTYGKDVFTPGA 472

Query: 480 FYMGNFWSPVINWTSXXXXXXXXXXXXXPSSQHNITADTMNYTCVFVGFVWFGSIAYYYF 539
           F+MG + SPV+NW S             P+ QH IT DTMNY+ VF+G VWF +  YY+ 
Sbjct: 473 FFMGKYLSPVVNWISIIFELFMILLVFFPTEQHGITPDTMNYSVVFIGAVWFLATIYYFI 532

Query: 540 YKHRTFHGPKSNLTDDEFVDAVGQDVIDEILSNQK 574
           YKH+ + GPKSNLTD+E+ + VGQDV+D ILS  +
Sbjct: 533 YKHKFYKGPKSNLTDEEYEENVGQDVLDAILSKSQ 567

>KLTH0G10736g Chr7 complement(902899..904605) [1707 bp, 568 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a gamma-
           aminobutyrate (GABA) transport protein involved in the
           utilization of GABA as a nitrogen source catalyzes the
           transport of putrescine and delta-aminolevulinic acid
           (ALA) localized to the vacuolar membrane
          Length = 568

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/567 (61%), Positives = 410/567 (72%), Gaps = 1/567 (0%)

Query: 8   VEKNQIKTSARELHPIVSANANGEVQQITSLRTITSKRAGEVNYINAKAAHDDTELLAEI 67
           +EK Q   +  ++   +   A+G + Q  SLRTITSKRAGEVN+I+AK A+ D+ELLAEI
Sbjct: 1   MEKVQAAANTTDVSSSIEPAADG-LHQFGSLRTITSKRAGEVNFIDAKGANGDSELLAEI 59

Query: 68  GYKQELNRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFILSVGA 127
           GYKQELNRHFSTIQVFG+AFSIMGLLPSIAS+L +   GG +SL+WGWLI+G FIL+VG 
Sbjct: 60  GYKQELNRHFSTIQVFGVAFSIMGLLPSIASVLAIGMPGGMVSLMWGWLIAGIFILAVGC 119

Query: 128 GMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILS 187
           GMAELASAIPTSGGL       +P K+K  LSF+IGN+NSLAL+A LCSI YGLAQEILS
Sbjct: 120 GMAELASAIPTSGGLYYYTYYYSPEKYKAFLSFVIGNTNSLALVAGLCSITYGLAQEILS 179

Query: 188 IVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXX 247
           IVV++KDGDF IT+ KTYGV+   I               KLQT SI++N          
Sbjct: 180 IVVVAKDGDFNITSGKTYGVFVAGIAATTAVTSLATVAVSKLQTVSILANVGLIVLFFIV 239

Query: 248 XXXGVSQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEA 307
              GV+ +  + FN G FIFG ++N   W DGW+FM+AG QP +W IGAFDSCIHMSEEA
Sbjct: 240 LPIGVANTKGLNFNDGSFIFGKWQNETSWPDGWQFMMAGLQPAIWTIGAFDSCIHMSEEA 299

Query: 308 KNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKK 367
           KNATKAVP+GI++SI VCWI+GF + I I ACMG NI AIL++ YG PL QIL+NALGKK
Sbjct: 300 KNATKAVPVGIISSIGVCWILGFIVCIVIAACMGPNIDAILESSYGSPLPQILFNALGKK 359

Query: 368 WAMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFX 427
           W + FMTLIA CQF+MG S LTAISRQIWAFARDDGL FS +IK VN KLSSPLRATWF 
Sbjct: 360 WTIAFMTLIAACQFLMGCSILTAISRQIWAFARDDGLMFSRYIKVVNKKLSSPLRATWFG 419

Query: 428 XXXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFWS 487
                         STAS ALFS+ I  NY AWMTPNLLRMT GK++F PGAF+MG  WS
Sbjct: 420 ALCALVIGLLCLIGSTASNALFSLAIGGNYVAWMTPNLLRMTVGKDLFRPGAFFMGKLWS 479

Query: 488 PVINWTSXXXXXXXXXXXXXPSSQHNITADTMNYTCVFVGFVWFGSIAYYYFYKHRTFHG 547
           P++NW +             P+   +IT DTMNYT V  G VW GSI Y+  YK + FHG
Sbjct: 480 PIVNWIAIIFQTFILIMIMFPADSKDITPDTMNYTVVICGGVWIGSIVYFLVYKKKAFHG 539

Query: 548 PKSNLTDDEFVDAVGQDVIDEILSNQK 574
           PKSNL+D+E+ DAVGQDVID+ILS+QK
Sbjct: 540 PKSNLSDEEYADAVGQDVIDQILSHQK 566

>KLLA0E24993g Chr5 complement(2214864..2216570) [1707 bp, 568 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 568

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/570 (60%), Positives = 412/570 (72%), Gaps = 8/570 (1%)

Query: 5   SSYVEKNQIKTSARELHPIVSANANGEVQQITSLRTITSKRAGEVNYINAKAAHDDTELL 64
           SS  EKN     A+E+          +V  +TSLRTITS+R G+VNYINAKAAHDDTELL
Sbjct: 6   SSGSEKNNYIIGAQEV--------KNKVDVVTSLRTITSRRVGDVNYINAKAAHDDTELL 57

Query: 65  AEIGYKQELNRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFILS 124
           AEIGYKQEL RHFS IQVFG+AFSIMGLLPSIAS+L +A  GG++SLVWGW I+GAF+L+
Sbjct: 58  AEIGYKQELQRHFSKIQVFGVAFSIMGLLPSIASVLSLALPGGSVSLVWGWGIAGAFVLT 117

Query: 125 VGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQE 184
            G  M+ELASAIPTSGGL       APPK K +LSF++GNSNSLALIA LCSI+YGLA E
Sbjct: 118 NGLAMSELASAIPTSGGLYYYTYYYAPPKVKNLLSFVVGNSNSLALIAGLCSINYGLAGE 177

Query: 185 ILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXX 244
           ILSIVV+  DG+F ITNA TYGVYA CI+              KLQTFSIVSN       
Sbjct: 178 ILSIVVVGSDGNFNITNASTYGVYAACIVATAVVTSVATVAVSKLQTFSIVSNLLLICIF 237

Query: 245 XXXXXXGVSQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMS 304
                 GV++S+ + FN  K+IFGNF+N  DW DGW+FM AGFQP +WVIG FDSCIHMS
Sbjct: 238 FVALPVGVARSNHMEFNDAKYIFGNFQNLSDWNDGWQFMSAGFQPLIWVIGGFDSCIHMS 297

Query: 305 EEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNAL 364
           EEAKNAT +VP GI+ SISVCW++GFFI I I AC   +++AI++T + QPLAQIL++AL
Sbjct: 298 EEAKNATASVPFGIIGSISVCWVLGFFICIVIAACSSQDVAAIVETKFHQPLAQILFDAL 357

Query: 365 GKKWAMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRAT 424
           GK+W +  M LIAFCQF+M AS LTAISRQIWAFARDDGLPFS WIK VN KLSSPLRAT
Sbjct: 358 GKRWTIAIMVLIAFCQFLMAASILTAISRQIWAFARDDGLPFSSWIKVVNIKLSSPLRAT 417

Query: 425 WFXXXXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGN 484
           W                  AS+ALFS+ ++ANYF+WM PNLLRMT GK++F+PGAF+MG 
Sbjct: 418 WVGAGAALAIGCLCLIGPVASSALFSLAVSANYFSWMVPNLLRMTYGKDVFTPGAFFMGK 477

Query: 485 FWSPVINWTSXXXXXXXXXXXXXPSSQHNITADTMNYTCVFVGFVWFGSIAYYYFYKHRT 544
           + SPV+NW S             P+ QH IT DTMNY+ VF+G VW     YY  YK++ 
Sbjct: 478 YLSPVVNWISIVFEIFMILLVFFPADQHGITPDTMNYSVVFIGAVWVLPTIYYLVYKYKF 537

Query: 545 FHGPKSNLTDDEFVDAVGQDVIDEILSNQK 574
           + GPKSNLTD+E+ + VGQDV+D ILS  +
Sbjct: 538 YSGPKSNLTDEEYEEKVGQDVLDAILSKHQ 567

>KLTH0B08140g Chr2 complement(659691..661397) [1707 bp, 568 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a gamma-
           aminobutyrate (GABA) transport protein involved in the
           utilization of GABA as a nitrogen source catalyzes the
           transport of putrescine and delta-aminolevulinic acid
           (ALA) localized to the vacuolar membrane
          Length = 568

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/567 (60%), Positives = 406/567 (71%), Gaps = 1/567 (0%)

Query: 8   VEKNQIKTSARELHPIVSANANGEVQQITSLRTITSKRAGEVNYINAKAAHDDTELLAEI 67
           +EK Q   ++ ++   +   A G++ QI SLRTITSKRAGEVN+I+AK AH D ELLAEI
Sbjct: 1   MEKAQAVANSTDVSSSLE-QAVGDIHQIGSLRTITSKRAGEVNFIDAKRAHGDAELLAEI 59

Query: 68  GYKQELNRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFILSVGA 127
           GYKQELNRHFST+QVFG+AFSIMGLLPSIAS+L +   GG +SLVWGW I+G FIL+VG 
Sbjct: 60  GYKQELNRHFSTVQVFGVAFSIMGLLPSIASVLAIGMPGGMVSLVWGWFIAGIFILAVGC 119

Query: 128 GMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILS 187
           GM+ELASAIPTSGGL       AP K+K   SF+IG SNSLAL++ LCSI YGLA+EILS
Sbjct: 120 GMSELASAIPTSGGLYYYTYYYAPQKYKAFFSFVIGYSNSLALVSGLCSITYGLAEEILS 179

Query: 188 IVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXX 247
           IVV+SKDGDF ITN KTYGV+   I               KLQT SI++N          
Sbjct: 180 IVVVSKDGDFTITNGKTYGVFVAGIAATTVVTSIATVAVSKLQTVSILANVGLIVLFFIV 239

Query: 248 XXXGVSQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEA 307
              GV+ +  + FN G FIFG + N   W DGW+FM+AG QP +W IGAFDSCIHMSEEA
Sbjct: 240 LPIGVANTKGLDFNDGSFIFGKWLNETTWPDGWQFMLAGLQPAIWTIGAFDSCIHMSEEA 299

Query: 308 KNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKK 367
           KNATKAVP+GI++SISVCWI+GF I I + ACMG +I AIL + +G PL QILYNALGKK
Sbjct: 300 KNATKAVPLGIISSISVCWILGFLICIVMAACMGPDIDAILGSSFGSPLPQILYNALGKK 359

Query: 368 WAMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFX 427
           W +  MTLIA CQF+MG S LTAISRQIWAFARDDGL FS +IK VN KLSSPLRATWF 
Sbjct: 360 WTIAIMTLIAACQFLMGCSILTAISRQIWAFARDDGLMFSKYIKVVNKKLSSPLRATWFG 419

Query: 428 XXXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFWS 487
                          TAS ALFS+ I  NY AWM PNLLRMTTGK++F PGAFYMG  WS
Sbjct: 420 AVCALVIGLLCLIGGTASNALFSLGIGGNYLAWMAPNLLRMTTGKDLFRPGAFYMGKTWS 479

Query: 488 PVINWTSXXXXXXXXXXXXXPSSQHNITADTMNYTCVFVGFVWFGSIAYYYFYKHRTFHG 547
           P++NWT+             P+    IT D MNYT V  G VW GS+ Y++ YK + F+G
Sbjct: 480 PIVNWTAIVFQIFILIMIMFPAESKGITPDAMNYTVVICGGVWIGSMIYFFVYKKKAFNG 539

Query: 548 PKSNLTDDEFVDAVGQDVIDEILSNQK 574
           PKSNL+DDE+VDAVGQDVID+ILS+QK
Sbjct: 540 PKSNLSDDEYVDAVGQDVIDQILSHQK 566

>Ecym_4621 Chr4 complement(1216034..1217752) [1719 bp, 572 aa] {ON}
           similar to Ashbya gossypii ABL116C
          Length = 572

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/553 (60%), Positives = 395/553 (71%), Gaps = 2/553 (0%)

Query: 6   SYVEKNQI-KTSARELHPIVSANANGEVQQITSLRTITSKRAGEVNYINAKAAHDDTELL 64
           SY+E  Q  K     L P ++ N +  VQQI+S++T  SK   +VNYINAK A+DD ELL
Sbjct: 3   SYLEGQQPSKVDVILLQPALTNNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELL 62

Query: 65  AEIGYKQELNRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFILS 124
           AEIGYKQEL+RHFSTIQVFGIAFSIMGLLPSIASIL +A  GG +S VWGWLI G FILS
Sbjct: 63  AEIGYKQELSRHFSTIQVFGIAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILS 122

Query: 125 VGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQE 184
           +GA M+ELASAIPTSGGL       APPKFK +LSFLIGNSNSLAL+A LCS++YGLAQE
Sbjct: 123 IGAAMSELASAIPTSGGLYYYTYYYAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQE 182

Query: 185 ILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXX 244
           +LSIV I KDGDFE++++KT+ VY   I+               LQT SIV N       
Sbjct: 183 VLSIVAIWKDGDFELSSSKTFAVYCAAILATVILTSMATAAVSVLQTVSIVIN-LSLVAF 241

Query: 245 XXXXXXGVSQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMS 304
                 GV+ +D +TFNG  FIF NF+N   W D  +F + G  P VWVIGAFDS IHMS
Sbjct: 242 LIVLPIGVANNDSMTFNGPGFIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMS 301

Query: 305 EEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNAL 364
           EEAKNA+KAVP+ ILTSI+VCW++GF I + I ACMG +I+ +LDT +GQPLAQ+L+N L
Sbjct: 302 EEAKNASKAVPVDILTSITVCWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVL 361

Query: 365 GKKWAMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRAT 424
           GK+WA+ FM+LIA CQ++MGAS LTAISRQIWAFARDDGLPFS+WIKKVN  LSSP+RAT
Sbjct: 362 GKQWAIAFMSLIAVCQYVMGASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRAT 421

Query: 425 WFXXXXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGN 484
           W                  AS+ALFSMY+ ANY AWM PNLLRM  GK IF+PG FYMG 
Sbjct: 422 WVGAFAAIMIGLLTLAGPVASSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGK 481

Query: 485 FWSPVINWTSXXXXXXXXXXXXXPSSQHNITADTMNYTCVFVGFVWFGSIAYYYFYKHRT 544
           FWSP+INW S             P++  NIT  +MNYT +F GFVWFGSI Y+  YKH+T
Sbjct: 482 FWSPIINWVSIIFQLLCIVLMMLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKT 541

Query: 545 FHGPKSNLTDDEF 557
           F GPKSNLTD + 
Sbjct: 542 FEGPKSNLTDSDL 554

>ABL116C Chr2 complement(181138..181889,181944..182826) [1635 bp,
           544 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDL210W (UGA4); 1-intron
          Length = 544

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/512 (58%), Positives = 348/512 (67%), Gaps = 1/512 (0%)

Query: 41  ITSKRAGEVNYINAKAAHDDTELLAEIGYKQELNRHFSTIQVFGIAFSIMGLLPSIASIL 100
           I     G +NYI+AK  HDD ELLAEIGYKQEL RHFST+Q+FGIAFSIMGLLPSIAS+L
Sbjct: 32  IECSNKGPMNYIDAKNVHDDVELLAEIGYKQELKRHFSTLQIFGIAFSIMGLLPSIASVL 91

Query: 101 GMAFAGGAISLVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSF 160
            +A  GG++S+VWGW I GAFIL+VGA MAELASA PTSGGL       APP+ K  LSF
Sbjct: 92  PVALPGGSVSMVWGWFIFGAFILAVGAAMAELASAFPTSGGLYYYTYYYAPPRLKACLSF 151

Query: 161 LIGNSNSLALIACLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXX 220
           LIGN NSLALIA LCSI+YGLA++ILSI+ IS +     +    YG+Y   ++       
Sbjct: 152 LIGNGNSLALIAGLCSIEYGLAEQILSIIAISSNSYLVSSRWLLYGIYCMGLLATVLLAS 211

Query: 221 XXXXXXXKLQTFSIVSNXXXXXXXXXXXXXGVSQSDDVTFNGGKFIFGNFENFGDWADGW 280
                   LQT SIV N             GV+ +    FN  KF+F NFEN   W D +
Sbjct: 212 IATFSVSLLQTASIVMNLALVALFIIVLPVGVAHNGR-GFNSAKFMFTNFENHTGWPDWF 270

Query: 281 EFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACM 340
           +F + G  P VWVIGAFDS +HMSEEAKNAT++VPIGIL+SIS CW +GF I + I ACM
Sbjct: 271 QFFLCGSLPIVWVIGAFDSTVHMSEEAKNATRSVPIGILSSISTCWALGFAIVVVIAACM 330

Query: 341 GSNISAILDTVYGQPLAQILYNALGKKWAMTFMTLIAFCQFIMGASTLTAISRQIWAFAR 400
           G +I AIL+  +  PLAQILYNALGK WA++ M  I  CQ++MGAS LTA SRQIWAFAR
Sbjct: 331 GPDIDAILNGEFNHPLAQILYNALGKGWALSVMVFIVVCQYLMGASILTASSRQIWAFAR 390

Query: 401 DDGLPFSWWIKKVNTKLSSPLRATWFXXXXXXXXXXXXXXXSTASAALFSMYIAANYFAW 460
           DDGLPFS WIK VNTKLSSPLRATW                 TAS+ALFSM +AANY AW
Sbjct: 391 DDGLPFSSWIKVVNTKLSSPLRATWASAFVALVIGLLTLAGPTASSALFSMAVAANYLAW 450

Query: 461 MTPNLLRMTTGKEIFSPGAFYMGNFWSPVINWTSXXXXXXXXXXXXXPSSQHNITADTMN 520
           MTPNLLRM  GKEI+ PG+FYMG FWSPVINWT+             PS    + A TMN
Sbjct: 451 MTPNLLRMLFGKEIYRPGSFYMGKFWSPVINWTAILFQVFIILVMMFPSDTAGLRASTMN 510

Query: 521 YTCVFVGFVWFGSIAYYYFYKHRTFHGPKSNL 552
           YT +  GFVW GSI Y+  YKHRTF GPKSNL
Sbjct: 511 YTAIITGFVWIGSIFYFLAYKHRTFIGPKSNL 542

>SAKL0G15136g Chr7 complement(1303874..1305583) [1710 bp, 569 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 569

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/556 (54%), Positives = 383/556 (68%), Gaps = 4/556 (0%)

Query: 20  LHPIVSAN--ANGEVQQITSLRTITSKR-AGEVNYINAKAAHDDTELLAEIGYKQELNRH 76
           + PIVS +     ++Q + S+R++ S+  AGEVNYINA  A+DD +LLAEIGYKQEL R 
Sbjct: 10  ISPIVSRDKGTTSDLQNLHSVRSVRSRTGAGEVNYINAATANDDNQLLAEIGYKQELKRQ 69

Query: 77  FSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFILSVGAGMAELASAI 136
           FST+QVFGIAFSIMGLLPSIAS++    +GG ++LVWGW I+G FIL +G  MAE ASAI
Sbjct: 70  FSTLQVFGIAFSIMGLLPSIASVMAGGLSGGPVTLVWGWFIAGFFILLIGLSMAENASAI 129

Query: 137 PTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVVISKDGD 196
           PT+GGL       AP  +K V+SF+IG SNSLAL++ +CSIDYGLA+EIL+ VVISKDGD
Sbjct: 130 PTAGGLYYWTHYYAPEGYKNVISFVIGCSNSLALVSGVCSIDYGLAEEILAAVVISKDGD 189

Query: 197 FEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXXXGVSQSD 256
           FE+T+ KTYGV+   +               +LQT SIV+N             G ++ +
Sbjct: 190 FEVTSGKTYGVFVAAVFAMILCTCLASSAISRLQTTSIVANCFIIILLFIALPIG-TKRN 248

Query: 257 DVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPI 316
              FN   +IFG FENF DW +GW+F + GF  CVW IGAFDSC+H SEEAK+A KAVPI
Sbjct: 249 MGGFNDASYIFGKFENFSDWNNGWQFCLQGFMTCVWTIGAFDSCVHQSEEAKDAKKAVPI 308

Query: 317 GILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKKWAMTFMTLI 376
           GI+ SI+VCWI+G+ I I ++AC+  ++  +LD  YG  LAQI+Y +LGK WA+ FM+LI
Sbjct: 309 GIIGSITVCWILGWLILIVLMACVDPDLEKVLDNPYGFVLAQIVYESLGKSWAIAFMSLI 368

Query: 377 AFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXXXXXXXXXX 436
           A CQF+MGAS LTA+SRQIWAFARDDGLP S +IK VN +LS P+ A W           
Sbjct: 369 AACQFLMGASILTAVSRQIWAFARDDGLPLSKYIKMVNERLSVPIVAVWAGGLASVVLGL 428

Query: 437 XXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFWSPVINWTSXX 496
                S A++ALFS+ +A NY +W TP LLR+T G++IF PG FY+G FWSP++NWTS  
Sbjct: 429 LCLIDSAAASALFSLAVAGNYLSWGTPTLLRLTFGRDIFRPGPFYLGKFWSPIVNWTSVL 488

Query: 497 XXXXXXXXXXXPSSQHNITADTMNYTCVFVGFVWFGSIAYYYFYKHRTFHGPKSNLTDDE 556
                      P+SQH IT  TMNY CV    +W  +  YY  YK + +HGPKSNLTD+E
Sbjct: 489 FQAFIIVVVMFPASQHGITKSTMNYACVIGPGIWILAWVYYMVYKKKYYHGPKSNLTDEE 548

Query: 557 FVDAVGQDVIDEILSN 572
           +VDAVG  VIDE+LSN
Sbjct: 549 YVDAVGSIVIDEMLSN 564

>SAKL0G14762g Chr7 complement(1265378..1267075) [1698 bp, 565 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 565

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/544 (54%), Positives = 378/544 (69%), Gaps = 2/544 (0%)

Query: 32  VQQITSLRTITSKR-AGEVNYINAKAAHDDTELLAEIGYKQELNRHFSTIQVFGIAFSIM 90
           +Q+I +LR++ S+  AGEVNYINA  A+DD +LLAEIGYKQEL R FST+QVFGIAFSIM
Sbjct: 12  IQEIAALRSVRSRTGAGEVNYINAATANDDNQLLAEIGYKQELKRQFSTLQVFGIAFSIM 71

Query: 91  GLLPSIASILGMAFAGGAISLVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXA 150
           GLLPSIAS++    +GG ++LVWGW I+G FIL +G  MAE ASAIPT+GGL       A
Sbjct: 72  GLLPSIASVMAGGLSGGPVTLVWGWFIAGFFILLIGLSMAESASAIPTAGGLFYWTHYYA 131

Query: 151 PPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGVYAG 210
           P  +K V+SF+IG SNSLAL++ LCSIDYGLAQEIL+ VVISKDGDFE+T+ KTYGV+A 
Sbjct: 132 PEGYKNVISFIIGCSNSLALVSGLCSIDYGLAQEILAAVVISKDGDFEVTSGKTYGVFAA 191

Query: 211 CIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXXXGVSQSDDVTFNGGKFIFGNF 270
            ++              +LQT SIV+N             G ++ +   FN   +IFG F
Sbjct: 192 AVVVTVLCTCLASSAISRLQTASIVANCFIIILLFIALPIG-TKRNMGGFNDASYIFGKF 250

Query: 271 ENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGF 330
           ENF DW DGW F + GF P +W IGAFDSC+H SEEAK+A KAVPIGI+ SI+VCWI+G+
Sbjct: 251 ENFSDWNDGWSFCLQGFMPVIWTIGAFDSCVHQSEEAKDAKKAVPIGIIGSITVCWILGW 310

Query: 331 FISIAIVACMGSNISAILDTVYGQPLAQILYNALGKKWAMTFMTLIAFCQFIMGASTLTA 390
            I I ++AC+  ++  +LD  YG  LAQI+Y +LGK WA+ FM+LIA CQF+MGAS LTA
Sbjct: 311 LILIVLMACVDPDLEKVLDNPYGFVLAQIVYESLGKSWAIAFMSLIAVCQFLMGASVLTA 370

Query: 391 ISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXXXXXXXXXXXXXXXSTASAALFS 450
           +SRQ+WAFARDDGLP S +IK V+T  S P+ A W                + A++ALFS
Sbjct: 371 LSRQVWAFARDDGLPLSKYIKMVHTNWSVPIVAVWVAGCAGLVLGLLCLIDAAAASALFS 430

Query: 451 MYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFWSPVINWTSXXXXXXXXXXXXXPSS 510
           + +A NY +W TP LLR+T GK+IF PG FY+G FWSP+INWTS             P+S
Sbjct: 431 LAVAGNYLSWGTPTLLRLTFGKDIFRPGPFYLGKFWSPIINWTSVIFQAFIIILVMFPAS 490

Query: 511 QHNITADTMNYTCVFVGFVWFGSIAYYYFYKHRTFHGPKSNLTDDEFVDAVGQDVIDEIL 570
           QH +   TMNY CV    +W  +  YY  YK + +HGPKSNLTD+E+V+AVG +VIDEIL
Sbjct: 491 QHGVDKSTMNYACVIGPGIWILAWIYYMIYKKKYYHGPKSNLTDEEYVEAVGSNVIDEIL 550

Query: 571 SNQK 574
           SN +
Sbjct: 551 SNTE 554

>ZYRO0G01474g Chr7 complement(113623..115341) [1719 bp, 572 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 572

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/563 (49%), Positives = 373/563 (66%), Gaps = 6/563 (1%)

Query: 15  TSARELHPIVSANANGEVQQITS---LRTITSKR-AGEVNYINAKAAHDDTELLAEIGYK 70
           + +  + P+ S    G+VQ  TS   +R+I S+  AGEVNYINA  ++DD +LLAEIGYK
Sbjct: 4   SKSLRISPVPSL-GKGDVQVYTSAGRIRSIRSRTGAGEVNYINAATSNDDNQLLAEIGYK 62

Query: 71  QELNRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFILSVGAGMA 130
            EL R FST+QVFGIAFSIMGLLPSIAS L    AGG +S VWGW I+G FI  VG  MA
Sbjct: 63  PELERKFSTLQVFGIAFSIMGLLPSIASELDDGLAGGPVSTVWGWFIAGIFIFLVGVTMA 122

Query: 131 ELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVV 190
           E +SAIPT+GGL       AP  +K  +SF+IG  NSLAL A +CSIDYG A+E+L+ VV
Sbjct: 123 ENSSAIPTAGGLYFWTYHYAPEGYKAAISFVIGIGNSLALAAGVCSIDYGFAEEVLAAVV 182

Query: 191 ISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXXX 250
           +SKDG+++IT  K YGVYAGC+I              K+Q+ SI SN             
Sbjct: 183 VSKDGNWDITQGKLYGVYAGCVILTIMVTCVASGWLAKMQSISIYSNLFIIVLFLIALPI 242

Query: 251 GVSQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNA 310
           G ++ +   FN G FIFG FEN  DW++GW+F +AGF P VW I +FDSC+H +EEAK+A
Sbjct: 243 G-TKVNRGGFNDGSFIFGKFENLSDWSNGWQFFLAGFTPIVWTISSFDSCVHQAEEAKDA 301

Query: 311 TKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKKWAM 370
           +KAVPIGI+ SI VCWI+G+ I+I ++AC+  +++ ++++ Y   +AQI++++LGK W +
Sbjct: 302 SKAVPIGIMGSIFVCWILGWVINIVLMACIDKDMNRVMNSPYQLGMAQIIFDSLGKNWTI 361

Query: 371 TFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXXXX 430
            F+ L+AFCQF+MGAS++TA SRQIWAFARDDG+P S  +KKV++K   P  A+      
Sbjct: 362 AFLALMAFCQFLMGASSMTAASRQIWAFARDDGMPLSNILKKVDSKFHVPFYASICSGLM 421

Query: 431 XXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFWSPVI 490
                        A+ ALFS+ IA NY AW+TPN LR+T G+++F PG FY+G FWSPV+
Sbjct: 422 SLVLGLLILIDDAAAEALFSLAIAGNYLAWVTPNFLRLTWGRDVFRPGPFYLGKFWSPVV 481

Query: 491 NWTSXXXXXXXXXXXXXPSSQHNITADTMNYTCVFVGFVWFGSIAYYYFYKHRTFHGPKS 550
           NWT+             P+ ++ I  + MNY CV     W  S+ YY+ YK + +HGPKS
Sbjct: 482 NWTTVVFMAFIIIMVMFPTQKNGINKENMNYACVIGPGTWLLSLIYYWVYKKKEYHGPKS 541

Query: 551 NLTDDEFVDAVGQDVIDEILSNQ 573
           NL D+E+ DAVG +V+D ILS  
Sbjct: 542 NLDDEEYADAVGPEVLDAILSTD 564

>Suva_4.38 Chr4 (72470..74185) [1716 bp, 571 aa] {ON} YDL210W (REAL)
          Length = 571

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/540 (51%), Positives = 367/540 (67%), Gaps = 2/540 (0%)

Query: 36  TSLRTITSKR-AGEVNYINAKAAHDDTELLAEIGYKQELNRHFSTIQVFGIAFSIMGLLP 94
           ++LR+I SK  AGEVNYINA  + +D +LLAEIGYKQEL R FST+QVFGIAFSIMGLLP
Sbjct: 32  SNLRSIRSKTGAGEVNYINASKSVNDHQLLAEIGYKQELKRQFSTLQVFGIAFSIMGLLP 91

Query: 95  SIASILGMAFAGGAISLVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKF 154
           SIAS++G    GG  SL+WGW ++G F+L VG  MAE ASAIPT+GGL       AP  +
Sbjct: 92  SIASVMGGGLDGGPASLLWGWFVAGFFLLLVGMSMAEHASAIPTAGGLYYWTYYYAPEGY 151

Query: 155 KKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIX 214
           K+++SF+IG SNSLAL A +CSI+YGLA+EI + V ++KDG+F++T    YG++AG ++ 
Sbjct: 152 KEIISFIIGCSNSLALTAGVCSINYGLAEEIAAAVTLTKDGNFDVTRGMLYGIFAGAVVL 211

Query: 215 XXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXXXGVSQSDDVTFNGGKFIFGNFENFG 274
                        +LQT SI SN             G  ++    FN G FIFG FENF 
Sbjct: 212 MGLCTCIASGGIARLQTLSIASNVFIIILLFIALPIGTKRNMG-GFNNGDFIFGKFENFS 270

Query: 275 DWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISI 334
           DW +GW+F +AGF P VW I +FDSC+H SEEAK+A K+VPIGI+ SI VCWI+G+FI I
Sbjct: 271 DWNNGWQFCLAGFMPAVWTINSFDSCVHQSEEAKDAKKSVPIGIILSILVCWILGWFIII 330

Query: 335 AIVACMGSNISAILDTVYGQPLAQILYNALGKKWAMTFMTLIAFCQFIMGASTLTAISRQ 394
            ++AC+  +++++LD+ YG  LAQI+Y++LGKKWA+ FM+LIAFCQF+MGAS  TA+SRQ
Sbjct: 331 CLLACINPDLASVLDSKYGFALAQIIYDSLGKKWAIAFMSLIAFCQFLMGASITTAVSRQ 390

Query: 395 IWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXXXXXXXXXXXXXXXSTASAALFSMYIA 454
           +WAF+RD+GLP S +IKKV++K S P  A                    A+ ALFS+ +A
Sbjct: 391 VWAFSRDNGLPLSKYIKKVDSKYSVPFYAILAACVCSLVLGLLCLIDQAATNALFSLAVA 450

Query: 455 ANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFWSPVINWTSXXXXXXXXXXXXXPSSQHNI 514
            N  AW TP +LR+T+GK++F PG FY+G FWSP++ W               P+ Q  I
Sbjct: 451 GNNLAWSTPTVLRLTSGKDLFRPGPFYLGKFWSPIVAWVGVAFQVFIIVMVMFPAQQKGI 510

Query: 515 TADTMNYTCVFVGFVWFGSIAYYYFYKHRTFHGPKSNLTDDEFVDAVGQDVIDEILSNQK 574
           T  TMNYTCV    +W  +  YY  YK + +HGP +NL+D+++VDAVG DVID I+S Q+
Sbjct: 511 TKATMNYTCVIGPGIWILAGIYYKVYKKKYYHGPATNLSDEDYVDAVGVDVIDTIISKQE 570

>NCAS0D01600 Chr4 (299803..301533) [1731 bp, 576 aa] {ON} Anc_5.112
          Length = 576

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/575 (48%), Positives = 371/575 (64%), Gaps = 3/575 (0%)

Query: 1   MSDSSSYVEKNQIKTSARELHPIVSANANGEVQQITS-LRTITSKR-AGEVNYINAKAAH 58
           MS SS+  +    K+ + E      A +  +++ + S +R+I SK  AGEVNYIN+  + 
Sbjct: 1   MSGSSNRSDDKDFKSISIEARVSTEAGSAVDIRNVNSHIRSIRSKTGAGEVNYINSATSV 60

Query: 59  DDTELLAEIGYKQELNRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLIS 118
            D +LLAEIGYKQEL R FST QVFGIAFSIMGLLPSIAS++G   +GG  + VWGW I+
Sbjct: 61  TDNQLLAEIGYKQELKRQFSTFQVFGIAFSIMGLLPSIASVMGTGISGGPTTFVWGWFIA 120

Query: 119 GAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSID 178
             F + +G  MAE ASAIPT+GGL       AP  FKKV+SF+IG SNSLAL A LCSID
Sbjct: 121 SIFTIFIGISMAENASAIPTAGGLYYWTYYYAPEGFKKVISFVIGCSNSLALAAGLCSID 180

Query: 179 YGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNX 238
           YGLA+EI++ VV++ DGDF++T+ K YG++A  ++              ++Q+FSI SN 
Sbjct: 181 YGLAEEIMAAVVLTFDGDFDVTSGKLYGIFAAAVVVMGICTCISSGAIARMQSFSIASNL 240

Query: 239 XXXXXXXXXXXXGVSQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFD 298
                       G  ++    FN  KFIFG FENF DW  GW+F +AGF P VW IG+FD
Sbjct: 241 FIIVLLFIALPIGTKRNRG-EFNDAKFIFGKFENFSDWNSGWQFCMAGFMPAVWTIGSFD 299

Query: 299 SCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQ 358
           SC+H SEEAK+A K+VPIGI+ SI+ CWI+G+ I I ++AC+  N+  ++DT YG P+AQ
Sbjct: 300 SCVHQSEEAKDAKKSVPIGIIASIAACWILGWLIIIVLMACIDPNLENVVDTKYGFPMAQ 359

Query: 359 ILYNALGKKWAMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLS 418
           ++Y++LGK+WA+TFM+L+AFCQF+MG S  TAISRQIWAF+RDDGLP S +IK V+ + S
Sbjct: 360 LIYDSLGKRWAITFMSLMAFCQFLMGCSICTAISRQIWAFSRDDGLPLSKYIKIVDKRYS 419

Query: 419 SPLRATWFXXXXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPG 478
            P  A                  STA+ ALFS+ +A NY AW  P LLR TTG+++F PG
Sbjct: 420 VPFNAIIAACVTCLVLGLLCLIDSTAANALFSLAVAGNYLAWSIPTLLRFTTGRDLFRPG 479

Query: 479 AFYMGNFWSPVINWTSXXXXXXXXXXXXXPSSQHNITADTMNYTCVFVGFVWFGSIAYYY 538
            FY+G   S ++ WT              P+ ++ I    MNY CV    +WF S  YY 
Sbjct: 480 PFYLGKPLSAIVGWTGICYEFFIIIMVMFPTQKNGINKTNMNYACVIGPGIWFLSWIYYI 539

Query: 539 FYKHRTFHGPKSNLTDDEFVDAVGQDVIDEILSNQ 573
            YK + F GPK+NL++D++ + V  D IDEI+ ++
Sbjct: 540 AYKKKYFRGPKTNLSEDDYEEMVAIDNIDEIMMSK 574

>NDAI0C03150 Chr3 complement(717726..719450) [1725 bp, 574 aa] {ON}
           Anc_5.112
          Length = 574

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/540 (51%), Positives = 357/540 (66%), Gaps = 4/540 (0%)

Query: 36  TSLRTITSKR-AGEVNYINAKAAHDDTELLAEIGYKQELNRHFSTIQVFGIAFSIMGLLP 94
           ++LR+I SK  AGEVNYINA  + +D +LLAEIGYKQEL R FST+QVFGIAFSIMGLLP
Sbjct: 37  SNLRSIISKTGAGEVNYINASKSVNDNQLLAEIGYKQELKRQFSTLQVFGIAFSIMGLLP 96

Query: 95  SIASILGMAFAGGAISLVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKF 154
           SIAS++G   +GG++S VWGW I+  FIL VG  MAE ASAIPT+GGL       AP  +
Sbjct: 97  SIASVMGTGISGGSVSFVWGWFIASFFILLVGISMAENASAIPTAGGLYYWTYYYAPKGY 156

Query: 155 KKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIX 214
           K+V SF+IG SNSLAL+A LCSIDYGLA+EI++ VV++ DGDF IT+ + Y V+   +I 
Sbjct: 157 KEVFSFIIGCSNSLALVAGLCSIDYGLAEEIMAAVVVTYDGDFNITDGRLYAVFLASVIV 216

Query: 215 XXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXXXGVSQSDDVTFNGGKFIFGNFENFG 274
                        +LQ  SIVSN             G       TFN   FIFG FENF 
Sbjct: 217 MALCTSMASGVIARLQNISIVSNLFIIVLLFIALPVGTKHKRG-TFNDASFIFGGFENFS 275

Query: 275 DWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISI 334
           DW  GW+F + GF P VW IG+FDSC+H SEEAK+A K+VP+GI+ SIS CWI+G+ I I
Sbjct: 276 DWNGGWQFCLTGFMPAVWTIGSFDSCVHQSEEAKDAKKSVPVGIIGSISACWILGWLIII 335

Query: 335 AIVACMGSNISAILDTVYGQPLAQILYNALGKKWAMTFMTLIAFCQFIMGASTLTAISRQ 394
            ++AC+   +  +LDT YG P+AQ++Y++LGKKW + F++L+AFCQF+MG S  TAISRQ
Sbjct: 336 CLMACIDPQLENVLDTQYGFPMAQLIYDSLGKKWTIAFLSLMAFCQFLMGCSICTAISRQ 395

Query: 395 IWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXXXXXXXXXXXXXXXSTASAALFSMYIA 454
           IWAF+RDDGLPFS +IK+V+   S P  A                  +TA+ ALFS+ +A
Sbjct: 396 IWAFSRDDGLPFSKYIKQVHN--SVPFFAILAACVSSLVLGLLCLIDATAANALFSLAVA 453

Query: 455 ANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFWSPVINWTSXXXXXXXXXXXXXPSSQHNI 514
            NY AW TP LLR+T+G++IF PG FY+G   SP+++W               PS QH I
Sbjct: 454 GNYLAWCTPTLLRLTSGRDIFRPGPFYLGKVLSPIVSWIGVLYEVFIIIMEMFPSQQHGI 513

Query: 515 TADTMNYTCVFVGFVWFGSIAYYYFYKHRTFHGPKSNLTDDEFVDAVGQDVIDEILSNQK 574
               MNY CV    +WF +  YY  YK + +HGPK+NL+D+E+ D VG DVID IL  ++
Sbjct: 514 NKTNMNYACVIGPGIWFLAWIYYLLYKKKYYHGPKTNLSDEEYSDMVGIDVIDGILEQKE 573

>TDEL0G01370 Chr7 (274664..276373) [1710 bp, 569 aa] {ON} Anc_5.112
          Length = 569

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/567 (50%), Positives = 378/567 (66%), Gaps = 6/567 (1%)

Query: 11  NQIKTSARELHPIVSANANG-EVQQITS--LRTITSKR-AGEVNYINAKAAHDDTELLAE 66
           + IK++ R    + ++  +  E+ Q++S  +R + SK  AGEVNYIN+  + +D +LLAE
Sbjct: 3   DDIKSAIRSGPRLSTSEGSAFELHQLSSSDVRYVRSKTGAGEVNYINSATSVNDGQLLAE 62

Query: 67  IGYKQELNRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFILSVG 126
           IGYKQEL R FST+QVFG+AFSIMGLLPSIAS++G    GG ++LVWGW I+  FIL VG
Sbjct: 63  IGYKQELKRQFSTLQVFGVAFSIMGLLPSIASVMGGGLTGGPVTLVWGWFIAAFFILLVG 122

Query: 127 AGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEIL 186
             MAE ASAIPT+GGL       AP  +K+++SF+IG SNSLAL A +CSI YG A E+L
Sbjct: 123 ITMAENASAIPTAGGLYYWTYYYAPKGYKEIVSFVIGCSNSLALSAGVCSISYGFALEVL 182

Query: 187 SIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXX 246
           + VVIS+DGDFE+T  KTYG++A  ++              +LQT SIVSN         
Sbjct: 183 AAVVISRDGDFEVTTGKTYGIFAAVVVAQGVVTCLSSGLVARLQTLSIVSNVFIMILLFI 242

Query: 247 XXXXGVSQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEE 306
               G ++ +   FN G+FIFG ++NF DW  GW+F +AGF P VW IG+FDSC+H SEE
Sbjct: 243 ALPIG-AKVNRGGFNNGEFIFGTYQNFSDWNSGWQFCLAGFMPAVWTIGSFDSCVHQSEE 301

Query: 307 AKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGK 366
           AK+A K+VPIGI+ SI+ CWI+G+ I I ++ACM S+IS +LDT Y   LAQI+Y+ LGK
Sbjct: 302 AKDAKKSVPIGIIGSIAACWILGWLIIICLMACMDSDISKVLDTDYEIILAQIVYDCLGK 361

Query: 367 KWAMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWF 426
            WA+ FM LIAFCQF+MGAS +TA SRQIWAFARDDGLP S +IKKV+ K S P  A   
Sbjct: 362 NWAIAFMALIAFCQFLMGASIVTAASRQIWAFARDDGLPLSKYIKKVDKKYSVPFVAI-I 420

Query: 427 XXXXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFW 486
                          + A+AALFS+ +A N  AW TP  LR+T G+++F PG FY+G  W
Sbjct: 421 AACVASLLLGLLCLDAAAAAALFSLAVAGNNLAWSTPTFLRLTWGRDLFRPGPFYLGKLW 480

Query: 487 SPVINWTSXXXXXXXXXXXXXPSSQHNITADTMNYTCVFVGFVWFGSIAYYYFYKHRTFH 546
           SP+I W               PS++H +T  TMNY CV    +W  S  YY  Y+ + FH
Sbjct: 481 SPIIAWIGVVYQAFIIILVMFPSARHGLTPQTMNYACVIGPGLWILSWIYYMVYRKKYFH 540

Query: 547 GPKSNLTDDEFVDAVGQDVIDEILSNQ 573
           GPKSNL+D+++ +AVG+D+I+EILS +
Sbjct: 541 GPKSNLSDEDYNEAVGEDLIEEILSRK 567

>KNAG0K01030 Chr11 (202385..204130) [1746 bp, 581 aa] {ON} Anc_8.468
           YDL210W
          Length = 581

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/546 (52%), Positives = 361/546 (66%), Gaps = 7/546 (1%)

Query: 1   MSDSSSYVEKNQIKTSARELHPIVSANANGEVQQ-ITSLRTITSKR-AGEVNYINAKAAH 58
           MS +SS  E  Q+ T  R      SA    E+++  +++R++ S+  AGEVN+I+A A  
Sbjct: 1   MSLTSSKKE-TQVVTEQRLSVDFGSAE---EIERPFSNIRSVRSQTGAGEVNFIDAGATV 56

Query: 59  DDTELLAEIGYKQELNRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLIS 118
            D +LLAEIGYKQELNR FSTIQVFGIAFSIMGLLPSIAS++G   AGG  +LVWGW I+
Sbjct: 57  SDHQLLAEIGYKQELNRQFSTIQVFGIAFSIMGLLPSIASVMGGGLAGGPTTLVWGWFIA 116

Query: 119 GAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSID 178
           G FIL+VG  MAE ASAIPT+GGL       AP  +K+V+SF+IG SNSLAL A +CSID
Sbjct: 117 GCFILTVGIAMAENASAIPTAGGLYYWTYYYAPKGYKEVISFVIGCSNSLALAAGVCSID 176

Query: 179 YGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNX 238
           YG A+E+L+ VVI+KDG+FEIT  KTYGV+A  ++              +LQT SIVSN 
Sbjct: 177 YGFAEEVLAAVVIAKDGNFEITPGKTYGVFAAAVVAMGICTCMASKAIARLQTISIVSNL 236

Query: 239 XXXXXXXXXXXXGVSQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFD 298
                       G ++ +   FN G FIFG F+N  DW +GW+F +AGF P VW IGAFD
Sbjct: 237 FIIVLLFIALPIG-TKINMGGFNDGSFIFGKFKNLSDWNNGWQFFLAGFMPVVWTIGAFD 295

Query: 299 SCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQ 358
           SC+H SEEAK+A K+VPIGI+ SISVCW++G+ I I ++ACM  +I  I+D  YG  +AQ
Sbjct: 296 SCVHQSEEAKDAKKSVPIGIIGSISVCWVLGWLILICLMACMSPDIEGIVDNKYGFAMAQ 355

Query: 359 ILYNALGKKWAMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLS 418
           I+Y++LGKKWA+ FM+LIAFCQF+MG+S +TAISRQIWAFARDDGLP S +IK V+ K  
Sbjct: 356 IIYDSLGKKWAVAFMSLIAFCQFLMGSSVVTAISRQIWAFARDDGLPLSDYIKMVDKKYK 415

Query: 419 SPLRATWFXXXXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPG 478
            P  A  F               + A++ALFS+ +A N  AW TP LLR+T+G+++F PG
Sbjct: 416 VPFNAIIFACCGSLILGLLCLIDAAATSALFSLAVAGNNLAWSTPTLLRLTSGRDLFRPG 475

Query: 479 AFYMGNFWSPVINWTSXXXXXXXXXXXXXPSSQHNITADTMNYTCVFVGFVWFGSIAYYY 538
            FY+G  WS V  W S             PS +H IT  TMNYTCV    +WF S  YY 
Sbjct: 476 PFYLGPVWSKVNGWISIIFEAFIIIVVMFPSEKHGITKSTMNYTCVIGPGIWFLSWVYYS 535

Query: 539 FYKHRT 544
            YK  T
Sbjct: 536 VYKKST 541

>YDL210W Chr4 (84270..85985) [1716 bp, 571 aa] {ON}  UGA4Permease
           that serves as a gamma-aminobutyrate (GABA) transport
           protein involved in the utilization of GABA as a
           nitrogen source; catalyzes the transport of putrescine
           and delta-aminolevulinic acid (ALA); localized to the
           vacuolar membrane
          Length = 571

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/540 (50%), Positives = 364/540 (67%), Gaps = 2/540 (0%)

Query: 36  TSLRTITSKR-AGEVNYINAKAAHDDTELLAEIGYKQELNRHFSTIQVFGIAFSIMGLLP 94
           ++LR+I SK  AGEVNYI+A  + +D +LLAEIGYKQEL R FST+QVFGIAFSIMGLLP
Sbjct: 32  SNLRSIRSKTGAGEVNYIDAAKSVNDNQLLAEIGYKQELKRQFSTLQVFGIAFSIMGLLP 91

Query: 95  SIASILGMAFAGGAISLVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKF 154
           SIAS++G    GG  +LVWGW ++  FIL VG  MAE AS+IPT+GGL       AP  +
Sbjct: 92  SIASVMGGGLGGGPATLVWGWFVAAFFILLVGITMAEHASSIPTAGGLYYWTYYYAPEGY 151

Query: 155 KKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIX 214
           K+++SF+IG SNSLAL A +CSIDYGLA+EI + V ++KDG+FE+T+ K YG++AG ++ 
Sbjct: 152 KEIISFIIGCSNSLALAAGVCSIDYGLAEEIAAAVTLTKDGNFEVTSGKLYGIFAGAVVV 211

Query: 215 XXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXXXGVSQSDDVTFNGGKFIFGNFENFG 274
                        +LQT SI +N             G        FN G FIFG +EN  
Sbjct: 212 MCICTCVASGAIARLQTLSIFANLFIIVLLFIALPIGTKHRMG-GFNDGDFIFGKYENLS 270

Query: 275 DWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISI 334
           DW +GW+F +AGF P VW IG+FDSC+H SEEAK+A K+VPIGI++SI+VCWI+G+ I I
Sbjct: 271 DWNNGWQFCLAGFMPAVWTIGSFDSCVHQSEEAKDAKKSVPIGIISSIAVCWILGWLIII 330

Query: 335 AIVACMGSNISAILDTVYGQPLAQILYNALGKKWAMTFMTLIAFCQFIMGASTLTAISRQ 394
            ++AC+  +I ++LD+ YG  LAQI+Y++LGKKWA+ FM+LIAFCQF+MGAS  TA+SRQ
Sbjct: 331 CLMACINPDIDSVLDSKYGFALAQIIYDSLGKKWAIAFMSLIAFCQFLMGASITTAVSRQ 390

Query: 395 IWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXXXXXXXXXXXXXXXSTASAALFSMYIA 454
           +WAF+RD+GLP S +IK+V++K S P  A                    A+ ALFS+ +A
Sbjct: 391 VWAFSRDNGLPLSKYIKRVDSKYSVPFFAILAACVGSLILGLLCLIDDAATDALFSLAVA 450

Query: 455 ANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFWSPVINWTSXXXXXXXXXXXXXPSSQHNI 514
            N  AW TP + R+T+G+++F PG FY+G  WSP++ WT              PS QH I
Sbjct: 451 GNNLAWSTPTVFRLTSGRDLFRPGPFYLGKIWSPIVAWTGVAFQLFIIILVMFPSQQHGI 510

Query: 515 TADTMNYTCVFVGFVWFGSIAYYYFYKHRTFHGPKSNLTDDEFVDAVGQDVIDEILSNQK 574
           T  TMNY CV    +W  +  YY  YK + +HGP +NL+DD++ +AVG DVID I+S Q+
Sbjct: 511 TKSTMNYACVIGPGIWILAGIYYKVYKKKYYHGPATNLSDDDYTEAVGADVIDTIMSKQE 570

>Smik_4.30 Chr4 (62468..64183) [1716 bp, 571 aa] {ON} YDL210W (REAL)
          Length = 571

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/540 (50%), Positives = 367/540 (67%), Gaps = 2/540 (0%)

Query: 36  TSLRTITSKR-AGEVNYINAKAAHDDTELLAEIGYKQELNRHFSTIQVFGIAFSIMGLLP 94
           ++LR+I SK  AGEVNYI+A  + +D +LLAEIGYKQEL R FSTIQVFGIAFSIMGLLP
Sbjct: 32  SNLRSIRSKTGAGEVNYIDAAKSVNDNQLLAEIGYKQELKRQFSTIQVFGIAFSIMGLLP 91

Query: 95  SIASILGMAFAGGAISLVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKF 154
           SIAS++G    GG  +LVWGW I+  FIL VG  MAE AS+IPT+GGL       AP  +
Sbjct: 92  SIASVMGGGLGGGPATLVWGWFIAAFFILLVGITMAEHASSIPTAGGLYYWTYYYAPEGY 151

Query: 155 KKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIX 214
           K+++SF+IG SNSLAL A +CSIDYGLA+EI + + ++KDG+F++T+ K YG++AG ++ 
Sbjct: 152 KEIISFIIGCSNSLALAAGVCSIDYGLAEEIAAAITLTKDGNFDVTSGKLYGIFAGAVVV 211

Query: 215 XXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXXXGVSQSDDVTFNGGKFIFGNFENFG 274
                        +LQT SI +N             G ++ +   FN G FIFG +EN  
Sbjct: 212 MGICTCIASGAIARLQTLSIFANLFIIVLLFIALPIG-TKHNIGGFNNGDFIFGKYENLS 270

Query: 275 DWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISI 334
           DW  GW+F +AGF P VW IG+FDSC+H SEEAK+A K+VPIGI++SI+VCWI+G+ I I
Sbjct: 271 DWNKGWQFCLAGFMPAVWTIGSFDSCVHQSEEAKDAKKSVPIGIISSITVCWILGWLIII 330

Query: 335 AIVACMGSNISAILDTVYGQPLAQILYNALGKKWAMTFMTLIAFCQFIMGASTLTAISRQ 394
            ++AC+  +I ++LD+ YG  LAQI+Y++LGKKWA+ FM+LIAFCQF+MGAS  TA+SRQ
Sbjct: 331 CLMACINPDIDSVLDSKYGFALAQIIYDSLGKKWAIAFMSLIAFCQFLMGASITTAVSRQ 390

Query: 395 IWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXXXXXXXXXXXXXXXSTASAALFSMYIA 454
           +WAF+RD+GLP S +IK+V++K S P  A                    A+ ALFS+ +A
Sbjct: 391 VWAFSRDNGLPLSKYIKRVDSKYSVPFFAILAACAGSLILGLLCLIDDAATDALFSLAVA 450

Query: 455 ANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFWSPVINWTSXXXXXXXXXXXXXPSSQHNI 514
            N  AW TP +LR+T+G+++F PG FY+G  WSP++ W               P+ QH I
Sbjct: 451 GNNLAWSTPTVLRLTSGRDLFRPGPFYLGKIWSPIVAWIGVAFQVFIIILVMFPAQQHGI 510

Query: 515 TADTMNYTCVFVGFVWFGSIAYYYFYKHRTFHGPKSNLTDDEFVDAVGQDVIDEILSNQK 574
           T  TMNY CV    +WF +  YY  YK + +HGP +NL+DD++ +AVG DVID I+S Q+
Sbjct: 511 TKSTMNYACVIGPGIWFLAGVYYKVYKKKYYHGPATNLSDDDYAEAVGIDVIDTIISKQE 570

>Skud_4.46 Chr4 (81451..83166) [1716 bp, 571 aa] {ON} YDL210W (REAL)
          Length = 571

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/550 (50%), Positives = 374/550 (68%), Gaps = 6/550 (1%)

Query: 30  GEVQQI----TSLRTITSKR-AGEVNYINAKAAHDDTELLAEIGYKQELNRHFSTIQVFG 84
           GE  Q+    ++LR+I SK  AGEVNYINA  + +D +LLAEIGYKQEL R FST+QVFG
Sbjct: 22  GEAYQLEGLGSNLRSIRSKTGAGEVNYINAAKSVNDNQLLAEIGYKQELKRQFSTVQVFG 81

Query: 85  IAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFILSVGAGMAELASAIPTSGGLXX 144
           IAFSIMGLLPSIAS++G    GG  +L+WGW ++  FIL VG  MAE ASAIPT+GGL  
Sbjct: 82  IAFSIMGLLPSIASVMGGGLGGGPATLLWGWFVAAFFILLVGITMAEHASAIPTAGGLYY 141

Query: 145 XXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVVISKDGDFEITNAKT 204
                AP  +K+++SF+IG SNSLAL A +CSIDYGLA+EI + V +++DG+F+ T+ K 
Sbjct: 142 WTYHYAPEGYKEIISFIIGCSNSLALAAGVCSIDYGLAEEIAAAVTLTRDGNFDATSGKL 201

Query: 205 YGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXXXGVSQSDDVTFNGGK 264
           YG++AG ++              +LQT SIV+N             G ++ +   FN G+
Sbjct: 202 YGIFAGAVVLMGICTCIASGAIARLQTVSIVANLFIIVLLFIALPIG-TKHNMGGFNNGE 260

Query: 265 FIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISV 324
           FIFG FEN  DW +GW+F +AGF P VW IG+FDSC+H SEEAK+A K+VPIGI++SI+V
Sbjct: 261 FIFGKFENMSDWNNGWQFCLAGFMPAVWTIGSFDSCVHQSEEAKDAKKSVPIGIISSIAV 320

Query: 325 CWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKKWAMTFMTLIAFCQFIMG 384
           CW++G  I I ++AC+  +I ++L++ YG  LAQI+Y++LGKKWA+ FM+LIAFCQF+MG
Sbjct: 321 CWVLGLLIIICLLACINPDIDSVLNSKYGFALAQIIYDSLGKKWAIAFMSLIAFCQFLMG 380

Query: 385 ASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXXXXXXXXXXXXXXXSTA 444
           AS  TA+SRQ+WAF+RD+GLP S +IK+V++K S P  A                    A
Sbjct: 381 ASITTAVSRQVWAFSRDNGLPLSKYIKRVDSKYSVPFYAILAACVGSLILGLLCLIDEAA 440

Query: 445 SAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFWSPVINWTSXXXXXXXXXX 504
           ++ALFS+ +A N  AW TP +LR+T+G+++F PG FY+G FWSP+I W            
Sbjct: 441 TSALFSLAVAGNNLAWSTPTVLRLTSGRDLFRPGPFYLGKFWSPIIAWIGVAFQVFIIIL 500

Query: 505 XXXPSSQHNITADTMNYTCVFVGFVWFGSIAYYYFYKHRTFHGPKSNLTDDEFVDAVGQD 564
              PS QH IT  TMNY CV    +WF +  YY  YK + +HGP +NL+DD++ DAVG D
Sbjct: 501 VMFPSQQHGITKSTMNYACVIGPGIWFLAGVYYKVYKKKYYHGPATNLSDDDYADAVGVD 560

Query: 565 VIDEILSNQK 574
           VID I+S Q+
Sbjct: 561 VIDAIISKQE 570

>ZYRO0B15048g Chr2 complement(1226178..1227926) [1749 bp, 582 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 582

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/556 (50%), Positives = 363/556 (65%), Gaps = 3/556 (0%)

Query: 15  TSARELHPIVSANANGEVQQITS-LRTITSKRAGEVNYINAKAAHDDTELLAEIGYKQEL 73
           TSA EL    +     E + + S +R++ S  AGEVNYIN+  ++ D  LLAEIGYKQEL
Sbjct: 18  TSAAELDGEKNEGTLLEFRGLKSHIRSVRSPVAGEVNYINSATSNTDKGLLAEIGYKQEL 77

Query: 74  NRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFILSVGAGMAELA 133
            R FSTIQVFG+AFSIMGLLPSI ++L    AGG +S +WGWLI+G FIL +G  MAE A
Sbjct: 78  ERKFSTIQVFGVAFSIMGLLPSIGTLLSDGLAGGPVSTIWGWLIAGFFILVLGLAMAENA 137

Query: 134 SAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVVISK 193
           SAIPT+GGL       AP  +K V+SF+IG SNSLAL A  CSI YG A+E+L+ VV++K
Sbjct: 138 SAIPTAGGLYYWTYYYAPKGYKAVMSFIIGCSNSLALTAACCSITYGFAEEVLAAVVLTK 197

Query: 194 DGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXXXGVS 253
           DG+F++TN K YG++AG  I              KLQT SI+ N             G +
Sbjct: 198 DGNFDVTNGKLYGIFAGAAIMMGVCTSVASGFVAKLQTLSIICNLFIIVLFFIAVPIG-A 256

Query: 254 QSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKA 313
           + +   FN G FIF N++N  DW +GW+F +AGF P +W IG FDSC+H SEEAK+A K+
Sbjct: 257 KVNRGKFNHGHFIFANYQNSSDWNNGWQFCLAGFMPAIWTIGGFDSCVHQSEEAKDAKKS 316

Query: 314 VPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKKWAMTFM 373
           V +GI+ SISVCWI+G+FI I ++ACM  ++S  ++T Y   +AQI+Y+ LGK WA+ FM
Sbjct: 317 VALGIVGSISVCWILGWFILIVLLACMDPDVSKTMNTKYVLSIAQIIYDCLGKNWAIAFM 376

Query: 374 TLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXXXXXXX 433
           +LIAFCQF+MGAST+TA+SRQIWAF+RD+GLPFS +IKKVN   S P  A          
Sbjct: 377 SLIAFCQFLMGASTITAVSRQIWAFSRDNGLPFSKYIKKVNKTYSIPFVAI-IAACCGTL 435

Query: 434 XXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFWSPVINWT 493
                     A+ ALFS+ +A N  +W TP  LR+T GK++F PG FY+G F S V  W 
Sbjct: 436 VLGLLCLQDEAANALFSLSVAGNNLSWGTPTFLRLTFGKDLFRPGPFYLGKFLSTVNGWI 495

Query: 494 SXXXXXXXXXXXXXPSSQHNITADTMNYTCVFVGFVWFGSIAYYYFYKHRTFHGPKSNLT 553
           S             P+SQHN+T  +MNY CV    VW  S  YY  YK + +HGP SNLT
Sbjct: 496 SVFWGLFVIILVMFPTSQHNVTPQSMNYACVIGPGVWILSFIYYITYKKKYYHGPASNLT 555

Query: 554 DDEFVDAVGQDVIDEI 569
           ++E+V+AVG+DV+D I
Sbjct: 556 EEEYVNAVGEDVLDNI 571

>SAKL0E14806g Chr5 (1222639..1224375) [1737 bp, 578 aa] {ON} similar
           to uniprot|P32837 Saccharomyces cerevisiae YDL210W UGA4
           Permease that serves as a gamma-aminobutyrate (GABA)
           transport protein involved in the utilization of GABA as
           a nitrogen source catalyzes the transport of putrescine
           and delta-aminolevulinic acid (ALA) localized to the
           vacuolar membrane
          Length = 578

 Score =  528 bits (1359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/561 (46%), Positives = 359/561 (63%), Gaps = 3/561 (0%)

Query: 15  TSARELHPIVSANANGEVQQITSLRTITSKRAGEVNYINAKAAHDDTELLAEIGYKQELN 74
           +S +++     +N +  V  +  LR+ITS     + YI+AK A  D ++LAEIGYK+EL 
Sbjct: 10  SSTKDMISARKSNVDIGVGNVAELRSITSAHGAPIRYIDAKNATSDQQVLAEIGYKEELK 69

Query: 75  RHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFILSVGAGMAELAS 134
           R FST+Q+FG+AFSIMGLLPSIAS +      G + L WGW ++G  IL+VG  +AEL+S
Sbjct: 70  REFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTVGIALAELSS 129

Query: 135 AIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVVISKD 194
           +IPT+G +       AP +++K +S+ +G  ++L+L A +CSI YGLAQ+ILS VV+S +
Sbjct: 130 SIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVS-N 188

Query: 195 GDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXXXGVSQ 254
            DF +T+  TYGV+A C+I              KLQT SIVSN             GVS+
Sbjct: 189 PDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCFLIILFFIALPIGVSR 248

Query: 255 SDDV--TFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATK 312
           SD +  +FN  KFIFG  ENF DW  GW + + G  P +W IGA+DSC+HM+EEA++A +
Sbjct: 249 SDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDAVR 308

Query: 313 AVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKKWAMTF 372
           AVPIGI+ SI+ CWI+G+ I I ++ACM  +++ I+++ YGQ + Q+ Y+ALGK+W + F
Sbjct: 309 AVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTLAF 368

Query: 373 MTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXXXXXX 432
           ++ +  CQF+MGAST+ A SRQ WAFARDD LPFS + KKVN  ++ P+RA W       
Sbjct: 369 LSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWGSSILSL 428

Query: 433 XXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFWSPVINW 492
                      A+ ALFS+ IA  Y A + P  LR+T GK+ F PG FYMG+FWSP+INW
Sbjct: 429 ALGCLCLAGEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPIINW 488

Query: 493 TSXXXXXXXXXXXXXPSSQHNITADTMNYTCVFVGFVWFGSIAYYYFYKHRTFHGPKSNL 552
            S             P  QHNI  DTMNYT V     W  S+ YYYF++ + + GPKSNL
Sbjct: 489 ISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEGPKSNL 548

Query: 553 TDDEFVDAVGQDVIDEILSNQ 573
           +D+EF + VG DV+D ILS+ 
Sbjct: 549 SDEEFAERVGDDVLDAILSSN 569

>KLLA0E12959g Chr5 complement(1146299..1148038) [1740 bp, 579 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 579

 Score =  523 bits (1346), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 257/566 (45%), Positives = 363/566 (64%), Gaps = 3/566 (0%)

Query: 9   EKNQIKTSARELHPIVSANANGEVQ--QITSLRTITSKRAGEVNYINAKAAHDDTELLAE 66
           +++  K+S    H I   N+N E+    ++ LR +TS     + YI+A +A  DT++LAE
Sbjct: 5   QESMSKSSGAVEHLINRNNSNDEIGFGSVSELRVVTSAHGAPIRYIDALSATSDTQVLAE 64

Query: 67  IGYKQELNRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFILSVG 126
           IGYK+EL R +ST+Q+FG+AFSIMGLLPSIAS +    A GA+ L WGW ++G  ILSVG
Sbjct: 65  IGYKEELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLILSVG 124

Query: 127 AGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEIL 186
             + EL+S+IPT+G +       AP K++K +S+ +G  ++L+L A +CSI YGLAQ+IL
Sbjct: 125 IALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQIL 184

Query: 187 SIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXX 246
           S VV+  + DFE+T+  TYGV+  CI+              +LQTFSI++N         
Sbjct: 185 SAVVVG-NPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSIIANVFLIILFFI 243

Query: 247 XXXXGVSQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEE 306
               GVS+SD V+FN   +IFG+ +N  DW  GW + + G  P +W IGA+DSC+HM+EE
Sbjct: 244 VLPIGVSRSDKVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEE 303

Query: 307 AKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGK 366
           AK+A +AVPIGI+ SIS CWI+G+ I I I+ACM  +++AI+++ YGQ + Q+  +ALGK
Sbjct: 304 AKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGK 363

Query: 367 KWAMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWF 426
           +W +TF++LI  CQF+MGAST+ A SRQ WAFARDDG+PFS + KKV+ +   P+R+ W 
Sbjct: 364 RWTLTFLSLIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWG 423

Query: 427 XXXXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFW 486
                           TA+ ALFS+ IA  Y A + P  LR+T G++ F PG FY+G+FW
Sbjct: 424 SSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFW 483

Query: 487 SPVINWTSXXXXXXXXXXXXXPSSQHNITADTMNYTCVFVGFVWFGSIAYYYFYKHRTFH 546
           S    W +             P  +  IT +TMNYT V     W  S+ YY+ ++ + + 
Sbjct: 484 STANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKFYE 543

Query: 547 GPKSNLTDDEFVDAVGQDVIDEILSN 572
           GPKSNLTD+EFV+AVG+D ID +LSN
Sbjct: 544 GPKSNLTDEEFVEAVGEDAIDAMLSN 569

>KNAG0E00820 Chr5 (152560..154275) [1716 bp, 571 aa] {ON} Anc_5.112
          Length = 571

 Score =  518 bits (1334), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 258/536 (48%), Positives = 352/536 (65%), Gaps = 2/536 (0%)

Query: 36  TSLRTITSKR-AGEVNYINAKAAHDDTELLAEIGYKQELNRHFSTIQVFGIAFSIMGLLP 94
           + +RT+ S   AGEVNYIN+  +  D +LLAEIGYK EL R FST+QVFGIAFSIMGLLP
Sbjct: 32  SRVRTVRSHTGAGEVNYINSVQSVSDNQLLAEIGYKPELKRQFSTLQVFGIAFSIMGLLP 91

Query: 95  SIASILGMAFAGGAISLVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKF 154
           SIAS++    AGG +SLVWGW  S   IL VG  MAE ASAIPT+GG+       AP K+
Sbjct: 92  SIASVMAGGLAGGPVSLVWGWFSSCIGILIVGITMAENASAIPTAGGMYYWTYYYAPKKY 151

Query: 155 KKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIX 214
           K VLSF++G SNSLAL+A  CSI+YG A+E+++ V ++ DG   +T+ K YG++AG  + 
Sbjct: 152 KAVLSFVVGCSNSLALVASCCSINYGFAEEVMAAVFLTYDGAVTVTSGKLYGIFAGATVV 211

Query: 215 XXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXXXGVSQSDDVTFNGGKFIFGNFENFG 274
                        +LQT SIVSN             G ++++   FN GK+IFG+FEN  
Sbjct: 212 MAMCTCVASGAIARLQTVSIVSNIFIIILFVIAVPIG-TKANIGHFNDGKYIFGHFENLS 270

Query: 275 DWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISI 334
           DW +G+ F +AGF P  W I +FDSC+H SEEAK+A K+VPIGI+ SI+ CWI+GF I I
Sbjct: 271 DWNNGFLFFLAGFMPAAWTISSFDSCVHQSEEAKDAKKSVPIGIIGSITACWILGFLIII 330

Query: 335 AIVACMGSNISAILDTVYGQPLAQILYNALGKKWAMTFMTLIAFCQFIMGASTLTAISRQ 394
            + ACM +++  ++++  G  +AQI++++LGK+WA+ FM LIAFCQF+MGAS +TAISRQ
Sbjct: 331 CLCACMDTDLDRLVNSDTGFAMAQIIFDSLGKRWAIAFMALIAFCQFLMGASIVTAISRQ 390

Query: 395 IWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXXXXXXXXXXXXXXXSTASAALFSMYIA 454
           IWAFARDDGLPFS  IK V+ +   P  +                  S A+AALFS+ +A
Sbjct: 391 IWAFARDDGLPFSNLIKYVDKRYQVPFNSVIAAAITSLLLGLLCLINSQATAALFSLSVA 450

Query: 455 ANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFWSPVINWTSXXXXXXXXXXXXXPSSQHNI 514
             Y A++ P +LR+T G+++F PG FY+G FWSP++ W+S             P+ QH+I
Sbjct: 451 GGYIAYLIPTVLRLTVGRDVFRPGPFYLGKFWSPIVAWSSVVFEIWIILLEMFPAQQHHI 510

Query: 515 TADTMNYTCVFVGFVWFGSIAYYYFYKHRTFHGPKSNLTDDEFVDAVGQDVIDEIL 570
              TMNY+CV        +  YY  +KHR + GPKSNL+D+++ +A+G  V+D+I+
Sbjct: 511 DKSTMNYSCVIGPGTCLLAWIYYRVWKHREYIGPKSNLSDEDYKEALGPAVLDDII 566

>KLTH0E01144g Chr5 complement(113309..115027) [1719 bp, 572 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W Permease that serves as a gamma- aminobutyrate
           (GABA) transport protein involved in the utilization of
           GABA as a nitrogen source; catalyzes the transport of
           putrescine and delta-aminolevulinic acid (ALA);
           localized to the vacuolar membrane
          Length = 572

 Score =  510 bits (1314), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 262/576 (45%), Positives = 361/576 (62%), Gaps = 14/576 (2%)

Query: 1   MSDSSSYVEKNQIKTSARELHPIVSANANGEVQQITSLRTITSKRAGEVNYINAKAAHDD 60
           MS SSS   K  IK   R+ H       + EV Q+  L TITS     + +++A++A  D
Sbjct: 1   MSASSS--NKGTIKN--RKSH------VDVEVGQMRELGTITSAHGAPIRFVDARSATSD 50

Query: 61  TELLAEIGYKQELNRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGA 120
            ++LAE+GYK+EL R FS+IQ+FG+AFSIMGLLPSIAS L    + G + L WGW I+G 
Sbjct: 51  QQVLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGG 110

Query: 121 FILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYG 180
            IL++G  + EL+SA+PT+G +       AP + +K +S+ +G  ++L+L A +CSI YG
Sbjct: 111 LILTIGIALGELSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYG 170

Query: 181 LAQEILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXX 240
           LAQ+ILS V++S + DF  T+  TYGV+A CI+              KLQT SI+SN   
Sbjct: 171 LAQQILSAVLVS-NPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFL 229

Query: 241 XXXXXXXXXXGVSQSDDV--TFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFD 298
                     GVS+SD +  +FNGG FIFG  +N   W  GW + +AG  P +W IGA+D
Sbjct: 230 IVLFFIAIPIGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYD 289

Query: 299 SCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQ 358
           SC+HM+EEA++A +AVP GI+ SI+VCWI+G+ + I I+ACM  +I ++LD+ +GQ + Q
Sbjct: 290 SCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQ 349

Query: 359 ILYNALGKKWAMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLS 418
           I+Y+ALGK+W + F+++   CQF+MGAST+ A SRQ WAFARDDG PFS + KKV+    
Sbjct: 350 IIYDALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTG 409

Query: 419 SPLRATWFXXXXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPG 478
            P+RA W                 TAS ALFS+ +A  Y A + P  LR+T GK+ F PG
Sbjct: 410 VPVRAVWGSSALSLALGCLCLVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPG 469

Query: 479 AFYMGNFWSPVINWTSXXXXXXXXXXXXXPSSQHNITADTMNYTCVFVGFVWFGSIAYYY 538
            FY+G+FWSP+INW S             P S   +T  TMNYT V     W  S+ YY+
Sbjct: 470 PFYLGDFWSPIINWISVFFQAFVIIMMMFP-SDSTVTPTTMNYTVVIGPGFWVLSLIYYF 528

Query: 539 FYKHRTFHGPKSNLTDDEFVDAVGQDVIDEILSNQK 574
            ++ + + GPKSNLTD+EF + VG DVID I+SN +
Sbjct: 529 VWQRKFYKGPKSNLTDEEFQEYVGDDVIDAIMSNNE 564

>Kwal_55.19721 s55 complement(95893..97626) [1734 bp, 577 aa] {ON}
           YDL210W (UGA4) - GABA-specific transport protein [contig
           159] FULL
          Length = 577

 Score =  509 bits (1312), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 254/570 (44%), Positives = 357/570 (62%), Gaps = 6/570 (1%)

Query: 8   VEKNQIKTSARELHPIVSANANGEVQ--QITSLRTITSKRAGEVNYINAKAAHDDTELLA 65
           ++ N +  S+  +  I +  +N EV+  Q+  LRTITS     + +++A++A  D ++LA
Sbjct: 1   MDGNLMSASSSAMDTIKNRKSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLA 60

Query: 66  EIGYKQELNRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFILSV 125
           E+GYK+EL R FS+IQ+FG+AFSIMGLLPSIAS L    + G + L WGW I+G  +L++
Sbjct: 61  ELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTI 120

Query: 126 GAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEI 185
           G  +AEL+S+IPT+G +       AP + +K +S+ +G  ++L+L A +CSI YGLAQ+I
Sbjct: 121 GIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQI 180

Query: 186 LSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXX 245
           LS V++S +  F +TN  TYGV+A CII              ++QT SIVSN        
Sbjct: 181 LSAVLVS-NPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFF 239

Query: 246 XXXXXGVSQSDDV--TFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHM 303
                GVS+SD +   FN G FIFG  +N   W  GW + +AG  P +W IGA+DSC+HM
Sbjct: 240 IAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHM 299

Query: 304 SEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNA 363
           +EEA++A +AVP GI+ SISVCWIVG+ I I ++ACM  NI  +L++ +GQ + QI+Y+A
Sbjct: 300 AEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDA 359

Query: 364 LGKKWAMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRA 423
           LGK+W + F+++   CQF+MGAST+ A SRQ WAFARDDG+PFS + KKV+     P+RA
Sbjct: 360 LGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRA 419

Query: 424 TWFXXXXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMG 483
            W                  AS ALFS+ +A  Y A + P  LR+T GK  F PG FY+G
Sbjct: 420 VWGSSALSLALGCLCLVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLG 479

Query: 484 NFWSPVINWTSXXXXXXXXXXXXXPSSQHNITADTMNYTCVFVGFVWFGSIAYYYFYKHR 543
           + WSP+INW +             P S   +   TMNYT V     W  S+ YY+ ++ +
Sbjct: 480 DVWSPIINWIAVFAQAFMIIMMMFP-SDATVDPSTMNYTVVIGPGFWVLSLIYYFVWQRK 538

Query: 544 TFHGPKSNLTDDEFVDAVGQDVIDEILSNQ 573
            + GPKSNLTD+EF + VG+DVID I+SN 
Sbjct: 539 FYQGPKSNLTDEEFQEYVGEDVIDAIISNN 568

>Skud_7.205 Chr7 complement(365478..367166) [1689 bp, 562 aa] {ON}
           YGL077C (REAL)
          Length = 562

 Score =  122 bits (305), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 130/552 (23%), Positives = 226/552 (40%), Gaps = 39/552 (7%)

Query: 23  IVSANANGE-VQQITSLRTITSKRAGEVNY-INAKAAHDDTELLAEIGYKQELNRHFSTI 80
           I++ N +G+ ++   S  T   KR   V   I      D   ++A  G +  L + FS  
Sbjct: 3   ILNDNPSGDYMEPEQSSNTHIHKRDVRVEEEIKPSDDMDGKGVVAADG-EVHLRKSFSLW 61

Query: 81  QVFGIAFSIMGLLPSIA-SILGMAFAGGAISLVWGWLISGAFILSVGAGMAELASAIPTS 139
            + G+ F +      I+ S++    +GG + +++G +I     + +G  + EL+SA P +
Sbjct: 62  SILGVGFGLTNSWFGISTSMVAGISSGGPMMIIYGIIIVALISICIGTSLGELSSAYPHA 121

Query: 140 GGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVVISKDGDFEI 199
           GG        APPK+K+  +++ G+      +    S    +A E++ +  +      E 
Sbjct: 122 GGQFWWSLKLAPPKYKRFAAYMCGSFAFAGSVFTSASTTLSVATEVVGMYALMHP---EF 178

Query: 200 TNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXXXGVSQSDDVT 259
           T  K + ++                   K       S+              V       
Sbjct: 179 T-PKRWHIFV--CFELLHLFLMLFNCYGKSLPIISSSSLYISLFSFFTITITVLACSHGK 235

Query: 260 FNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGIL 319
           FN  KF+F  F N   W +G    + G     W     D   HM+ E +   + +PI I+
Sbjct: 236 FNDAKFVFATFYNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPIAIM 295

Query: 320 TSISV------CWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKKWAMTFM 373
            ++++      C+++  F SI        ++SA+L +  G P+  I   ALG K    F+
Sbjct: 296 GTVAIGFVTSFCYVIAMFFSI-------KDLSAVLSSTTGAPILDIYNQALGNKSGAIFL 348

Query: 374 -TLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXXXXXX 432
             LI    F    +  T  +R  W+FARD+GLP S +  +VN  +  PL A         
Sbjct: 349 GCLILLTSFGCVIACHTWQARLCWSFARDNGLPLSRYWAQVNPHIGVPLNAHLMSCAWIS 408

Query: 433 XXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGN--FWSPVI 490
                    STA  +L +  IA    +++ P +  +   ++I + G F++G   F+S ++
Sbjct: 409 LIGLLYLASSTAFQSLITGCIAFLLLSYIIPVVCLLAKKRDI-AHGPFWLGKFGFFSNIV 467

Query: 491 --NWTSXXXXXXXXXXXXXPSSQHNITADTMNYTC-VFVGFVWFGSIAYYYFYKHRTFHG 547
              WT                    +T D MNY C V VG+  + S+ Y++F   + FH 
Sbjct: 468 LLGWTIFSVVFFSFPPVL------PVTKDNMNYVCVVIVGYTAY-SLLYWHFKGKKEFHA 520

Query: 548 PKSNLTDDEFVD 559
            +   ++DE  D
Sbjct: 521 VEE--SEDEQAD 530

>NCAS0D03750 Chr4 complement(696686..698395) [1710 bp, 569 aa] {ON}
           Anc_6.205
          Length = 569

 Score =  120 bits (302), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 124/545 (22%), Positives = 222/545 (40%), Gaps = 38/545 (6%)

Query: 16  SARELHPIVSANANGEVQQITSLRTITSKRAGEVNYINAKAAHDDTELLAEIGYKQELNR 75
           S+++   ++++  N ++   TSL     +   + N ++ K    D +     G +  L +
Sbjct: 2   SSQDALDVIASTYNQDIDSNTSLH---QRDTFDKNKLSTKTQELDGDANNNNG-EVHLRK 57

Query: 76  HFSTIQVFGIAFSIMGLLPSI-ASILGMAFAGGAISLVWGWLISGAFILSVGAGMAELAS 134
            FS   + G+ F +      I AS++    +GG + +V+G +I     + +G  ++EL+S
Sbjct: 58  SFSVWSILGVGFGLTNSWFGISASMVTGISSGGPMMVVYGIIIIALVSICIGTSLSELSS 117

Query: 135 AIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVVISKD 194
           A P +GG        APPK K+  ++L G+      +    S    +A E++ +  ++  
Sbjct: 118 AYPHAGGQFFWSLKLAPPKHKRFAAYLCGSFAYAGSVFTSASTTLSVATEVVGMYALTHP 177

Query: 195 GDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXXXGVSQ 254
            DF++     +  +                   K   F   S+              V  
Sbjct: 178 -DFKVQRWHIFVCFE-----LLHLLLMLFNCYGKSLPFISASSLYISLVSFFTITVTVLA 231

Query: 255 SDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAV 314
                FN  KF+F  F N   W +G    + G     W     D   HM+ E +   + +
Sbjct: 232 CSHGNFNDPKFVFATFYNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVI 291

Query: 315 PIGILTSISV------CWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKKW 368
           PI I+ +I++      C+++  F S+        ++  IL +  G P+  I    LG K 
Sbjct: 292 PIAIMGTIAIGFATSFCYVIAMFFSL-------RDLDKILTSTTGAPILDIYNQVLGNKS 344

Query: 369 AMTFM-TLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFX 427
              F+  L+ F  F    +  T  +R  W+FARD+GLP+S    +VN ++  PL A    
Sbjct: 345 GAIFLGCLVLFTSFGCVIACHTWQARLCWSFARDNGLPWSHLWAQVNPQMGVPLNAHLMS 404

Query: 428 XXXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNF-- 485
                         STA  +L +  IA    +++ P +  +   ++I   G F++G F  
Sbjct: 405 CAWISLIGILYLASSTAFNSLITGCIAFLLLSYIIPVICLLMKKRQI-RHGPFWLGKFGL 463

Query: 486 WSPVI--NWTSXXXXXXXXXXXXXPSSQHNITADTMNYTC-VFVGFVWFGSIAYYYFYKH 542
           +S +I   WT+                   +T D MNY   V VG+  + ++ Y+ F   
Sbjct: 464 FSNIILLAWTAFAIIFFSFPPVLP------VTKDNMNYVAVVIVGYTSY-ALLYWRFKGR 516

Query: 543 RTFHG 547
           + FH 
Sbjct: 517 KEFHA 521

>SAKL0A04730g Chr1 (432222..433847) [1626 bp, 541 aa] {ON} similar
           to uniprot|P19807 Saccharomyces cerevisiae YGL077C HNM1
           Choline transporter (permease) that also controls the
           uptake of nitrogen mustard expression is co- regulated
           with phospholipid biosynthetic genes and negatively
           regulated by choline and myo-inositol
          Length = 541

 Score =  120 bits (300), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 123/500 (24%), Positives = 210/500 (42%), Gaps = 16/500 (3%)

Query: 72  ELNRHFSTIQVFGIAFSIMGLLPSI-ASILGMAFAGGAISLVWGWLISGAFILSVGAGMA 130
           EL + FS   + G+ F +      I AS++    +GG + +V+G +I     + +G  + 
Sbjct: 46  ELRKSFSLWSILGVGFGLTNSWFGISASMVTGISSGGPMMIVYGIIIIALVSVCIGISLG 105

Query: 131 ELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVV 190
           EL+SA P +GG        APPK+++  +++ G+      +    S    +A E++ +  
Sbjct: 106 ELSSAYPHAGGQFWWSLKLAPPKYRRFAAYMCGSFAWAGSVFTSASTTLSVATELVGMYA 165

Query: 191 ISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXXX 250
           ++   DFE+   K + ++  C                 L   S  S              
Sbjct: 166 LTHP-DFEV---KRWHIFV-CFELLHLFLMIFNCSGKSLPLIS-SSALYISLFSFITITI 219

Query: 251 GVSQSDDVTFNGGKFIFGNFENFGDWAD-GWEFMVAGFQPCVWVIGAFDSCIHMSEEAKN 309
            V       +N  KF+F  F N   W + G  F+V    P  W     D   HM+ E + 
Sbjct: 220 TVLACSHGQYNDAKFVFATFYNETGWKNSGIAFIVGLINP-AWSFSCLDCATHMAFEVEK 278

Query: 310 ATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNAL-GKKW 368
             + +PI I+ ++++ +I  F   IA+   +  N+  I+ +  G P+  I Y AL  K  
Sbjct: 279 PERVIPISIMGTVAIGFITSFCYVIAMFFSL-HNLDEIMSSNTGAPILDIYYQALQSKAG 337

Query: 369 AMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXX 428
           A+    LI F  F    +  T  +R  W+FARD+GLP+S +  KVN +L  PL A     
Sbjct: 338 AIVLGCLILFTSFGCVIACHTWQARLCWSFARDNGLPYSRYWSKVNPELGVPLNAHLMSC 397

Query: 429 XXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFWSP 488
                        STA  +L +  IA    +++ P +  +   ++I   G F++G     
Sbjct: 398 AWIVLLGVLYLASSTAFNSLITGCIAFLLLSYVVPVICLLWRKRQI-QHGPFWLGKI-GL 455

Query: 489 VINWTSXXXXXXXXXXXXXPSSQHNITADTMNY-TCVFVGFVWFGSIAYYYFYKHRTFHG 547
             N+               P+    +T D MNY + V VG++ + S+ Y+ F    TF+ 
Sbjct: 456 FSNYVLLGWTVFALVFFCFPAVM-PVTKDNMNYASVVIVGYLLY-SLLYWRFRGRYTFYV 513

Query: 548 PKSNLTDDEFVDAVGQDVID 567
            + +    E V    + + D
Sbjct: 514 VEEDEYTGENVSVNSETIHD 533

>KNAG0D05140 Chr4 complement(937630..939261) [1632 bp, 543 aa] {ON}
           Anc_6.205 YGL077C
          Length = 543

 Score =  118 bits (296), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 120/504 (23%), Positives = 199/504 (39%), Gaps = 38/504 (7%)

Query: 70  KQELNRHFSTIQVFGIAFSIMGLLPSIA-SILGMAFAGGAISLVWGWLISGAFILSVGAG 128
           +  L + FS   + G+ F +      I+ S++    +GG + +V+G +I     + VG  
Sbjct: 51  EPHLRKSFSLWSILGVGFGLTNSWFGISVSMVTGIMSGGPMMIVYGIIIIALISVCVGGS 110

Query: 129 MAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILSI 188
           + EL+SA P +GG        AP + ++  +FL G+      +    S       E++ +
Sbjct: 111 LGELSSAYPHAGGQFWWALKLAPARHRRFAAFLCGSFAYAGSVFTSASTTLSAGTEVVGM 170

Query: 189 VVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXX 248
             +   G F +     +  +                   K       S+           
Sbjct: 171 YALKHPG-FVVKRWHVFVCFE-----LIHLFLMLFNCYGKSLPLISSSSLYISLISFLTI 224

Query: 249 XXGVSQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAK 308
              V      +FN  KF+F  F N   W +     + G     W     DS  HM+ E +
Sbjct: 225 TITVLACSSGSFNDSKFVFATFYNETGWKNSGMAFIMGLINPAWSFSCLDSATHMAFEVE 284

Query: 309 NATKAVPIGILTSISV------CWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYN 362
              + +P  I+ ++++      C+++  F SI        +ISA+L +  G P+ +I   
Sbjct: 285 RPERVIPTAIMGTVAIGFVTSFCYVIAMFFSI-------RDISAVLKSTTGAPILEIYRQ 337

Query: 363 ALGKKWAMTFM-TLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPL 421
           ALG +    F+  L+ F  F    S  T  +R  W+F+RD+GLP+S W  +VN  +  PL
Sbjct: 338 ALGNEGGAIFLGCLVLFTSFGCIISCHTWQARLCWSFSRDNGLPYSKWWSQVNPDVGVPL 397

Query: 422 RATWFXXXXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFY 481
            A                  STA  +L +  IA    ++  P +  +   ++I   G F+
Sbjct: 398 NAHLMSCAWISLIGVLYLASSTAFNSLITACIAFLLLSYSVPIVCLLWRRRDI-PQGPFW 456

Query: 482 MGNFW----SPVINWTSXXXXXXXXXXXXXPSSQHNITADTMNYTC-VFVGFVWFGSIAY 536
           +G F       ++ WT              P  ++N     MNY C V VGFV + S+ Y
Sbjct: 457 LGKFGLFANVVLLAWT-VFAVVFFSFPPVLPVDRNN-----MNYVCVVIVGFVTY-SLLY 509

Query: 537 YYFYKHRTFHG----PKSNLTDDE 556
           + F   R FH     P   L D E
Sbjct: 510 WRFKGSRDFHKVEDEPGEKLVDAE 533

>Smik_7.206 Chr7 complement(356650..358341) [1692 bp, 563 aa] {ON}
           YGL077C (REAL)
          Length = 563

 Score =  118 bits (295), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 131/565 (23%), Positives = 218/565 (38%), Gaps = 68/565 (12%)

Query: 4   SSSYVEKNQIKTSARELHPIVSANANGEVQQITSLRTITSKRAGEVNYINAKAAHDDTEL 63
           S++YV K  ++    E+ P+   N  G V              GEV+             
Sbjct: 19  SNNYVHKRDLRVE-EEMKPLDDMNGKGVVAG-----------DGEVH------------- 53

Query: 64  LAEIGYKQELNRHFSTIQVFGIAFSIMGLLPSIA-SILGMAFAGGAISLVWGWLISGAFI 122
                    L + FS   + G+ F +      I+ S++    +GG + +V+G +I     
Sbjct: 54  ---------LRKSFSLWSILGVGFGLTNSWFGISTSMVAGISSGGPMMIVYGIIIVALIS 104

Query: 123 LSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLA 182
           + +G  + EL+SA P +GG        APPK+K+  +F+ G+      +    S    +A
Sbjct: 105 ICIGTSLGELSSAYPHAGGQFWWSLKLAPPKYKRFAAFMCGSFAYAGSVFTSASTTLAVA 164

Query: 183 QEILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXX 242
            E++ +  +      E T  K + ++                   K       S+     
Sbjct: 165 TEVVGMYALMHS---EFT-PKRWHIFV--CFELLHLFLMFFNCYGKSLPIISSSSLYISL 218

Query: 243 XXXXXXXXGVSQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIH 302
                    V       FN  KF+F  F N   W +G    + G     W     D   H
Sbjct: 219 LSFFTITITVLACSHGKFNDSKFVFATFYNETGWKNGGIAFIVGLINPAWSFSCLDCATH 278

Query: 303 MSEEAKNATKAVPIGILTSISV------CWIVGFFISIAIVACMGSNISAILDTVYGQPL 356
           M+ E +   + +PI I+ +I++      C+++  F SI        ++  IL +  G P+
Sbjct: 279 MAFEVEKPERVIPIAIMGTIAIGFVTSFCYVIAMFFSI-------KDLDGILSSTTGAPI 331

Query: 357 AQILYNALGKKWAMTFM-TLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNT 415
             I   ALG K    F+  LI F  F    +  T  +R  W+F+RD+GLP S    +VN 
Sbjct: 332 LDIYNQALGNKSGAIFLGCLILFTSFGCVIACHTWQARLCWSFSRDNGLPLSRLWSQVNP 391

Query: 416 KLSSPLRATWFXXXXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIF 475
               PL A                  STA  +L +  IA    +++ P +  +   ++I 
Sbjct: 392 HTGVPLNAHLMSCAWISLIGLLYLASSTAFQSLITGCIAFLLLSYIIPVVCLLNKKRDI- 450

Query: 476 SPGAFYMGN--FWSPVI--NWTSXXXXXXXXXXXXXPSSQHNITADTMNYTC-VFVGFVW 530
           + G F++G   F+S ++   WT              P     +T D MNY C V VG+  
Sbjct: 451 AHGPFWLGKFGFFSNIVLLGWT-LFAVVFFSFPPVLP-----VTKDNMNYVCVVIVGYTA 504

Query: 531 FGSIAYYYFYKHRTFHGPKSNLTDD 555
           + SI Y+ +   + FH  + +  D 
Sbjct: 505 Y-SILYWKYKGKKEFHAVEESEIDQ 528

>YGL077C Chr7 complement(362225..363916) [1692 bp, 563 aa] {ON}
           HNM1Choline/ethanolamine transporter; involved in the
           uptake of nitrogen mustard and the uptake of glycine
           betaine during hypersaline stress; co-regulated with
           phospholipid biosynthetic genes and negatively regulated
           by choline and myo-inositol
          Length = 563

 Score =  116 bits (291), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 117/498 (23%), Positives = 199/498 (39%), Gaps = 54/498 (10%)

Query: 72  ELNRHFSTIQVFGIAFSIMGLLPSIA-SILGMAFAGGAISLVWGWLISGAFILSVGAGMA 130
            L + FS   + G+ F +      I+ S++    +GG + +V+G +I     + +G  + 
Sbjct: 53  HLRKSFSLWSILGVGFGLTNSWFGISTSMVAGISSGGPMMIVYGIIIVALISICIGTSLG 112

Query: 131 ELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVV 190
           EL+SA P +GG        APPK+K+  +++ G+      +    S    +A E++ +  
Sbjct: 113 ELSSAYPHAGGQFWWSLKLAPPKYKRFAAYMCGSFAYAGSVFTSASTTLSVATEVVGMYA 172

Query: 191 ISKDG----------DFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXX 240
           ++              FE+ +   + ++  C                 L  F+I      
Sbjct: 173 LTHPEFIPKRWHIFVCFELLH--LFLMFFNCYGKSLPIISSSSLYISLLSFFTITIT--- 227

Query: 241 XXXXXXXXXXGVSQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSC 300
                      V       FN  KF+F  F N   W +G    + G     W     D  
Sbjct: 228 -----------VLACSHGKFNDAKFVFATFNNETGWKNGGIAFIVGLINPAWSFSCLDCA 276

Query: 301 IHMSEEAKNATKAVPIGILTSISV------CWIVGFFISIAIVACMGSNISAILDTVYGQ 354
            HM+ E +   + +PI I+ ++++      C+++  F SI        ++ A+L +  G 
Sbjct: 277 THMAFEVEKPERVIPIAIMGTVAIGFVTSFCYVIAMFFSI-------QDLDAVLSSTTGA 329

Query: 355 PLAQILYNALGKKWAMTFM-TLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKV 413
           P+  I   ALG K    F+  LI F  F    +  T  +R  W+FARD+GLP S    +V
Sbjct: 330 PILDIYNQALGNKSGAIFLGCLILFTSFGCVIACHTWQARLCWSFARDNGLPLSRLWSQV 389

Query: 414 NTKLSSPLRATWFXXXXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKE 473
           N     PL A                  STA  +L +  IA    +++ P +  +   + 
Sbjct: 390 NPHTGVPLNAHLMSCAWITLIGLLYLASSTAFQSLITGCIAFLLLSYIIPVICLLAKKRN 449

Query: 474 IFSPGAFYMGN--FWSPVI--NWTSXXXXXXXXXXXXXPSSQHNITADTMNYTC-VFVGF 528
           I + G F++G   F+S ++   WT                    +T D MNY C V VG+
Sbjct: 450 I-AHGPFWLGKFGFFSNIVLLGWTVFSVVFFSFPPVLP------VTKDNMNYVCVVIVGY 502

Query: 529 VWFGSIAYYYFYKHRTFH 546
             + SI Y+ +   + FH
Sbjct: 503 TAY-SILYWKYKGKKEFH 519

>TDEL0G01410 Chr7 (285255..286916) [1662 bp, 553 aa] {ON} Anc_6.205
           YGL077C
          Length = 553

 Score =  114 bits (285), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 127/523 (24%), Positives = 216/523 (41%), Gaps = 41/523 (7%)

Query: 39  RTITSKRAGEVNYINAKAAHDDTELLAEIGYKQELNRHFSTIQVFGIAFSI----MGLLP 94
           RT  S+     ++  A     DT ++ E G +  L + FS   + G+ F +     G+  
Sbjct: 14  RTSLSEVHTRESHKGALEYGKDT-MMTERGGEVHLRKSFSLWSILGVGFGLTNSWFGI-- 70

Query: 95  SIASILGMAFAGGAISLVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKF 154
           S++ + G+ F+GG + +V+G +I     + VGA + EL+SA P +GG        APPK 
Sbjct: 71  SVSMVTGI-FSGGPMMIVYGIIIVALISICVGASLGELSSAYPHAGGQFWWSLKLAPPKH 129

Query: 155 KKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIX 214
           K+  ++L G+      +    S     A E++ +  ++   DF     K + V+  C   
Sbjct: 130 KRFAAYLCGSFAYAGSVFTSASTTLSAATEVVGMYALAHP-DF---TPKRWHVFV-CFEI 184

Query: 215 XXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXXXGVSQSDDVTFNGGKFIFGNFENFG 274
                         L   S  S               V       FN  KF+F  F N  
Sbjct: 185 MHLFLTLFNCYGKSLPLIS-ASALYISLLSFFTITVTVLACSSGKFNDAKFVFATFYNET 243

Query: 275 DWAD-GWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISV------CWI 327
            W + G  F+V    P  W     D   HM+ E +   + +PI I+ ++++      C++
Sbjct: 244 GWKNSGIAFIVGLINP-AWSFSCLDCATHMAFEVEKPERVIPIAIMGTVAIGFATSFCYV 302

Query: 328 VGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKKWAMTFM-TLIAFCQFIMGAS 386
           +  F SI        ++ +++ +  G P+  I   ALG      F+  ++ F  F    +
Sbjct: 303 ISMFFSI-------RDLDSLMQSATGAPILDIYNQALGNTSGAIFLGCMVLFTSFGCIIA 355

Query: 387 TLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXXXXXXXXXXXXXXXSTASA 446
             T  +R  W+FARD GLPFS  + +VN ++  PL A                  STA  
Sbjct: 356 CHTWQARLGWSFARDKGLPFSGLLSQVNPQVGVPLNAHLMSCALISLIGLLYLASSTAFN 415

Query: 447 ALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFY---MGNFWSPVINWTSXXXXXXXXX 503
           +L +  IA    ++  P +  +   ++I   G F+   +G F++ V+   +         
Sbjct: 416 SLCTGCIAFLLLSYSIPVICLLRKKRQI-KHGPFWFGKLGYFFNIVLLGWAVFCIVFFSF 474

Query: 504 XXXXPSSQHNITADTMNY-TCVFVGFVWFGSIAYYYFYKHRTF 545
               P     +T D MNY + V VGF  + ++ Y+ F   + F
Sbjct: 475 PPALP-----VTKDNMNYVSVVIVGFTAY-ALLYWKFKGCKEF 511

>KLLA0C15521g Chr3 complement(1347098..1348741) [1644 bp, 547 aa]
           {ON} similar to uniprot|P19807 Saccharomyces cerevisiae
           YGL077C HNM1 Choline transporter (permease) that also
           controls the uptake of nitrogen mustard expression is
           co- regulated with phospholipid biosynthetic genes and
           negatively regulated by choline and myo-inositol
          Length = 547

 Score =  114 bits (284), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 123/528 (23%), Positives = 219/528 (41%), Gaps = 31/528 (5%)

Query: 48  EVNYINAKAAHDDTELLAEIGYKQELNRHFSTIQVFGIAFSIMGLLPSIA-SILGMAFAG 106
           E   I++K A+D      E      L + FS   + G+ F +      I+ S++   ++G
Sbjct: 36  EEQSISSKDAYDAYGGTGE----GHLRKSFSLWSILGVGFGLTNSWFGISVSMVTGIYSG 91

Query: 107 GAISLVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSN 166
           G + +V+G +I     + +   + EL+SA P +GG        APPK++++ ++L G+  
Sbjct: 92  GPMMVVYGIIIIALISICIAVTLGELSSAFPHAGGQFWWSLQLAPPKYRRLAAYLCGSFA 151

Query: 167 SLALIACLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXX 226
               I    S    +A E++ +  ++   DFE+   K + V+  C               
Sbjct: 152 WAGAIFSSASTTLSVASELVGMYALTHP-DFEV---KRWHVFV-CFQILHLFLMMFNCSG 206

Query: 227 XKLQTFSIVSNXXXXXXXXXXXXXGVSQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAG 286
             L   S  S+              V       +N  KF+F  F N   W +G    + G
Sbjct: 207 KALPVIS-QSSLYISLISFFTITVTVLACSHGKYNDAKFVFATFYNETGWKNGVIAFIVG 265

Query: 287 FQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISA 346
                W     D   HM+ E +N  + +PI IL ++ + ++  F   IA+   +  ++ A
Sbjct: 266 LINPAWSFSCLDCATHMAFEVENPERVIPISILCTVGIGFLTSFSYVIAMFFSL-QDLEA 324

Query: 347 ILDTVYGQPLAQILYNAL-GKKWAMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLP 405
           +  +  G P+ +I   A      A+    LI F  F    +  T  +R  W+FARD+G+P
Sbjct: 325 VASSNTGMPILEIFRQATKSTPGAVVLGCLILFTSFGCVIACHTWQARLCWSFARDNGIP 384

Query: 406 FSWWIKKVNTKLSSPLRATWFXXXXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNL 465
           +S +  K++ +L  PL A                  +TA  +L +  IA   F++  P +
Sbjct: 385 YSKYWAKIDPELGVPLNAHLLSCALISLLGCLYMASTTAFNSLITGCIAFLLFSYSVPVV 444

Query: 466 LRMTTGKEIFSPGAFYMGNFWS----PVINWTSXXXXXXXXXXXXXPSSQHNITADTMNY 521
             +   + I   G F++G F +     ++ W               P+    +T D MNY
Sbjct: 445 CLLARKRNI-KHGPFWLGKFGAFSNIVLLGWN-----LFALVFFCFPAVM-PVTKDNMNY 497

Query: 522 -TCVFVGFVWFGSIAYYYFYKHRTFHGPKSNLTDDEFVDAVGQDVIDE 568
            + V VGF+ F  + ++ F   + F+     + +DE  D+  + V  E
Sbjct: 498 ASVVIVGFLLF-YLGFWQFKAKKVFY-----IREDENTDSNQESVTTE 539

>AFL081W Chr6 (286339..287967) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL077C (HNM1)
          Length = 542

 Score =  113 bits (282), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 112/479 (23%), Positives = 197/479 (41%), Gaps = 31/479 (6%)

Query: 65  AEIGYKQELNRHFSTIQVFGIAFSI----MGLLPSIASILGMAFAGGAISLVWGWLISGA 120
            ++   Q L + FS   V G+ F +     G+  S++ I G+  +GG + +V+G +I   
Sbjct: 34  CQVDEGQLLRKSFSLWSVLGVGFGLTNSWFGI--SVSMITGIG-SGGPMMIVYGIVIIAL 90

Query: 121 FILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYG 180
             + VG  +AEL+SA P +GG        APPK +++ ++L G+      +    S    
Sbjct: 91  VSVCVGVSLAELSSAYPHAGGQFWWSLKLAPPKHRRLAAYLCGSLAWAGSVFTSASTTLS 150

Query: 181 LAQEILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXX 240
            A E++ +  + +  +F +     +  Y   I+               L + S +     
Sbjct: 151 AATELVGMYALVRP-EFVVRKWHVFVCYQ--ILHCFLMLFNCYGRSLPLVSSSALYVSLF 207

Query: 241 XXXXXXXXXXGVSQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSC 300
                       S+     FN  KF+F  F N   W +     + G     W     D  
Sbjct: 208 SFVTITITVVACSRGH---FNDPKFVFATFRNETGWQNSAIAFIVGLINPAWSFSCLDCA 264

Query: 301 IHMSEEAKNATKAVPIGILTSISV------CWIVGFFISIAIVACMGSNISAILDTVYGQ 354
            HM+ E +   + +PI IL ++++      C+++  F S+        ++S I+ +  G 
Sbjct: 265 THMAFEVEQPERVIPIAILGTVAIGFLTSFCYVIAMFFSL-------RDLSEIMTSNTGV 317

Query: 355 PLAQILYNALGKK-WAMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKV 413
           P+  I Y ALG +  A+   +L+         S+ T  +R  W+FARD GLP+S    +V
Sbjct: 318 PILDIYYQALGSRAGALVLGSLVLLTSVGCIISSHTWQARLCWSFARDGGLPYSHLWARV 377

Query: 414 NTKLSSPLRATWFXXXXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKE 473
           N  +  PL A                  STA  +L +  IA    +++ P +  +   ++
Sbjct: 378 NRSVGVPLNAHLMSCVCISLLGILYMASSTAFNSLITGCIAFLLLSYIVPVICLLLKKRQ 437

Query: 474 IFSPGAFYMGNFWSPVINWTSXXXXXXXXXXXXXPSSQHNITADTMNY-TCVFVGFVWF 531
           I   G F++G F     N+               P  +  +T D MNY + V VG++ +
Sbjct: 438 I-KHGPFWLGPF-GAFCNYVLLAWTVFVLIFFSLPPLK-PVTKDNMNYVSVVVVGYILY 493

>KLTH0H04444g Chr8 (397467..399065) [1599 bp, 532 aa] {ON} similar
           to uniprot|P19807 Saccharomyces cerevisiae YGL077C HNM1
           Choline transporter (permease) that also controls the
           uptake of nitrogen mustard expression is co- regulated
           with phospholipid biosynthetic genes and negatively
           regulated by choline and myo- inositol
          Length = 532

 Score =  111 bits (278), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 116/488 (23%), Positives = 199/488 (40%), Gaps = 16/488 (3%)

Query: 72  ELNRHFSTIQVFGIAFSIMGLLPSIA-SILGMAFAGGAISLVWGWLISGAFILSVGAGMA 130
            L + FS   + G+ F +      I+ S++    +GG + +V+G +I     + +   + 
Sbjct: 46  HLRKQFSLWSILGVGFGLTNSWFGISTSMITGIMSGGPMMVVYGIIIIALISICIAVSLG 105

Query: 131 ELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVV 190
           EL+SA P +GG        APPK K+  +++ G+      +    S    +A EI+ +  
Sbjct: 106 ELSSAYPHAGGQFWWSLKLAPPKHKRFAAYMCGSLAWAGSVFTSASTTLSVAAEIVGMYA 165

Query: 191 ISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXXX 250
           ++   +FE+    T+  +                   K       S+             
Sbjct: 166 LTHP-EFEVKRWHTFVCFE-----VLHLFLMLFNCYGKALPLISSSSLYISLFSFITITI 219

Query: 251 GVSQSDDVTFNGGKFIFGNFENFGDWAD-GWEFMVAGFQPCVWVIGAFDSCIHMSEEAKN 309
            V       +N  KF+F  F N   W + G  F+V    P  W     D   HM+ E + 
Sbjct: 220 TVLACSHGKYNDAKFVFATFYNETGWKNSGIAFIVGLINP-AWSFSCLDCATHMAFEVEK 278

Query: 310 ATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKK-W 368
             + +PI IL ++++ ++  F   IA+   +  N+  ++++    P+  I Y ALG K  
Sbjct: 279 PERVIPISILGTVAIGFVTSFCYVIAMFFSL-QNLDKVVNSNTQVPILDIYYQALGSKAG 337

Query: 369 AMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXX 428
           A+    L+ F  F    +  T  +R  W+FARD+GLPFS +  +V+ +L  PL A     
Sbjct: 338 AIVLGCLLLFTSFGCVIACHTWQARLCWSFARDEGLPFSRYWARVSPELGVPLNAHLMSS 397

Query: 429 XXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFWSP 488
                        STA  +L +  I     ++  P +  +   + I   G F++G F   
Sbjct: 398 FWIVLLGCLYLASSTAFNSLITGCIMFLLLSYTIPVVCLLLKKRNI-KHGPFWLGKF-GC 455

Query: 489 VINWTSXXXXXXXXXXXXXPSSQHNITADTMNY-TCVFVGFVWFGSIAYYYFYKHRTFHG 547
             N                P SQ  +  D MNY + V VG++ F S+ ++ F    TFH 
Sbjct: 456 FSNVVLLGWMLFSIVFFCFP-SQMPVVKDNMNYASVVIVGYLLF-SLLFWQFRGRHTFHA 513

Query: 548 PKSNLTDD 555
            +    +D
Sbjct: 514 LEEEAGED 521

>ZYRO0G08602g Chr7 complement(697178..698887) [1710 bp, 569 aa] {ON}
           similar to uniprot|P19807 Saccharomyces cerevisiae
           YGL077C HNM1 Choline transporter (permease) that also
           controls the uptake of nitrogen mustard expression is
           co- regulated with phospholipid biosynthetic genes and
           negatively regulated by choline and myo-inositol
          Length = 569

 Score =  111 bits (278), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 124/555 (22%), Positives = 217/555 (39%), Gaps = 29/555 (5%)

Query: 27  NANGEVQQITSLRTITSKRAGEVNYINAKAAHDDTELLAE---IGYKQE--LNRHFSTIQ 81
           + +GE QQ +S   I  +   E          +D +   +    G  +E  L + FS   
Sbjct: 2   STSGEFQQRSSQSEIHKREFYEAPNEELSMDKNDMDKYDDESGSGGSEEVVLRKSFSLWS 61

Query: 82  VFGIAFSIMGLLPSI-ASILGMAFAGGAISLVWGWLISGAFILSVGAGMAELASAIPTSG 140
           + G+ F +      I AS++    +GG + +++G ++     +++G  + EL SA P +G
Sbjct: 62  ILGVGFGLTNSWFGISASLVTGLSSGGPLLVIYGIILISLISITIGVSLGELTSAYPHAG 121

Query: 141 GLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVVISKDGDFEIT 200
           G        APPK K+  +++ G+      I    S    +A E++++  ++ + DF   
Sbjct: 122 GQFWWSLKLAPPKHKRFAAYMCGSFAYAGAIFTSASTTLSVASELVAMYQLTHE-DFTPK 180

Query: 201 NAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXXXGVSQSDDVTF 260
             + +  Y   I+               L   S +                 S      F
Sbjct: 181 RWQVFVTYL--ILHFFLMQFNCYGKSLPLIASSSLYISLLSFIVITITVLACSSGH---F 235

Query: 261 NGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILT 320
           N  KF+F +F N   W+ G    + G     W     D   HM+ E +     +P  IL 
Sbjct: 236 NSAKFVFSHFYNETGWSSGGIAFIVGLINPAWSFSCLDCATHMAFEVEKPETIIPTAILG 295

Query: 321 SISV------CWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKK-WAMTFM 373
           +I++      C+++  F SI        ++ ++L+   G P+  I   AL  K  A+   
Sbjct: 296 TIAIGFITSFCYVISLFFSI-------RDLPSVLNNTGGFPVLVIYEQALNSKAGAIVLG 348

Query: 374 TLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXXXXXXX 433
            LI F  F    ++ T  SR  W+F+RD GLPF+    KVN+++  PL A          
Sbjct: 349 CLILFTSFGCVIASHTWQSRLCWSFSRDGGLPFAGLWSKVNSRMGVPLNAHLMSCVWVAI 408

Query: 434 XXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFWSPVINWT 493
                   STA  +L +  IA    ++  P +  +   ++I + G F+ G F     N  
Sbjct: 409 IGFLYLASSTAFNSLITACIAFLLLSYSIPVICLLMKKRQI-AHGPFWFGKF-GLFCNIA 466

Query: 494 SXXXXXXXXXXXXXPSSQHNITADTMNYTCVFVGFVWFGSIAYYYFYKHRTFHGPKSNLT 553
                         P   + +  D MNY  V +   +  S+ Y+ F+  + FH    +  
Sbjct: 467 LLLWTVFCLVFFSFP-PDYPVNKDNMNYVSVVIVGYFLYSLIYWKFWASKDFHTHDDDDD 525

Query: 554 DDEFVDAVGQDVIDE 568
           +      +  +  DE
Sbjct: 526 EQTVAQEISNEGFDE 540

>TPHA0E02920 Chr5 (612901..614661) [1761 bp, 586 aa] {ON} Anc_6.205
           YGL077C
          Length = 586

 Score =  110 bits (275), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 117/511 (22%), Positives = 203/511 (39%), Gaps = 35/511 (6%)

Query: 43  SKRAGEVNYINAKAAHDDTELLAEIGYKQ-ELNRHFSTIQVFGIAFSIMGLLPSIASILG 101
           S+    +      A  DD +L   +G  +  L + FS   + G+ F +      I++ L 
Sbjct: 29  SRNTSNIELSTNGAKLDDQQLNHHVGDGEVHLRKSFSAWSILGVGFGLTNSWFGISTSLV 88

Query: 102 MAFA-GGAISLVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSF 160
              + GG + +V+G +I     + VG  + EL+SA P +GG        APPK +K  ++
Sbjct: 89  TGISSGGPLMVVYGIIIIALISVCVGVSLGELSSAYPHAGGQFWWSLKLAPPKHRKFAAY 148

Query: 161 LIGNSNSLALIACLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXX 220
           L G+      +    S    +A E++ +  + K  +F+      +  +            
Sbjct: 149 LCGSFAYAGSVFTSASTTLSVATEVVGMYAL-KHPEFKPQRWHVFICFE-----LLHLFL 202

Query: 221 XXXXXXXKLQTFSIVSNXXXXXXXXXXXXXGVSQSDDVTFNGGKFIFGNFENFGDWADGW 280
                  K       S+              V       FN  KF+F +F N   W +  
Sbjct: 203 MLFNCYGKSLPLISSSSLYISLTSFFTITVTVLACSSGKFNDSKFVFASFYNETGWKNNG 262

Query: 281 EFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISV------CWIVGFFISI 334
              + G     W     D   HM+ E +   K +P+ I+ +I++      C+++  F SI
Sbjct: 263 IAFITGLINPAWSFSCLDCATHMAFEVEKPEKIIPLAIMGTIAIGFVTSFCYVIAMFFSI 322

Query: 335 AIVACMGSNISAILDTVYGQPLAQILYNALGKKWAMTFM-TLIAFCQFIMGASTLTAISR 393
                   ++  +L++  G P+  I   ALG      F+  LI F  F    +  T  +R
Sbjct: 323 -------RDLDKLLNSTTGAPILDIFNQALGNSSGAIFLGCLILFTSFGCVIACHTWQAR 375

Query: 394 QIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXXXXXXXXXXXXXXXSTASAALFSMYI 453
             W+F+R+ GLP+S    +VN  +  PL A                  STA  +L +  I
Sbjct: 376 LCWSFSRNKGLPYSHLWSQVNPNVGVPLNAHLMSCALISIIGVLYIASSTAFNSLITACI 435

Query: 454 AANYFAWMTPNLLRMTTGKEIFSPGAFYMGNF--WSPVI--NWTSXXXXXXXXXXXXXPS 509
           A    +++ P +  +   ++I   G F++G F  +S ++   WT                
Sbjct: 436 AFLLLSYIIPVICLLLKRRQI-KHGPFWLGKFGLFSNIVLLCWTIFAIVFFSF------P 488

Query: 510 SQHNITADTMNY-TCVFVGFVWFGSIAYYYF 539
            Q  +T D MNY + V VG+  + +I Y++F
Sbjct: 489 PQLPVTKDNMNYVSVVIVGYSIY-AILYWHF 518

>TBLA0A01960 Chr1 complement(473787..475571) [1785 bp, 594 aa] {ON}
           Anc_6.205 YGL077C
          Length = 594

 Score =  110 bits (274), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 125/554 (22%), Positives = 227/554 (40%), Gaps = 31/554 (5%)

Query: 11  NQIKTSARELHPIVSANANGEVQQITSLRTITSKRAGEVNYINAKAAHDDTELLAEIGYK 70
           +Q      E++ IV AN   +      L +++S +  +++  +     + TE       +
Sbjct: 5   DQKLQKNSEVYTIVEAN--DDTASFNQLGSVSSSKISDLDKNSINNEFNQTE-------E 55

Query: 71  QELNRHFSTIQVFGIAFSIMGLLPSI-ASILGMAFAGGAISLVWGWLISGAFILSVGAGM 129
             L + FS   + G+ F +      I AS++    +GG + +V+G +I     + VG  +
Sbjct: 56  VHLRKSFSLWSILGVGFGLTNSWFGISASMVTGIESGGPMMIVYGIIIISLISICVGVSL 115

Query: 130 AELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIV 189
            EL+SA P +GG        APPK ++  +++ G+      +    S    +A E++ + 
Sbjct: 116 GELSSAYPHAGGQFFWSLKLAPPKHRRFAAYMCGSYAYAGSVFTSASTTLSVATELVGMY 175

Query: 190 VISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXX 249
            +      E    + + V+  C                 L  F   S+            
Sbjct: 176 ALCH----ESFVPRRWHVFV-CFELLHLFLLLFNCYGKSLP-FISSSSLYISLLSFFTIT 229

Query: 250 XGVSQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKN 309
             V       +N  KF+F  F N   W +G    + G     W     D   HM+ E + 
Sbjct: 230 ITVLACAHGKYNDAKFVFATFYNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAFEVEK 289

Query: 310 ATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNAL-GKKW 368
             + +P+ I+ +I++ +I  F   IA+   + ++++A+ ++  G P+  I   AL  K  
Sbjct: 290 PERVIPMAIMGTIAIGFITSFCYVIAMFFSL-NDLNALFNSHTGAPILDIYNQALHNKAG 348

Query: 369 AMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXX 428
           A+    L+ F  F    +  T  +R  W+FA D GLP+S W  +VN  L  PL A     
Sbjct: 349 AIVLGCLVLFTSFGCVIACHTWQARLCWSFATDQGLPYSKWWAEVNPTLGVPLNAHLMSC 408

Query: 429 XXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNF--W 486
                        STA  +L +  IA    +++ P +  +   ++I   G F++G F  +
Sbjct: 409 GWIAIIGLLYLASSTAFNSLITGCIAFLLLSYIIPVICLLQKKRQI-KHGPFWLGKFGLF 467

Query: 487 SPVI--NWTSXXXXXXXXXXXXXPSSQHNITADTMNYTC-VFVGFVWFGSIAYYYFYKHR 543
           S ++   WT              P +++N     MNY C V VGF  +  + Y+ +   +
Sbjct: 468 SNIVLLCWT-LFSIVFFSFPPNLPVNRNN-----MNYVCVVIVGFTCY-QLIYWKWKGAK 520

Query: 544 TFHGPKSNLTDDEF 557
            FH  + +  + E+
Sbjct: 521 EFHSAQDDDDNIEY 534

>Ecym_2212 Chr2 (417948..419585) [1638 bp, 545 aa] {ON} similar to
           Ashbya gossypii AFL081W
          Length = 545

 Score =  109 bits (273), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 120/513 (23%), Positives = 198/513 (38%), Gaps = 26/513 (5%)

Query: 54  AKAAHDDTELLAEIGYKQ--ELNRHFSTIQVFGIAFSI----MGLLPSIASILGMAFAGG 107
           +K   D+ E+ +  G  +  EL + FS   V G+ F +     GL  S++ + G++ +GG
Sbjct: 26  SKVECDNVEVYSIPGVNKPAELRKSFSLWSVLGVGFGLTNSWFGL--SVSMVTGIS-SGG 82

Query: 108 AISLVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNS 167
            + +++G +I     + VG  + EL+SA P +GG        AP K+K++ ++L G+   
Sbjct: 83  PMMIIYGIVIIALISVCVGVSLGELSSAYPHAGGQFWWSLQLAPNKYKRLAAYLCGSFAW 142

Query: 168 LALIACLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXX 227
              +    S      + +L +  +      EI +   +  Y    +              
Sbjct: 143 AGSVFASASSTLSTTRLLLGMYALVHP-SLEIKDWHVFVCYQALHMFLLLFNCHGRPLPL 201

Query: 228 KLQTFSIVSNXXXXXXXXXXXXXGVSQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGF 287
              T   VS                   +D  F     +F NF N   W       + G 
Sbjct: 202 ISSTALYVSLFSFITITITVLASSHGNFNDAKF-----VFANFRNETGWESNTIAFIVGL 256

Query: 288 QPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMG---SNI 344
               W     D   HM+ E +     +P  IL +++    +GF  SI     M     ++
Sbjct: 257 INPAWSFSCLDCATHMAFEVEKPETVIPTAILGTVA----IGFLTSIVYCIAMFFSIRDL 312

Query: 345 SAILDTVYGQPLAQILYNALGKK-WAMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDG 403
             IL +  G P+  I Y A G K  A+   +L+    F    S  T  +R  W+FARD+G
Sbjct: 313 DGILSSTTGAPILDIYYQASGSKACAIVLGSLVLLTSFTCVTSCHTWQARLCWSFARDNG 372

Query: 404 LPFSWWIKKVNTKLSSPLRATWFXXXXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTP 463
            P+S    KVNT+L  PL A                  STA  AL +  I+    ++  P
Sbjct: 373 FPYSRIWAKVNTELGVPLNAHLLSCAVISLLGVLYLASSTAFNALVTGCISFLLLSYTVP 432

Query: 464 NLLRMTTGKEIFSPGAFYMGNFWSPVINWTSXXXXXXXXXXXXXPSSQHNITADTMNYTC 523
            +  +   + I   G F++G F     N+               P  +  IT   MNY  
Sbjct: 433 VICLLLKQRNI-KRGPFWLGKF-GTFSNYVLLAWTLFSLVFFSLPPMK-PITKGNMNYVS 489

Query: 524 VFVGFVWFGSIAYYYFYKHRTFHGPKSNLTDDE 556
           + +      SI Y+ F  H+ F+  +  +  +E
Sbjct: 490 IVILSYLLYSILYWKFSGHKKFYIYQEKIPVEE 522

>Kpol_1033.41 s1033 complement(106505..108265) [1761 bp, 586 aa]
           {ON} complement(106505..108265) [1761 nt, 587 aa]
          Length = 586

 Score =  109 bits (273), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 124/545 (22%), Positives = 217/545 (39%), Gaps = 37/545 (6%)

Query: 18  RELHPIVSANANG-EVQQITSLRTITSKRAGEVNYINAKAAHDDTELLAEIGYKQE--LN 74
           ++   I+S N +G  + Q + L +   +        N  +  D  E+    G   E  L 
Sbjct: 3   KDQSEIISLNIHGSNIDQHSKLNSFNERVQELTVNENDHSISDKKEIQQGGGNGDEVHLR 62

Query: 75  RHFSTIQVFGIAFSIMGLLPSI-ASILGMAFAGGAISLVWGWLISGAFILSVGAGMAELA 133
           + FS   + G+ F +      I AS++    +GG + +V+G +I     + VG  + EL+
Sbjct: 63  KSFSLWSILGVGFGLTNSWFGISASLVTGISSGGPMMVVYGIIIIALISVCVGVSLGELS 122

Query: 134 SAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVVISK 193
           SA P +GG        AP K K+  ++L G+      +    S    +A E++ +  ++ 
Sbjct: 123 SAYPHAGGQFWWSLKLAPQKHKRFAAYLCGSFAYAGSVFTSASTTLSVATELVGMYSLTH 182

Query: 194 DGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXXXGVS 253
               E    + +      ++               L + + +               G S
Sbjct: 183 P---EFIPQRWHVFVCFELLHLFLMLFNCYGKSLPLISTTSLYISLASFLTITVTVLGCS 239

Query: 254 QSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKA 313
             +   FN  KF+F  F N   W +     + G     W     D   HM+ E +   + 
Sbjct: 240 HGN---FNDPKFVFATFYNQTGWKNSVIAFITGLINPAWSFSCLDCATHMAFEVEKPERV 296

Query: 314 VPIGILTSISV------CWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKK 367
           +PI I+ +I++      C+++  F SI        ++ A+  +  G P+  I   ALG K
Sbjct: 297 IPIAIMGTIAIGFVTSFCYVIAMFFSI-------RDLDALFASHTGAPILDIYNQALGNK 349

Query: 368 -WAMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWF 426
             A+    LI F  F    +  T  +R  W+F+RD GLP+S    +VN +L  PL A   
Sbjct: 350 GGAIVLGCLILFTSFGCVIACHTWQARLCWSFSRDKGLPYSHLWAQVNPQLGVPLNAHLM 409

Query: 427 XXXXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNF- 485
                          +TA  +L +  IA    +++ P +  +   ++I   G F++G F 
Sbjct: 410 SCAWISLIGILYIASTTAFNSLITGCIAFLLLSYIIPVICLLKKKRQI-KHGPFWLGKFG 468

Query: 486 -WSPVI--NWTSXXXXXXXXXXXXXPSSQHNITADTMNY-TCVFVGFVWFGSIAYYYFYK 541
            +S ++   WT                 Q  +T D MNY + V VG+  +  + Y+ F  
Sbjct: 469 LFSNIVLLGWTLFAIVFFSF------PPQLPVTKDNMNYVSVVIVGYTLY-VLIYWKFKG 521

Query: 542 HRTFH 546
            + FH
Sbjct: 522 SKEFH 526

>NDAI0I01140 Chr9 (276535..278337) [1803 bp, 600 aa] {ON} Anc_6.205
          Length = 600

 Score =  106 bits (264), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 118/483 (24%), Positives = 204/483 (42%), Gaps = 24/483 (4%)

Query: 72  ELNRHFSTIQVFGIAFSIMGLLPSIAS--ILGMAFAGGAISLVWGWLISGAFILSVGAGM 129
            L + FS   V G+ F +      I++  + G++ +GG + +++G +I     + +G  +
Sbjct: 67  HLRKSFSLWSVLGVGFGLTNSWFGISTSMVTGIS-SGGPMMVIYGIIIIALISICIGTSL 125

Query: 130 AELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIV 189
            EL+SA P +GG        APPK+K++ +++ G+      +    S     A E++ + 
Sbjct: 126 GELSSAYPHAGGQFWWSLKLAPPKYKRLAAYMCGSFAYAGSVFTSASTTLSAATEVVGMY 185

Query: 190 VISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXX 249
            ++ + DF     K + V+  C                 L   S  S+            
Sbjct: 186 ALTHE-DFV---PKRWHVFV-CFEILHLFLMIFNCYGKSLPIIS-ASSLYISLSSFLIIT 239

Query: 250 XGVSQSDDVTFNGGKFIFGNFENFGDWAD-GWEFMVAGFQPCVWVIGAFDSCIHMSEEAK 308
             V       FN  KF+F  F N   W + G  F+V    P  W     D   HM+ E +
Sbjct: 240 ITVLACSRGQFNDAKFVFATFYNETGWKNSGIAFIVGLINP-AWSFSCLDCATHMAFEVE 298

Query: 309 NATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKK- 367
              + +PI IL++I++ +I  F   I++   +  ++ +IL +  G P+  I   ALG K 
Sbjct: 299 KPERVIPIAILSTIAIGFITSFCYVISMFFSL-RDLDSILKSTTGAPILDIYNQALGNKA 357

Query: 368 WAMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFX 427
            A+    +I F  F    +  T  +R  W+FARD+GLP+S    +VN ++  PL A    
Sbjct: 358 GAIILGCMILFTSFGCVIACHTWQARLGWSFARDNGLPYSKLWAQVNPQVGVPLNAHLMS 417

Query: 428 XXXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNF-- 485
                         STA  +L +  IA    +++ P    +   ++I   G F++G F  
Sbjct: 418 CAWISLIGILYLASSTAFNSLITGCIAFLLLSYIIPVSCLLLKKRQI-RHGPFWLGKFGL 476

Query: 486 WSPVI--NWTSXXXXXXXXXXXXXPSSQHNITADTMNYTCVFVGFVWFGSIAYYYFYKHR 543
           +S ++   WT                +   +T D MNY  V +      S+ Y+ F  ++
Sbjct: 477 FSNIVLLLWTVFAIVFFSF------PAMMPVTKDNMNYVAVVIAGYTLYSVLYWNFKGYK 530

Query: 544 TFH 546
            FH
Sbjct: 531 EFH 533

>Suva_7.193 Chr7 complement(355063..356754) [1692 bp, 563 aa] {ON}
           YGL077C (REAL)
          Length = 563

 Score =  103 bits (257), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 84/313 (26%), Positives = 135/313 (43%), Gaps = 28/313 (8%)

Query: 260 FNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGIL 319
           FN  KF+F  F N   W +G    + G     W     D   HM+ E +   + +PI I+
Sbjct: 236 FNDAKFVFATFYNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPIAIM 295

Query: 320 TSI------SVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKKWAMTFM 373
            ++      S+C+++  F SI        ++ A+L +  G P+  I   ALG K    F+
Sbjct: 296 GTVAIGFVTSLCYVIAMFFSI-------KDLDAVLSSTTGAPILDIYNQALGNKSGAIFL 348

Query: 374 -TLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXXXXXX 432
             L+ F  F    +  T  +R  W+FARD+GLP S +  +VN     PL A         
Sbjct: 349 GCLVLFTSFGCVIACHTWQARLCWSFARDNGLPLSRFWSQVNPHTGVPLNAHLMSCAWIS 408

Query: 433 XXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNF--WSPVI 490
                    STA  +L +  IA    +++ P +  +   ++I + G F++G F  +S ++
Sbjct: 409 LIGLLYLASSTAFQSLITGCIAFLLLSYIIPVICLLAKKRDI-AHGPFWLGKFGLFSNIV 467

Query: 491 --NWTSXXXXXXXXXXXXXPSSQHNITADTMNYTC-VFVGFVWFGSIAYYYFYKHRTFHG 547
              WT                    +T D MNY C V VG+  + SI Y+ +   + FH 
Sbjct: 468 LLGWTVFSIVFFSFPPVLP------VTKDNMNYVCVVIVGYTAY-SILYWRYKGKKEFHA 520

Query: 548 -PKSNLTDDEFVD 559
             +S    D+F +
Sbjct: 521 VEESEHEQDDFAN 533

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 49/94 (52%), Gaps = 1/94 (1%)

Query: 72  ELNRHFSTIQVFGIAFSIMGLLPSI-ASILGMAFAGGAISLVWGWLISGAFILSVGAGMA 130
            L + FS   + G+ F +      I AS++    +GG + +V+G +I     + +G  + 
Sbjct: 53  HLRKSFSLWSILGVGFGLTNSWFGISASMVAGISSGGPMMIVYGIIIVALISVCIGTSLG 112

Query: 131 ELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGN 164
           EL+SA P +GG        APPK+K+  +++ G+
Sbjct: 113 ELSSAYPHAGGQFWWSLKLAPPKYKRFAAYMCGS 146

>CAGL0H03399g Chr8 complement(316110..317780) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P19807 Saccharomyces
           cerevisiae YGL077c HNM1 choline permease
          Length = 556

 Score =  102 bits (254), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 120/508 (23%), Positives = 201/508 (39%), Gaps = 34/508 (6%)

Query: 53  NAKAAHDDTELLAEIGYKQELNRHFSTIQVFGIAFSIMGLLPSI-ASILGMAFAGGAISL 111
            AK      E    I  +  L + FS   + G+ F +      I AS++    +GG + +
Sbjct: 24  EAKNGKKIIEQEQSIDGEVHLRKSFSLWSILGVGFGLTNSWFGISASMVTGINSGGPMMI 83

Query: 112 VWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALI 171
           V+G +I     + +G  + EL+SA P +GG        AP K K+  ++L G+      +
Sbjct: 84  VYGIIIIALISVCIGVSLGELSSAYPHAGGQFWWSLKLAPTKHKRFAAYLCGSFAYAGSL 143

Query: 172 ACLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQT 231
               S     A E++ + V++     E T  K + ++  C                 L  
Sbjct: 144 FTSASTTLSAATELVGMYVLTHP---EFT-PKRWHIFV-CFELLHLFLMLFNCYGKSLPL 198

Query: 232 FSIVSNXXXXXXXXXXXXXGVSQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCV 291
            S  S+              V       FN  KF+F  F N   W +     + G     
Sbjct: 199 IS-ASSLYISLTSFFVITVTVLACSSGKFNDAKFVFATFYNETGWKNSVIAFIVGLINPA 257

Query: 292 WVIGAFDSCIHMSEEAKNATKAVPIGILTSISV------CWIVGFFISIAIVACMGSNIS 345
           W     D   HM+ E +   + +PI I+ +I++      C+++  F SI        ++ 
Sbjct: 258 WSFSCLDCATHMAFEVEKPERVIPIAIMGTIAIGFLTSFCYVIAMFFSI-------RDLD 310

Query: 346 AILDTVYGQPLAQILYNALGKK-WAMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGL 404
           A+L +  G P+  I   A   K  A+    L+    F    +  T  +R  W+FARD+GL
Sbjct: 311 ALLASNTGAPILNIYEQATNSKAGAIVLGCLVLITSFGCIIACHTWQARLGWSFARDNGL 370

Query: 405 PFSWWIKKVNTKLSSPLRATWFXXXXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPN 464
           P+S +  +VN     PL A                  +TA  +L +  IA    +++ P 
Sbjct: 371 PYSKYWSQVNPNAGVPLNAHLMSSALIALIGVLYLASTTAFNSLITGCIAFLLLSYIIPV 430

Query: 465 LLRMTTGKEIFSPGAFYMGNF--WSPVI--NWTSXXXXXXXXXXXXXPSSQHNITADTMN 520
           +  +   ++I   G F++G F  +S ++   WT              P S+     D MN
Sbjct: 431 ICLLMRKRQI-RQGPFWLGKFGLFSNIVLLGWT-LFAIVFFSFPPVLPVSK-----DNMN 483

Query: 521 Y-TCVFVGFVWFGSIAYYYFYKHRTFHG 547
           Y + V VG+  + +IAY+ F   + FH 
Sbjct: 484 YVSVVIVGYTVY-AIAYWEFKGKKEFHA 510

>KAFR0K00360 Chr11 (79233..80849) [1617 bp, 538 aa] {ON} Anc_6.205
           YGL077C
          Length = 538

 Score = 90.9 bits (224), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 80/316 (25%), Positives = 131/316 (41%), Gaps = 25/316 (7%)

Query: 260 FNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGIL 319
           FN  KF+F  F N   W       + G     W     D   HM+ E +   + +P+ I+
Sbjct: 227 FNDSKFVFATFYNETGWKSSAIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPMAIM 286

Query: 320 TSISVCWIVGFFISIAIVACMG---SNISAILDTVYGQPLAQILYNALGKK-WAMTFMTL 375
            +I+    +GF  S A V  M     NI  +L++  G P+ +I   ALG K  A+    L
Sbjct: 287 GTIA----IGFLTSFAYVISMFFSIRNIQDVLNSNSGAPILEIYNQALGNKAGAVILGCL 342

Query: 376 IAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXXXXXXXXX 435
           + F  F    +  T  +R  W+FARD GLP+S +  +VN     PL A            
Sbjct: 343 VLFTSFGCVIACHTWQARLCWSFARDKGLPYSRFWSQVNPTFGVPLHAHLMSCTLISIIG 402

Query: 436 XXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNF--WSPVI--N 491
                 STA  +L +  IA    ++  P +  +   +++ + G F++G F  +S ++   
Sbjct: 403 LLYLASSTAFNSLITACIAFLLLSYSIPVICLLLRKRDM-NRGPFWLGKFGLFSNIVLLA 461

Query: 492 WTSXXXXXXXXXXXXXPSSQHNITADTMNYTCVFVGFVWFGSIAYYYFYKHRTFHGPKSN 551
           WT                SQ  +  + MNY  V +    F S++Y++      F+     
Sbjct: 462 WTVFSLVFFSF------PSQIPVNRNNMNYVSVVIAGYTFFSVSYWFVKGKNEFY----- 510

Query: 552 LTDDEFVDAVGQDVID 567
             DD  + +  ++  D
Sbjct: 511 -LDDNIISSSSEEEAD 525

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 56/111 (50%), Gaps = 5/111 (4%)

Query: 59  DDTELLAEIGYKQE----LNRHFSTIQVFGIAFSIMGLLPSI-ASILGMAFAGGAISLVW 113
            D E+L++   +Q+    L + FS   + G+ F +      I AS++    +GG + +V+
Sbjct: 27  KDPEILSDKLIEQDEDIHLRKSFSLWSILGVGFGLTNSWFGISASMITGITSGGPMMIVY 86

Query: 114 GWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGN 164
           G +I     + +G  + EL+SA P +GG        A PK K+  +++ G+
Sbjct: 87  GIIIIALISICIGVSLGELSSAYPHAGGQFHWTLQLASPKHKRFAAYMCGS 137

>Kwal_56.24009 s56 complement(812371..813399) [1029 bp, 342 aa] {ON}
           YGL077C (HNM1) - Transporter (permease) for choline and
           nitrogen mustard; share homology with UGA4 [contig 168]
           PARTIAL
          Length = 342

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 79/294 (26%), Positives = 130/294 (44%), Gaps = 17/294 (5%)

Query: 260 FNGGKFIFGNFENFGDWAD-GWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGI 318
           +N  KF+F  F N   W + G  F+V    P  W     D   HM+ E +   + +PI I
Sbjct: 40  YNDPKFVFATFFNETGWRNSGIAFIVGLINP-AWSFSCLDCATHMAFEVERPERVIPISI 98

Query: 319 LTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKK-WAMTFMTLIA 377
           L ++++ ++  F   IA+   +  N+  I+ +  G P+  I   ALG K  A+    L+ 
Sbjct: 99  LGTVAIGFVTSFCYVIAMFFSL-HNLDEIVGSNTGAPILDIYLQALGNKAGAVVLGCLVL 157

Query: 378 FCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXXXXXXXXXXX 437
           F  F    +  T  +R  W+FARD+GLP+S    KV+ +L  PL A              
Sbjct: 158 FTSFGCVIACHTWQARLCWSFARDEGLPYSRIWAKVSPELGVPLNAHLMSCFWIVLLGLL 217

Query: 438 XXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFWS----PVINWT 493
               +TA  +L +  I    F+++ P +  +   + I   G F++G F       ++ W 
Sbjct: 218 YLASTTAFNSLITGCIMFLLFSYIVPVICLLIKKRNI-KHGPFWLGKFGLFANIVLLGW- 275

Query: 494 SXXXXXXXXXXXXXPSSQHNITADTMNY-TCVFVGFVWFGSIAYYYFYKHRTFH 546
           S             P     +  D MNY + V VG++ F S+ +++F    +FH
Sbjct: 276 SLFALVFFCFPFVMP-----VDKDNMNYASVVIVGYILF-SLLFWHFKGRHSFH 323

>TBLA0C05740 Chr3 complement(1391698..1393677) [1980 bp, 659 aa]
           {ON} Anc_1.173 YKL174C
          Length = 659

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 119/545 (21%), Positives = 211/545 (38%), Gaps = 46/545 (8%)

Query: 37  SLRTITSKRAGEVNYINAKAAHDDTEL-----LAEIGYKQELNRHF-STIQVFGIAFSIM 90
           SLR I   +  E+        HDD E      +    Y Q+L++   S   V G+ F +M
Sbjct: 13  SLRDINIPKPDEIFDNLYTIFHDDAETEGPQEVEHFNYHQDLDKSLLSRGSVMGLGFGLM 72

Query: 91  GLLPSIASILGMAFA---GGAISLVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXX 147
              P +     MA     GG  +++WG+LISG  +      + E+ S  P    L     
Sbjct: 73  S--PVLGMCTSMAIGLMNGGPATIMWGFLISGIMVWFCSLSLGEIVSKFPME--LHVSSA 128

Query: 148 XXAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGV 207
             AP K K + S+  G    +       SI +  AQ  +S+++++ +     TN   + V
Sbjct: 129 MLAPKKLKLICSWYTGWLTLIGNWTMSTSITFAGAQLTISLILMANNDLISETNLIFFTV 188

Query: 208 YAGCIIXXXXXXXXXXXXXXKLQTF-SIVSNXXXXXXXXXXXXXGVSQSDDVTFNGG--- 263
                I              KL  F  I++               +     + F+ G   
Sbjct: 189 -----IVFYLVVTIVGIVNLKLARFIEIINKVCVYWIIYAILFIDILL---LFFHSGKYR 240

Query: 264 --KFIFGNFEN-FGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILT 320
             KF   +F+N    +A+ +   + GFQ   + +  F     +++E K A + +P  +  
Sbjct: 241 SLKFALFHFDNSLSGYANCFVSFIIGFQQSNFTLQGFSMLPALADEVKEAERDIPRAMSA 300

Query: 321 SISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKKWAMTFMTLIAFCQ 380
           S+ +  + GF   + I+  +  N +   D     P+  I   +    +   F+ L+    
Sbjct: 301 SVLISTVSGFIFLLPIMLILPDNTNLFADHKI-LPIVSIFTQSTHSTFVSFFLVLMILGN 359

Query: 381 -FIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXXXXXXXXXXXXX 439
            F  G  ++T  SR +++F+RD  +P   +   V+ +  S  +   +             
Sbjct: 360 LFFSGIGSITTSSRVVYSFSRDHAIPKHEFWTYVDPQSVS--KVPKYSVLLSMAVSYLLG 417

Query: 440 XXSTASAALFSMYIAANYF----AWMTPNLLRMTTGKEIF--SPGAFYMGNFWSPVINWT 493
             +  S A F+ +I A       A + P +L + T + I   +P   +    W  ++N T
Sbjct: 418 ILALFSTAAFNAFIGAAVLCLCSATVLPLVLVLFTRRRILRNAPIKIHYKLGW--IVNIT 475

Query: 494 SXXXXXXXXXXXXXPSSQHNITADTMNYTC-VFVGFVWFGSIAYYYFYKHRTFHGPKSNL 552
           S             P SQ  +T  TMNY   V+V  +   +I Y+ + K+  F  P   L
Sbjct: 476 SIVWLLLSMGSVCLP-SQVPVTVRTMNYALIVYVACLIAITILYFRWGKYH-FTLP---L 530

Query: 553 TDDEF 557
            D+++
Sbjct: 531 VDEDY 535

>CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa]
           {ON} highly similar to uniprot|P36029 Saccharomyces
           cerevisiae YKL174c
          Length = 621

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 104/518 (20%), Positives = 186/518 (35%), Gaps = 27/518 (5%)

Query: 50  NYINAKAAHDDTELLAEIGYKQELNRHF-STIQVFGIAFSIMGLLPSIASILGMA-FAGG 107
           +Y+      D+ E +    YKQEL++   S   V G+ F +M  +  + + +G+    GG
Sbjct: 34  HYVQEDEVTDEPEEVEHFNYKQELDKSLLSRNSVIGLGFGLMSPVLGMCTSMGIGMLNGG 93

Query: 108 AISLVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNS 167
            +S++ G+ ISG  I      + E+ S  P    L       APP+ K + S+  G    
Sbjct: 94  PLSIMLGFFISGILIWFSSLSLGEIVSKFPME--LHVGSAMIAPPRLKLICSWFTGWLML 151

Query: 168 LALIACLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXX 227
           +       SI +  AQ  +S+++++ +     T+   + V     I              
Sbjct: 152 IGNWTMSTSITFAGAQLTISLILMANNELISETHLILFTV-----IVFYMVVTLVGLVNL 206

Query: 228 KLQTFSIVSNXXXX---XXXXXXXXXGVSQSDDVTFNGGKFIFGNFEN-FGDWADGWEFM 283
           K   F  + N                 +       F   K+   +F+N    ++  +   
Sbjct: 207 KFARFIEIINKVCVYWIIYAIIFIDILLLIFHKGKFRSLKYALFHFDNSMSGYSSAFLSF 266

Query: 284 VAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSN 343
           + GFQ   + +  F     +++E K   K +P G+ T++ +    G    + I+  +  +
Sbjct: 267 LIGFQQSNFTLQGFSMLPALADEVKKPEKDIPRGMSTAVLLSTFSGLIFLLPIMLIL-PD 325

Query: 344 ISAILDTVYGQPLAQILYNALGKKWAMTFMTLIAFCQ-FIMGASTLTAISRQIWAFARDD 402
           I  I       P+  I   +        F+ L+     F  G  ++T  SR +++F+RD 
Sbjct: 326 IETIFSNHKVLPIVTIFTKSTHSMVVSVFLVLLILGNLFFSGIGSITTSSRAVYSFSRDH 385

Query: 403 GLP-FSWWIKKVNTKLSSPLRATWFXXXXXXXXXXXXXXXSTASAALFSMYIAANYF--- 458
            +P +  W         S  R   +               +  S A F+ +I A      
Sbjct: 386 AIPRYDLW---TFVPPDSQSRVPKYSILLSMGISYFLGLLALISTAAFNAFIGAAVLCLC 442

Query: 459 -AWMTPNLLRMTTGKEIFSPGAFYMGNFWSPVINWTSXXXXXXXXXXXXXPSSQHNITAD 517
            A   P +L + TG+         +   +   IN  S             P +Q  +T  
Sbjct: 443 SATFIPLVLVLCTGRRSIKHAPVKIRYKFGWFINIASVLWLLLVMVSVCFP-TQLPVTVK 501

Query: 518 TMNYTCVFVGFVWFGSIAYYYFYKHRTFHGPKSNLTDD 555
            MNY  V       G    Y+ +    F  P   L+DD
Sbjct: 502 GMNYAIVVYVLCLIGITILYFKWGKYNFRLP---LSDD 536

>ZYRO0F00242g Chr6 (26301..27908) [1608 bp, 535 aa] {ON} similar to
           uniprot|Q0CZS0 Aspergillus terreus NIH2624 ATEG_00814
           Hypothetical protein
          Length = 535

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 103/477 (21%), Positives = 187/477 (39%), Gaps = 36/477 (7%)

Query: 106 GGAISLVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNS 165
           GG   +++ ++    F  ++GA +AELAS++P SGG+          K+  +  +  G  
Sbjct: 71  GGPPGIMYEFIAVSVFYWAIGASIAELASSVPASGGVYHWAAMTPGKKWGPICGWFAGWF 130

Query: 166 NSLALIACLCSIDYGLAQE---ILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXX 222
           + LA        ++G+A     + S++V S       T  + + VY   +I         
Sbjct: 131 DFLAW-------NFGIASNANMVASMIVYSYGLFHPDTELQRWHVYICFLILTWLCCFVV 183

Query: 223 XXXXXKLQTFSIVSNXXXXX--XXXXXXXXGVSQSDDVTFNGGKFIFGNFEN-FGDWADG 279
                 L T + + +                +  +         F++  ++N  G  +DG
Sbjct: 184 MFADWALPTINRIGSFLILGGWFVTVVVCAVMPSTTGKGHASNDFVWSKWQNNTGYSSDG 243

Query: 280 WEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVAC 339
           + F++ G     + +G  D   H++EE  +A + +P  +   I    +VGF  +I  +  
Sbjct: 244 FAFLL-GMLNGAFSVGTPDCITHLAEEIPDAGRNLPKVLFWQI----LVGFITAITYMIA 298

Query: 340 MG---SNISAILDTVYGQPLAQILYNAL----GKKWAMTFMTLIAFCQFIMGASTLTAIS 392
           M    +N+  I  +    PL +I   A     G    +  + L   C  +     +TA  
Sbjct: 299 MFYAINNLPIIFSSNTFSPLGEIYLQATNSRGGAIGLLLIIYLPIICAIV--GCYITA-G 355

Query: 393 RQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWFXXXXXXXXXXXXXXXSTASAAL---F 449
           R ++  ARD+  PFS ++  ++ +  SP  AT+                +TA  A    F
Sbjct: 356 RTLYVLARDNATPFSKYLGAIHPRYKSPFWATFACGVLCTCLGAIYVGSATAFNAFVGSF 415

Query: 450 SMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFWSPVINWTSXXXXXXXXXXXXXPS 509
            +   A +F  M PNLL   T +     G+F MG F    +N  S             P 
Sbjct: 416 VLLTTAAFFLAMLPNLL---TKRSKLPLGSFNMGKF-GYAVNIISCLYILVFFVIYCFPY 471

Query: 510 SQHNITADTMNYTCVFVGFVWFGSIAYYYFYKHRTFHGPKSNLTDDEFVDAVGQDVI 566
           S    TA+ MNYT V V  +      ++  +  + + GP  ++ + +    +  D +
Sbjct: 472 SLP-ATAENMNYTSVMVSGLTLMVAIWWMVHGRKNYKGPTFDMVEKDNCSVLTDDYL 527

>Kthe_YGOB_SAKL0H11484g Chr5 complement(59674..60886,60889..61346)
           [1671 bp, 556 aa] {ON} ANNOTATED BY YGOB -
          Length = 556

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 106/242 (43%), Gaps = 25/242 (10%)

Query: 252 VSQSD--DVTFNGGKFIFGNFENFGDW-ADGWEFMVAGFQPCVWVIGAFDSCIHMSEEA- 307
           VS+S+  D+++     IFG F N   W + G  F+V    P +W     DS  HM +E  
Sbjct: 246 VSRSNYSDISWPKSSDIFGQFRNTTGWSSSGMAFVVGLINP-LWAFAGIDSATHMVDEVG 304

Query: 308 -KNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGK 366
            K +T  VP  IL++I + ++  F  +I +  C+ ++   + +++   P+ +I Y A G 
Sbjct: 305 YKASTTLVPQAILSTIIIGFLTSFTYAIGMFFCV-TDTEKVTESIL--PILEIYYQATGN 361

Query: 367 KWAMTFMTLIAFCQFIMGA----STLTAISRQIWAFARD-----DGLPFSW----WIKKV 413
           +       L+  C  + GA    +++T  SR +W+  +D        P       +   V
Sbjct: 362 R---NLSVLMQCCCILTGALCGIASVTWQSRILWSLGKDFSQVTTTRPVCKKTMGFFGTV 418

Query: 414 NTKLSSPLRATWFXXXXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKE 473
           N+KL +PL A  F               STA  A+ S  I      +  P L+ +  GK 
Sbjct: 419 NSKLRAPLNAHLFSQLCVAIIGCIFMGSSTAFNAIISACITLLLLTYAVPCLIVLLIGKR 478

Query: 474 IF 475
            F
Sbjct: 479 EF 480

>Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar to
           Ashbya gossypii AEL125C
          Length = 583

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 86/367 (23%), Positives = 141/367 (38%), Gaps = 28/367 (7%)

Query: 55  KAAHDDTELLAEIGYKQELNRHF-STIQVFGIAFSIMGLLPSIASILGMAFA-GGAISLV 112
           K   DDT L+    Y+Q L++   S   V G+ F +M  +  +++ L      GG ++++
Sbjct: 33  KEDDDDTVLVEHFQYEQRLDKSLLSKYSVIGLGFGLMSPVLGMSTSLSTGLVNGGPLTIL 92

Query: 113 WGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIA 172
             ++I G         + E+ S  P    L       AP  ++ V ++  G    L    
Sbjct: 93  GAFIICGFMNWLTSLSIGEVVSKYPIE--LHGSVAMLAPDNYRLVTAYFTGWLMLLGNCV 150

Query: 173 CLCSIDYGLAQEILSIVVISKDGDFEITNAK--TYGVYAGCIIXXXXXXXXXXXXXXKLQ 230
              SI Y  A+ I+S+V IS D      N    T  VY  CI                + 
Sbjct: 151 MNASIQYAGARLIISLVTISGDSLISEDNLIIWTVLVYFLCITITGIINSNFARYLEIIN 210

Query: 231 TFSIVSNXXXXXXXXXXXXXGVSQSDDV--TFNGGKF--IFGNFENFGDWADGWE----- 281
           T  I                 V+  D +   F+ G F      F +F +   G+      
Sbjct: 211 TVCI-----------YWILYAVAFIDILLLMFHYGSFRPFLYAFFHFDNKLSGYSSAVLS 259

Query: 282 FMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMG 341
           FMV GFQ   + +  F     +S+E +   K +P G+  S+ V  I G    I I+  + 
Sbjct: 260 FMVGGFQQSNFTLQGFSLLPALSDETREPEKDIPKGMSQSVLVSTICGIIYLIPILLVIP 319

Query: 342 SNISAILDTVYGQPLAQILYNALGKKWAMTFMTLIAFCQFIM-GASTLTAISRQIWAFAR 400
                I++      +  I   +   K    F  L+     +  G  ++T  SR +++ +R
Sbjct: 320 EP-EEIMNDSRVMEIVLIFTKSTRSKIVSYFQVLLILGNLLFSGIGSITTSSRAVYSMSR 378

Query: 401 DDGLPFS 407
           D GLP+S
Sbjct: 379 DHGLPYS 385

>ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} similar
           to uniprot|P36029 Saccharomyces cerevisiae YKL174C TPO5
           Protein involved in excretion of putrescine and
           spermidine putative polyamine transporter in the Golgi
           or post-Golgi vesicles
          Length = 591

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 95/510 (18%), Positives = 190/510 (37%), Gaps = 26/510 (5%)

Query: 55  KAAHDDTELLAEIGYKQELNRHF-STIQVFGIAFSIMGLLPSIASILGMAFA-GGAISLV 112
           + A ++ E+     Y+QEL++   S   V G+ F +M  +  + + +G+    GG  +++
Sbjct: 33  EEADNEPEIAEHFEYEQELDKSLLSRTSVIGLGFGLMSPVLGMCTSMGIGLLNGGPFTIM 92

Query: 113 WGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIA 172
           +G+ + G F       + E+ S  P    L       AP   K++ S+L G    L    
Sbjct: 93  FGFQVCGVFSFLCACSLGEVVSKFPME--LHGASAILAPDYIKRISSWLTGWFLLLGNWF 150

Query: 173 CLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTF 232
               + +  AQ I+S++ ++   +F++ + K   +Y   I                L+  
Sbjct: 151 MSIGVTFAGAQLIISLIAMA---NFDLISEKYLVLYTVLI----YYAVVTIVGVVNLKYA 203

Query: 233 SIVSNXXXXXXXXXXXXXGVSQSDDVTFNGGKFIFGNFE--NFGDWADGWEFM----VAG 286
             V                      + F+  KF    +   +F +   G+  +    + G
Sbjct: 204 KYVETINKVCIYWIIYAVLFIDVLLLLFHRNKFRSLPYALFHFDNELSGYRSVIISFIIG 263

Query: 287 FQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISA 346
           FQ   + +  F     +++E K   K +P G+ +++ +  ++G      I+  +  +   
Sbjct: 264 FQQSNFTLQGFSMLPALADEVKVPEKDIPRGMSSAVLISTVIGIIFLFPIMVILPDS-RD 322

Query: 347 ILDTVYGQPLAQILYNALGKKWAMTFMTLIAFCQ-FIMGASTLTAISRQIWAFARDDGLP 405
           +       P+  I   +   ++   F+ L+     F  G  ++T  SR +++F+RD  +P
Sbjct: 323 LFSNQKVLPIVNIFKKSTDSQFVSIFLVLLILGNLFFSGIGSITTSSRAVYSFSRDHAIP 382

Query: 406 FSWWIKKVNTKLSSPLRATWFXXXXXXXXXXXXXXXSTASAALFSMYIAANYF----AWM 461
           +      V+ +  S  R   +                  S A F+ +I         A +
Sbjct: 383 YYRLWTYVDPQSES--RVPKYSILLSMSISYILGLLPLFSNAAFNAFIGCAVLCLCSATL 440

Query: 462 TPNLLRMTTGKEIFSPGAFYMGNFWSPVINWTSXXXXXXXXXXXXXPSSQHNITADTMNY 521
            P LL + T + +       +      + N  S             P  Q  +TA TMNY
Sbjct: 441 IPLLLVLVTRRRVLKNAPVKIKYKLGWIANIGSVCWLLLSMFSVCLP-PQIPVTAKTMNY 499

Query: 522 TCVFVGFVWFGSIAYYYFYKHRTFHGPKSN 551
             +   F +F     YY +  + F  P+ +
Sbjct: 500 ALLVFLFCFFIICILYYKWGRKHFQLPQVD 529

>Smik_14.390 Chr14 complement(688421..690085) [1665 bp, 554 aa] {ON}
           YNR056C (REAL)
          Length = 554

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 100/459 (21%), Positives = 185/459 (40%), Gaps = 66/459 (14%)

Query: 72  ELNRHFSTIQVFGIAFSI----MGLLPSIASILGMAFAGGAISLVWGWLISGAFILSVGA 127
           + ++HF+   + GIAFS+    +G+  S+A  +G+A +GG + +++G +I+  F L  G 
Sbjct: 33  KFDKHFNWWSLLGIAFSLSCSWVGISASMA--VGIA-SGGPLLIIYGLIIAAFFSLMCGI 89

Query: 128 GMAELASAIPTSGG--------LXXXXXXXAPP--------------------------- 152
            + + A+ +P S G        L         P                           
Sbjct: 90  SLGDFAAILPNSSGGSFWVLKMLEQESVALKTPEYEDTSDDDGEVFLENYCQTANVEVCS 149

Query: 153 KFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGVYAG-- 210
           KF+KV S ++G  N    I    SI   L+   + I  +    D+E+   K + V+ G  
Sbjct: 150 KFQKVSSMVVGLLNYFGAIFTTASICSSLSMSCIGIHKLLHP-DYEL---KHWHVFVGYQ 205

Query: 211 CIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXXXGVSQSDDVTFNGGKFIFGNF 270
           CI                +  F + ++               S +    +     IFG+F
Sbjct: 206 CINAILTFFNIYSSPLPYISQFGLYTSLLSFAMTFIICIVSRSNNTVEKWPKASNIFGSF 265

Query: 271 ENFGDW-ADGWEFMVAGFQPCVWVIGAFDSCIHMSEEA--KNATKAVPIGILTSISVCWI 327
           +N   W + G  F+V    P +W     DS  HM +E     +   VP  I+T+I V ++
Sbjct: 266 DNQTGWNSSGMAFVVGLVNP-LWAFVGIDSATHMIDEVGYSRSRFLVPKVIITTIIVGFV 324

Query: 328 VGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKKWAMTFMTLIAFCQ-FIMGAS 386
             F   + +  C+ ++ +A+++++   P+ +I Y A G +    F+  +     FI G +
Sbjct: 325 TSFIYCVGLFFCI-TDKTAVVESIL--PIVEIFYQATGNRNLSVFLQCMCITTGFISGIA 381

Query: 387 TLTAISRQIWAFAR------DDGLPFSWWIKKVNT---KLSSPLRATWFXXXXXXXXXXX 437
           + T  SR + +F +      ++G   +  +K+++    K  SPL A +            
Sbjct: 382 SGTWQSRILQSFGKSYAPFYNEGSLGNKSLKRLSILTPKFKSPLYAHFLSQICVTIIGCI 441

Query: 438 XXXXSTASAALFSMYIAANYFAWMTPNLLRM-TTGKEIF 475
               STA  A+ +  I     ++  P+ + +    KE F
Sbjct: 442 FMGSSTAFNAIITACITLLLMSYAVPSFIFVFVVNKEKF 480

>YNR056C Chr14 complement(731618..733303) [1686 bp, 561 aa] {ON}
           BIO5Putative transmembrane protein involved in the
           biotin biosynthesis pathway; responsible for uptake of
           7-keto 8-aminopelargonic acid; BIO5 is in a cluster of 3
           genes (BIO3, BIO4, and BIO5) that mediate biotin
           synthesis
          Length = 561

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 86/377 (22%), Positives = 158/377 (41%), Gaps = 60/377 (15%)

Query: 72  ELNRHFSTIQVFGIAFSI----MGLLPSIASILGMAFAGGAISLVWGWLISGAFILSVGA 127
           + ++HF+   + GIAFS+    +G+  S+A  +G+A +GG + +++G +I+  F L  G 
Sbjct: 40  KFDKHFNWWSLLGIAFSLSCSWVGISASMA--VGIA-SGGPLLIIYGLIIAAFFSLMCGI 96

Query: 128 GMAELASAIPTSGG--------LXXXXXXXAPP--------------------------- 152
            + + A+ +P S G        L         P                           
Sbjct: 97  SLGDFAAILPNSSGGSFWVLKMLEQESVTLKTPEYEDPSDDDEEVFLENYCQTFNVEVSS 156

Query: 153 KFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGVYAG-- 210
           KF+KV S ++G  N    I    SI   L+   + I  +    D+E+   K + V+ G  
Sbjct: 157 KFQKVSSMVVGLLNYFGAIFTTASICSSLSMSCIGIHKLLHP-DYEL---KHWHVFVGYE 212

Query: 211 CIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXXXGVSQSDDVT--FNGGKFIFG 268
           CI                +  F + ++              VS+SD+    +     IFG
Sbjct: 213 CINAVLTLFNIYSTPLPYISQFGLYTSLLSFAMTFIICI--VSRSDNTVDPWPKASNIFG 270

Query: 269 NFENFGDW-ADGWEFMVAGFQPCVWVIGAFDSCIHMSEEA--KNATKAVPIGILTSISVC 325
           +F+N   W + G  F+V    P +W     DS  HM +E     +   VP  I+T+I V 
Sbjct: 271 SFDNQTGWNSSGMAFVVGLVNP-IWAFVGIDSATHMIDEVGYSKSRFLVPKVIITTIIVG 329

Query: 326 WIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKKWAMTFMTLIAFCQ-FIMG 384
           ++  F   + +  C+ ++ +A+++++   P+ +I Y A G +    F+  +     F+ G
Sbjct: 330 FVTSFIYCVGLFFCI-TDQTAVVESIL--PIVEIFYQATGNRNLSVFLQCMCITTGFVSG 386

Query: 385 ASTLTAISRQIWAFARD 401
            ++ T  SR + +F + 
Sbjct: 387 IASGTWQSRILQSFGKS 403

>KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {ON}
           similar to uniprot|P36029 Saccharomyces cerevisiae
           YKL174C TPO5 Protein involved in excretion of putrescine
           and spermidine putative polyamine transporter in the
           Golgi or post-Golgi vesicles
          Length = 549

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 74/362 (20%), Positives = 145/362 (40%), Gaps = 19/362 (5%)

Query: 55  KAAHDDTELLAEIGYKQELNRHF-STIQVFGIAFSIMGLLPSIASILGMAFA-GGAISLV 112
           + A ++ E +    Y+Q+L+R F S   V G+ F +M  +  +++ + +    GG +++V
Sbjct: 31  QDADEEEEEVQRFKYEQQLDRSFLSKSSVIGLGFGLMSPVLGMSTTMSIGLLNGGPLTIV 90

Query: 113 WGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIA 172
            G+LI+G         + E+ S  P    L       A  KFK   S+  G    L    
Sbjct: 91  IGFLINGIATWLCSLSLGEIVSRFPIE--LHGGSAMLARQKFKLACSWFTGWLMLLGNWT 148

Query: 173 CLCSIDYGLAQEILSIVVISKD---GDFEITNAKTYGVYAGCIIXXXXXXXXX--XXXXX 227
              SI +  AQ ++S+V ++ D   G+  I        Y    I                
Sbjct: 149 MSTSITFAGAQLLVSLVTMTNDKLIGENYIVVTTVLAFYLIVTIVGLINLKFAGFIETVN 208

Query: 228 KLQTFSIVSNXXXXXXXXXXXXXGVSQSDDVTFNGGKFIFGNFEN-FGDWADGWEFMVAG 286
           K+  + IV               G        +   K+   +F+N F  ++      + G
Sbjct: 209 KVCVYWIVYAVIFIDILLLLFHSG-------KYRSLKYALAHFDNSFSGYSSAALSFIIG 261

Query: 287 FQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISA 346
           FQ   + +  F     +++E K + + +P G+ T++    + G    + I+  +  +   
Sbjct: 262 FQQSSFTLQGFSMLPALADEVKESERDIPKGMSTAVLTSTVTGVVFLLPIMLIL-PDTQT 320

Query: 347 ILDTVYGQPLAQILYNALGKKWAMTFMTLIAFCQFIM-GASTLTAISRQIWAFARDDGLP 405
           I++     P+A I   +    +   F+ ++     +  G  ++T  SR +++ +RD  LP
Sbjct: 321 IINNPKVMPIALIFTQSTHSIFVSLFLVIMILGNLLFSGIGSVTTSSRAVYSMSRDMALP 380

Query: 406 FS 407
           +S
Sbjct: 381 YS 382

>Kwal_55.19602 s55 (43521..45197) [1677 bp, 558 aa] {ON} YNR056C
           (BIO5) - transmembrane regulator of KAPA/DAPA transport
           [contig 159] FULL
          Length = 558

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 96/235 (40%), Gaps = 15/235 (6%)

Query: 253 SQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEA--KNA 310
           S + +V +     IFG F+N   W       + G    +W     DS  HM +E     +
Sbjct: 251 SSNTEVAWPKPSMIFGEFKNTTGWKSSQMAFIVGLINPLWAFAGIDSATHMVDEVGYTAS 310

Query: 311 TKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKKWAM 370
            K VP  I+ +I + ++  F  +I +  C+ ++ + + D V   P+ ++ Y A G K   
Sbjct: 311 MKLVPRVIIGTILIGFVTSFTYAIGMFFCI-TDPAKLSDAVL--PILELYYQATGNKNLS 367

Query: 371 TFMTLIAFCQFIM-GASTLTAISRQIWAFARDDGL-----PFSWWIKK----VNTKLSSP 420
            F+        I  G +++T  SR +W+  RD         +S  I K    VN  L +P
Sbjct: 368 VFLQCCCIVSGITCGVASVTWQSRILWSLGRDFSTLELRQTYSKKILKFFGVVNPTLKTP 427

Query: 421 LRATWFXXXXXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIF 475
           L A +F               STA  A+ +  I     ++  P L+    G+  F
Sbjct: 428 LNAHFFSQLLVAIIGCIFMGSSTAFNAIITACITLLLLSYAIPCLILFMVGRRRF 482

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 45/74 (60%), Gaps = 3/74 (4%)

Query: 70  KQELNRHFSTIQVFGIAFSIMGLLPSIAS--ILGMAFAGGAISLVWGWLISGAFILSVGA 127
           + +L+++F  + + GIAFS+      ++S  ++G++ +GG + +++G +I   F L  G 
Sbjct: 19  ELKLSKNFGWLSLLGIAFSLTNSWLGVSSSLVVGIS-SGGPLLIIYGLIIGVFFTLMCGW 77

Query: 128 GMAELASAIPTSGG 141
            +AE +S +P S G
Sbjct: 78  SLAEFSSLLPNSSG 91

>Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {ON}
           YKL174C - Hypothetical ORF [contig 110] PARTIAL
          Length = 549

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 74/361 (20%), Positives = 145/361 (40%), Gaps = 25/361 (6%)

Query: 59  DDTELLAEIGYKQELNRHF-STIQVFGIAFSIMGLLPSIASILGMAFA-GGAISLVWGWL 116
           D+ E +    Y+Q+L+R F S   + G+ F++M  +  +++ + +    GG ++++ G+L
Sbjct: 35  DEQEEVQAFKYEQQLDRSFLSKGSIIGLGFALMSPVLGMSTTMNIGLLNGGPMTILLGFL 94

Query: 117 ISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCS 176
           I+G         + E+ S  P    L       AP  ++   S+  G    L       S
Sbjct: 95  INGLATWLCSLSLGEIVSRFPIE--LHGGSAMLAPYNYQLSCSWFTGWLMLLGNWTMSTS 152

Query: 177 IDYGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIXXXX-----XXXXXXXXXXKLQT 231
           I +  AQ ++S+V ++ D          + V A  II                   K+  
Sbjct: 153 ITFAGAQLVISLVTMANDQLIGEKYIVLFTVLAFYIIVTIVGLINLRFASFIEAVNKVCV 212

Query: 232 FSIVSNXXXXXXXXXXXXXGVSQSDDVTFNGGKFIFGNFENF--GDWADGWEFMVAGFQP 289
           + I+               G       ++   K+   +F+N   G  +    FM+ GFQ 
Sbjct: 213 YWIIYAVIFIDILLLLFHSG-------SYRSLKYALFHFDNSFSGYSSKALSFMI-GFQQ 264

Query: 290 CVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVG--FFISIAIVACMGSNISAI 347
             + +  F     +++E K   + +P G+ T++    + G  F + I I+     +   I
Sbjct: 265 SSFTLQGFSMLPALADEVKRPERDIPKGMFTAVLTSTLTGIVFLLPIMIIL---PDTKTI 321

Query: 348 LDTVYGQPLAQILYNALGKKWAMTFMTLIAFCQ-FIMGASTLTAISRQIWAFARDDGLPF 406
           +D     P+  I   +    +   F+ ++     F  G  ++T  SR +++ +RD  LP+
Sbjct: 322 IDNPKLMPIVLIFTQSTHSMFVSLFLVIMILGNLFFSGIGSITTSSRAVYSMSRDMALPY 381

Query: 407 S 407
           S
Sbjct: 382 S 382

>Skud_14.392 Chr14 complement(699671..701266) [1596 bp, 531 aa] {ON}
           YNR056C (REAL)
          Length = 531

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 83/375 (22%), Positives = 154/375 (41%), Gaps = 56/375 (14%)

Query: 72  ELNRHFSTIQVFGIAFSI----MGLLPSIASILGMAFAGGAISLVWGWLISGAFILSVGA 127
           + ++HF+   + GIAFS+    +G+  S+A  +G+A +GG + +++G +I+  F L  G 
Sbjct: 10  KFDKHFNWWSLLGIAFSLSCSWVGISASMA--VGIA-SGGPLLIIYGLIIAAFFSLMCGI 66

Query: 128 GMAELASAIPTS-GG-------LXXXXXXXAPP--------------------------- 152
            + + AS +P S GG       L         P                           
Sbjct: 67  SLGDFASMLPNSCGGSFWVLKMLEQKSATLKTPDYEDTSDDDEEVFLENYCQTANVEVSS 126

Query: 153 KFKKVLSFLIGNSNSLALIACLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGVYAG-- 210
           K ++V S ++G  N    I    SI   L+   + I  +    D+E+   K + ++ G  
Sbjct: 127 KVQRVSSMVVGLLNYFGAIFTTASICSSLSMSCIGIHKLLHP-DYEL---KHWHIFVGYQ 182

Query: 211 CIIXXXXXXXXXXXXXXKLQTFSIVSNXXXXXXXXXXXXXGVSQSDDVTFNGGKFIFGNF 270
           CI                +  F + ++               S +    +     IFG+F
Sbjct: 183 CINAILTLFNIYSSPLPYISQFGLYTSLLSFAMTFIICIVSRSNNTIDAWPKASNIFGSF 242

Query: 271 ENFGDW-ADGWEFMVAGFQPCVWVIGAFDSCIHMSEEA--KNATKAVPIGILTSISVCWI 327
           +N   W + G  F+V    P +W     DS  HM +E     +   VP  I+T+I V +I
Sbjct: 243 DNQTGWNSSGMAFVVGLVNP-IWAFVGIDSATHMIDEVGYSKSRFLVPKVIITTIIVGFI 301

Query: 328 VGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKKWAMTFMTLIAFCQ-FIMGAS 386
             F   + +  C+ ++ +A+++++   P+ +I Y A G +    F+  +     F+ G +
Sbjct: 302 TSFIYCVGLFFCI-TDKTAVVESIL--PIVEIFYQATGNRNLSVFLQCMCITTGFVAGIA 358

Query: 387 TLTAISRQIWAFARD 401
           + T  SR + +F + 
Sbjct: 359 SGTWQSRILQSFGKS 373

>SAKL0H11484g Chr8 complement(983765..985447) [1683 bp, 560 aa] {ON}
           similar to uniprot|P53744 Saccharomyces cerevisiae
           YNR056C BIO5 Putative transmembrane protein involved in
           the biotin biosynthesis pathway responsible for uptake
           of 7-keto 8-aminopelargonic acid BIO5 is in a cluster of
           3 genes (BIO3 BIO4 and BIO5) that mediate biotin
           synthesis
          Length = 560

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 98/226 (43%), Gaps = 20/226 (8%)

Query: 266 IFGNFENFGDW-ADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKA--VPIGILTSI 322
           IF  F N   W + G  F+V    P +W     DS  HM +E  ++T    VP  I+ ++
Sbjct: 261 IFSEFSNTTGWSSSGMAFIVGLINP-LWAFAGIDSATHMVDEVGHSTSRTLVPRAIIGTV 319

Query: 323 SVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKKWAMTFMTLIAFCQ-F 381
            + ++  F  SI +  C+ ++  ++++++   P+ QI Y A G +    F+         
Sbjct: 320 LLGFVTSFTYSIGMFYCI-TDTKSVVESIL--PILQIYYQATGNRNLSIFLQCCCITSGV 376

Query: 382 IMGASTLTAISRQIWAFAR-----DDGLP---FSWWIKK---VNTKLSSPLRATWFXXXX 430
           + G ++ T  SR +W+ +R     D   P   F ++ K+   VN+ L  PL +  F    
Sbjct: 377 VCGIASGTWQSRILWSISRDFENIDTNKPRPVFRYFCKRFGHVNSLLKVPLTSHLFSQVI 436

Query: 431 XXXXXXXXXXXSTASAALFSMYIAANYFAWMTP-NLLRMTTGKEIF 475
                      +TA  A+ +  I     ++  P  +L +  GK  F
Sbjct: 437 VAIIGCIFMGSTTAFNAIITACITLLLLSYAIPCTILLVVVGKRQF 482

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 72  ELNRHFSTIQVFGIAFSIMGLLPSIASILGMA-FAGGAISLVWGWLISGAFILSVGAGMA 130
           +L ++FS   + GI+FS+      ++S L +  ++GG + +++G +I   F    G  ++
Sbjct: 30  KLLKNFSWWSLIGISFSLTNSWLGVSSSLVVGLYSGGPLLIIYGLIIGLFFTFMCGWSLS 89

Query: 131 ELASAIPTSGG 141
           E +S +P S G
Sbjct: 90  EFSSLLPNSSG 100

>AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL174C
          Length = 575

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 75/362 (20%), Positives = 143/362 (39%), Gaps = 26/362 (7%)

Query: 58  HDDTELLAE-IGYKQELNRHF-STIQVFGIAFSIMGLLPSIASILGMAFA-GGAISLVWG 114
            DD  +  E   Y+Q+L+R   S   V G+ F +M  +  +++ LG+    GG  +++  
Sbjct: 34  RDDEPVEVEHFQYEQKLDRTLLSRRSVIGLGFGLMSPVLGMSTTLGIGLVHGGPPTILGA 93

Query: 115 WLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACL 174
           + + G         + E+ S  P    L       AP +++ V ++  G    L      
Sbjct: 94  FALCGLMSWLTALAIGEVVSKYPIE--LHGSVALLAPERYRLVAAYYTGCLILLGNWVMN 151

Query: 175 CSIDYGLAQEILSIVVISKDGDFEITNAK-TYGVYAGCIIXXXXXXXXXXXXXXKLQTFS 233
            SI Y  AQ I+S++ IS D   E   A  T  VY   I                + T  
Sbjct: 152 ASIQYAGAQLIISLIAISGDLVSEENLAIWTVAVYFLSITVTGVINAKFASFLEPINTVC 211

Query: 234 IVSNXXXXXXXXXXXXXGVSQSDDVTFNGGKF--IFGNFENFGDWADGWE-----FMVAG 286
           I                       + F+ G F      F NF +   G+E     F+V G
Sbjct: 212 IYWILYAVVFIDVLL---------ILFHKGSFRPFLSAFSNFDNRLSGYESMLLSFLVGG 262

Query: 287 FQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISA 346
            Q   + +  F     +S+E +   K +P G+  ++ V  + G    + ++  M S    
Sbjct: 263 LQQSNFTLQGFSMLPALSDETQEPEKDIPKGMSQAVLVSTVCGVIYLVPLLLVMPSPEEV 322

Query: 347 ILDTVYGQPLAQILYNALGKKWAMTFMTLIAFCQFIM--GASTLTAISRQIWAFARDDGL 404
           + D+   + +  +L+    +   ++++ ++     ++  G  ++T  SR +++ +RD  +
Sbjct: 323 MSDSRVMEIV--LLFTKSTRSNIVSYLQVMLILGNLLFSGIGSITTSSRAVYSISRDHAI 380

Query: 405 PF 406
           P+
Sbjct: 381 PY 382

>KAFR0G00390 Chr7 complement(115188..117011) [1824 bp, 607 aa] {ON}
           Anc_1.173 YKL174C
          Length = 607

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 73/374 (19%), Positives = 147/374 (39%), Gaps = 28/374 (7%)

Query: 51  YINAKAAHDDTELLAEIGYKQELNRHF-STIQVFGIAFSIMGLLPSIASILGMAFA-GGA 108
           Y++      +++ +    Y+QEL++   S   V G+ F +M  +  + + + +    GG 
Sbjct: 29  YLHEDEDSVNSDTVEHFKYEQELDKSLLSRSSVIGLGFGLMSPVLGMCTSMSIGLINGGP 88

Query: 109 ISLVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLS------FLI 162
           ++++ G+++SG  I      + E+ S  P    +       AP KFK + S       LI
Sbjct: 89  LTIMLGFILSGISIWFCSLSLGEIISKFPME--MHVASAMLAPKKFKLLCSWYTGWLMLI 146

Query: 163 GNSNSLALIACLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXX 222
           GN           SI +  AQ  +S+ ++    D  + + + +  Y   +I         
Sbjct: 147 GNWTMST------SITFAGAQLTISLFLMK---DQYLISEEHFIFYT--VIVFYLVVTVV 195

Query: 223 XXXXXKLQTFSIVSNXXXX---XXXXXXXXXGVSQSDDVTFNGGKFIFGNFEN-FGDWAD 278
                K   F  + N                 +      T+   K+   +F+N    +++
Sbjct: 196 GLINLKFARFIEIINKVCVYWIIYAIIFIDILLLIFHKGTYRSLKYALFHFDNSRSGYSN 255

Query: 279 GWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVA 338
                + GFQ   + +  F     +++E K   + +P G+  S+ +    G    + I+ 
Sbjct: 256 VLISFIIGFQQSNFTLQGFSMLPALADEVKKPERDIPRGMSISVLISTFSGIIFLLPIMI 315

Query: 339 CMGSNISAILDTVYGQPLAQILYNALGKKWAMTFMTLIAFCQ-FIMGASTLTAISRQIWA 397
            +  ++S I       P+  I   +        F+ L+     F  G  ++TA SR +++
Sbjct: 316 IL-PDLSTIFTDHKVLPIVNIFIQSTDSMIVSFFLVLLILGNLFFSGIGSITASSRTVYS 374

Query: 398 FARDDGLP-FSWWI 410
           F+RD  +P +  WI
Sbjct: 375 FSRDQAIPYYDHWI 388

>NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON}
           Anc_1.173
          Length = 612

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 76/363 (20%), Positives = 143/363 (39%), Gaps = 19/363 (5%)

Query: 52  INAKAAHDDTELLAEIGYKQELNRHF-STIQVFGIAFSIMGLLPSIASILGMAFA-GGAI 109
           I+ ++  D+ E +    Y QEL++   S   V G+ F +M  +  +++ + +    GG  
Sbjct: 31  IHEESDTDEVESVEHFKYNQELDKSLLSRSSVVGLGFGLMSPVLGMSTSMAIGLINGGPA 90

Query: 110 SLVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLA 169
           +++WG++ISG  I      + E+ S  P    L       AP   K + S+  G    L 
Sbjct: 91  TILWGFIISGICIWFCSLSLGEVVSKFPME--LHVSSAMLAPKDAKLICSWYTGWLMLLG 148

Query: 170 LIACLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKL 229
                 SI +  AQ  +S+++++K        A+ Y +    II               L
Sbjct: 149 NWTMSTSITFAGAQLTISLILMAKSDLI----AEKYMIGFTVII---FYLVVTLVGLINL 201

Query: 230 QTFSIVSNXXXXXXXXXXXXXGVSQSDDVTFNGG-----KFIFGNFEN-FGDWADGWEFM 283
           +    +                V     + F+ G     KF   NF+N    +++ +   
Sbjct: 202 KFARFIETINKVCVVWIIYAICVIDILLLIFHQGKYRSLKFALFNFDNSLSGYSNFFVSF 261

Query: 284 VAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSN 343
           + GFQ   + +  F     +++E K   K +P G+  ++ +    G    I I+  +  +
Sbjct: 262 IIGFQQSNFTLQGFSMLPALADEVKVPEKDIPRGMSNAVLLSTFSGIIFLIPIMIILPDS 321

Query: 344 ISAILDTVYGQPLAQILYNALGKKWAMTFMTL-IAFCQFIMGASTLTAISRQIWAFARDD 402
              +       P+  I   +   K    F+ L I    F  G  ++T  SR +++F+RD 
Sbjct: 322 -DKLFSNNQMLPIVNIFTQSTHSKIVSLFLVLSILGNLFFSGIGSITTSSRAVYSFSRDH 380

Query: 403 GLP 405
            +P
Sbjct: 381 AIP 383

>SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36029 Saccharomyces cerevisiae
           YKL174C TPO5 Protein involved in excretion of putrescine
           and spermidine putative polyamine transporter in the
           Golgi or post-Golgi vesicles
          Length = 568

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 106/531 (19%), Positives = 196/531 (36%), Gaps = 34/531 (6%)

Query: 59  DDTELLAEIGYKQELNRHF-STIQVFGIAFSIMGLLPSIASILGMAFA-GGAISLVWGWL 116
           D  E++ +  Y+Q+L++   S   V G+ F +M  +  +++ + +    GG +++V G++
Sbjct: 38  DGPEVVEQFQYEQKLDKSLLSRGSVIGLGFGLMSPVLGMSTTMSIGLLNGGPLTIVAGFM 97

Query: 117 ISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCS 176
           + G         + E+ S  P    L       A  K + V S+  G    L       S
Sbjct: 98  VVGFATWLCSLSLGEIVSKFPIE--LHGGSAMLAAKKHRLVFSWYTGWLMLLGNWTMSTS 155

Query: 177 IDYGLAQEILSIVVISKDGDFEITNAKTYGV---YAGCIIXXXXXXXXXX--XXXXKLQT 231
           I +  AQ ++S++ ++ D      +   Y V   YA   +                K+  
Sbjct: 156 ITFAGAQLVISLISLANDSLVPKDSVIFYTVVVFYAIVTVVGVVNLKFARFIETINKVCV 215

Query: 232 FSIVSNXXXXXXXXXXXXXGVSQSDDVTFNGGKFIFGNFENF--GDWADGWEFMVAGFQP 289
           + I+               G        +   K+   +F+N   G  +    FM+ GFQ 
Sbjct: 216 YWIIYAIIFTDILLLLFHTG-------EYRSLKYALAHFDNSLSGYRSAALSFMI-GFQQ 267

Query: 290 CVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILD 349
             + +  F     +++E K   + +P G+  S+ +  + G    + I+  +  + SAIL+
Sbjct: 268 SNFTLQGFSMLPALADEVKEPERDIPRGMSLSVVLSALSGLVFLLPIMLIL-PDTSAILN 326

Query: 350 TVYGQPLAQILYNALGKKWAMTFMTLIAFCQFIM-GASTLTAISRQIWAFARDDGLPFSW 408
                P+  I   +        F+ L+     +  G  ++T  SR +++ +RD  LP+  
Sbjct: 327 NDRVMPIVLIFTQSTHSIVVSFFLVLMILGNLLFSGIGSITTSSRAVYSMSRDHALPYHE 386

Query: 409 WIKKVNTKLSSPLRATWFXXXXXXXXXXXXXXXSTASAALFSMYIAANYF----AWMTPN 464
               V     S  R   +               +  S A F+ ++ A       A   P 
Sbjct: 387 LWTYVEPASQS--RVPKYSILLTMAISYVLGLLALVSTAAFNAFVGAAVLCLCSATCIPV 444

Query: 465 LLRMTTGKEIF--SPGAFYMGNFWSPVINWTSXXXXXXXXXXXXXPSSQHNITADTMNYT 522
           +L + + +     SP        W  ++N  S             P  Q  +T  TMNY 
Sbjct: 445 VLVLASRRRALRGSPIKVRYKLGW--LVNLASVAWLVFTMFVISMP-PQVPVTLVTMNYA 501

Query: 523 C-VFVGFVWFGSIAYYYFYKHRTFHGPKSNLTDDEFVDAVGQDVIDEILSN 572
             VF  F+  G  A Y+ +    F  P  +       D   ++V  E +SN
Sbjct: 502 AFVFAAFM-VGITALYFCWGRHHFRAPLVDENSKAGGDVPLEEVPLEEMSN 551

>TDEL0G04830 Chr7 complement(891989..893620) [1632 bp, 543 aa] {ON} 
          Length = 543

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 68/145 (46%), Gaps = 14/145 (9%)

Query: 263 GKFIFGNFENFGDW-ADGWEFMVAGFQPCVWVIGAFDSCIHMSEEA--KNATKAVPIGIL 319
           GK +FG F N   W + G  F+V    P +W     DS  HM ++     + K VP  I+
Sbjct: 244 GKTVFGEFTNTTGWSSSGMAFIVGLINP-LWSFAGIDSATHMVDDVGYSASRKLVPRIII 302

Query: 320 TSISVCWIVGFFISIAIVACMGSN---ISAILDTVYGQPLAQILYNALGKKWAMTFM-TL 375
            +I + +   F  +I +  C+  +   +S+IL      P+ QI Y A G K    FM + 
Sbjct: 303 ATILLGFATAFPYAIVMFFCITDSTQVVSSIL------PILQIYYQATGNKSLSAFMQSC 356

Query: 376 IAFCQFIMGASTLTAISRQIWAFAR 400
                FI G S+ T  +R +W+ +R
Sbjct: 357 CIITGFICGVSSSTWQNRILWSVSR 381

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 77  FSTIQVFGIAFSIMG-LLPSIASILGMAFAGGAISLVWGWLISGAFILSVGAGMAELASA 135
           F+ + + GIAFS+    L   +S++   ++GG + +++G +I   F +  G  + E +S 
Sbjct: 9   FNWLSLLGIAFSLTSSWLGVSSSLVAGLYSGGPVLIIYGLIIGAVFTIMCGLSLCEFSSM 68

Query: 136 IPTSGGL 142
           +P + G+
Sbjct: 69  LPNASGV 75

>NDAI0A00890 Chr1 complement(181903..183828) [1926 bp, 641 aa] {ON}
           Anc_1.173 YKL174C
          Length = 641

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 75/366 (20%), Positives = 144/366 (39%), Gaps = 25/366 (6%)

Query: 52  INAKAAHDDTELLAEIGYKQELNRHF-STIQVFGIAFSIMGLLPSIASILGMAFA-GGAI 109
           I+ +   + TE++    Y QEL++   S   + G+ FS+M     +++ + +    GG  
Sbjct: 31  IHEEPDDETTEVVEHFKYNQELDKSLLSRGSIVGLGFSLMSAPLGMSTSMAIGLINGGPA 90

Query: 110 SLVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLA 169
           +++WG+LISG  I      + E+ S  P    L       AP K K + S+  G    L 
Sbjct: 91  TIIWGFLISGICIWFCSLSLGEVVSKFPME--LHVSSAMLAPKKLKLICSWYTGWLMLLG 148

Query: 170 LIACLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKL 229
                 SI +  AQ  +S+++++ + D  I+     G     +I              K 
Sbjct: 149 NWTMSTSITFAGAQLTISLILMT-NSDL-ISEKYLIGF---TVIIFYLVVTIVGLINLKF 203

Query: 230 QTFSIVSNXXXX---XXXXXXXXXGVSQSDDVTFNGGKFIFGNFENFGDWADGW--EFMV 284
             F    N                 +       ++  K+   +F+N      G+   F++
Sbjct: 204 ARFIETINRACVIWIIYAILFIDILLLIFHRGKYHSLKYSLFHFDNSLSGYSGFLISFLI 263

Query: 285 AGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNI 344
            GFQ   + +  F     +++E K   K +P G+  ++ +    G    I I+  +  + 
Sbjct: 264 -GFQQSNFTLQGFSMLPALADEVKVPEKDIPRGMSNAVLLSAFSGIVFLIPIMIILPES- 321

Query: 345 SAILDTVYGQ----PLAQILYNALGKKWAMTFMTLIAFCQ-FIMGASTLTAISRQIWAFA 399
               D ++      P+  I   +    +   F+ L+     F  G  ++T  SR +++F+
Sbjct: 322 ----DKLFTNHKILPIVNIFTQSTHSMFVSFFLLLMILGNLFFSGIGSITTSSRAVYSFS 377

Query: 400 RDDGLP 405
           RD  +P
Sbjct: 378 RDHAIP 383

>KLLA0A06666g Chr1 complement(603169..604851) [1683 bp, 560 aa] {ON}
           similar to uniprot|P36029 Saccharomyces cerevisiae
           YKL174C TPO5 Protein involved in excretion of putrescine
           and spermidine putative polyamine transporter in the
           Golgi or post-Golgi vesicles
          Length = 560

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 66/356 (18%), Positives = 145/356 (40%), Gaps = 15/356 (4%)

Query: 58  HDDTELLAEIGYKQELNRHF-STIQVFGIAFSIMGLLPSIASILGMAFA-GGAISLVWGW 115
            D  + + E  Y Q+L+++  S   V G+ F +M  +  +++ + +    GG+ S+++G+
Sbjct: 66  QDIPDEVKEFTYVQQLDKNLLSRTSVIGLGFGLMSPVLGMSTTMSIGLLNGGSPSIIFGY 125

Query: 116 LISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLC 175
           LI G         ++E+ S  P    L       AP + +  +S+  G            
Sbjct: 126 LICGIMTWISSLSLSEIVSKYPIE--LHGAAAMLAPGRLRLRMSWYCGWLMLFGSWTMST 183

Query: 176 SIDYGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIV 235
           SI +  AQ I+S++ ++ +    + +++   ++   ++              K  +F   
Sbjct: 184 SITFAGAQLIISLLTMTNE---SLIDSRWLTLWT--VLMFYLIVTVVGVINLKFSSFIET 238

Query: 236 SNXXXXXXXXXXXXXGVSQSDDVTFNGGKF--IFGNFENF--GDWADGWEFMVAGFQPCV 291
            N               +       N   F  +F  F+N   G  +    F++ GFQ   
Sbjct: 239 INKVCVYWILYAILFTSTLLLLFQPNHRSFKDVFTKFDNSLSGYSSMALSFLIGGFQQSN 298

Query: 292 WVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTV 351
           +    F     +S+E +   K +P  +  S+ +  + G F  I ++  +  ++S +++  
Sbjct: 299 FTFQGFAMLSALSDETEKPEKDIPYSMTRSVIISLVSGLFFLIPMMLIL-PDVSEVMNHE 357

Query: 352 YGQPLAQILYNALGKKWAMTFMTLIAFCQFIM-GASTLTAISRQIWAFARDDGLPF 406
              P+  I   +    +   F+ L+     +  G  ++T  SR +++ +RD G+P+
Sbjct: 358 GVMPIVLIFTKSTKSLFVSIFLVLLILGNLLFSGIGSVTTSSRALYSLSRDRGIPY 413

>Kpol_2002.70 s2002 complement(159457..161325) [1869 bp, 622 aa]
           {ON} complement(159457..161325) [1869 nt, 623 aa]
          Length = 622

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 95/507 (18%), Positives = 178/507 (35%), Gaps = 32/507 (6%)

Query: 58  HDDTELLAEIGYKQELNRHFSTIQV-----FGIAFSIMGLLPSIASILGMAFAGGAISLV 112
           +D  E++ +  Y+QEL++   ++       FG+   ++G+  S++  +G+   GG ++++
Sbjct: 36  NDQVEVVEQFKYEQELDKSLLSLSSVVGLGFGLMSPVLGMCTSMS--IGLK-NGGPLTII 92

Query: 113 WGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIA 172
            G+L+SG  I      + E+ S  P    L       AP   K + S+  G    +    
Sbjct: 93  MGFLLSGISIWFCSLSLGEVVSKFPME--LHGSSALLAPDSLKLICSWYTGWLMLIGNWT 150

Query: 173 CLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTF 232
              SI Y  AQ  +S+++++        N   + V     I              K   F
Sbjct: 151 MSTSITYAGAQLTISLILMNNSDLISEANLIFFTV-----IVFYMVVTIVGLVNLKFSRF 205

Query: 233 SIVSNXXXXX---XXXXXXXXGVSQSDDVTFNGGKFIFGNFEN-FGDWADGWEFMVAGFQ 288
             + N                 +       F   K+   +F+N    +  G    + GFQ
Sbjct: 206 IEIINKICVLWIIYAIIFIDILLLIFHSGKFRSLKYALFHFDNHLSGYGSGVLSFIIGFQ 265

Query: 289 PCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAIL 348
              + +  F     +SEE K     +P G+  ++ +  + G      I       I   +
Sbjct: 266 QSNFTLQGFSMLPALSEEVKRPENDIPRGMSNAVLLSTLSG-----VIFLIPILIILPDI 320

Query: 349 DTVYG----QPLAQILYNALGKKWAMTFMTLIAFCQ-FIMGASTLTAISRQIWAFARDDG 403
           DT++      P+  I   +        F+ L+     F  G  ++T  SR +++F+RD G
Sbjct: 321 DTLFTGHKILPIVNIFTKSTNSTVVSIFLVLMILGNLFFSGIGSITTSSRSVYSFSRDRG 380

Query: 404 LPFS--WWIKKVNTKLSSPLRATWFXXXXXXXXXXXXXXXSTASAALFSMYIAANYFAWM 461
           +P+   W     ++    P  + W                + A  A     +     A +
Sbjct: 381 IPYHNLWTYVDPSSVSKVPKYSIWLSMAISYFLGLLALFSTAAFNAFIGAAVLCLCSATV 440

Query: 462 TPNLLRMTTGKEIFSPGAFYMGNFWSPVINWTSXXXXXXXXXXXXXPSSQHNITADTMNY 521
            P +L + + + +       M      ++N  S             P  Q  +T  TMNY
Sbjct: 441 IPLILVLFSRRRVIRNAPVKMKYKLGWIVNIISVLWLLLSMVSVCFP-PQIPVTFQTMNY 499

Query: 522 TCVFVGFVWFGSIAYYYFYKHRTFHGP 548
             +   F        Y+ +    F  P
Sbjct: 500 ALIVYIFCLISITVLYFKWGKYNFQLP 526

>Suva_14.415 Chr14 complement(716463..718061) [1599 bp, 532 aa] {ON}
           YNR056C (REAL)
          Length = 532

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 70/140 (50%), Gaps = 8/140 (5%)

Query: 266 IFGNFENFGDW-ADGWEFMVAGFQPCVWVIGAFDSCIHMSEEA--KNATKAVPIGILTSI 322
           IFGNF+N   W + G  F+V    P +W     DS  HM +E     +   VP  I+T+I
Sbjct: 238 IFGNFDNQTGWHSSGMAFVVGLVNP-IWAFVGIDSATHMIDEVGYSKSRFLVPKVIITTI 296

Query: 323 SVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKKWAMTFMTLIAFCQ-F 381
            V +I  F   + +  C+ ++ +A+++++   P+ +I Y A G +    F+  +     +
Sbjct: 297 VVGFITSFIYCVGLFFCI-TDKTAVVESIL--PIVEIFYQATGNRNLSVFLQCMCITTGY 353

Query: 382 IMGASTLTAISRQIWAFARD 401
           + G ++ T  SR + ++ + 
Sbjct: 354 VAGIASGTWQSRILQSYGKS 373

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 45/74 (60%), Gaps = 7/74 (9%)

Query: 72  ELNRHFSTIQVFGIAFSI----MGLLPSIASILGMAFAGGAISLVWGWLISGAFILSVGA 127
           + ++HF+   + GIAFS+    +G+  S+A  +G+A +GG + +++G +I+  F L  G 
Sbjct: 10  KFDKHFNWWSLLGIAFSLSCSWVGISASMA--VGIA-SGGPLLIIYGLIIAAFFTLMCGI 66

Query: 128 GMAELASAIPTSGG 141
            + + AS +P S G
Sbjct: 67  SLGDFASILPNSCG 80

>TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.173
           YKL174C
          Length = 647

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 58/321 (18%), Positives = 115/321 (35%), Gaps = 19/321 (5%)

Query: 260 FNGGKFIFGNFEN-FGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGI 318
           F   K+   +F+N    +   +   + GFQ   + +  F     +++E K   + +P G+
Sbjct: 251 FRSLKYALFHFDNSLSGYTSAFLSFIIGFQQSNFTLQGFSMLPALADEVKRPERDIPRGM 310

Query: 319 LTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQ------PLAQILYNALGKKWAMTF 372
            T++ +    G    + I+  +       LD ++        P+  I   +   K+   F
Sbjct: 311 STAVLLSTFSGVVFLLPIMLILPD-----LDNIFNNKNSNLLPIVSIFTQSTHSKFVSVF 365

Query: 373 MTLIAFCQFIM-GASTLTAISRQIWAFARDDGLPFS--WWIKKVNTKLSSPLRATWFXXX 429
           +        +  G  ++T  SR +++F+RD  LP+   W     ++    P  + W    
Sbjct: 366 LVFCILGNLLFSGIGSITTSSRAVYSFSRDHALPYHELWTFVDSDSVSKVPKYSIWLSMG 425

Query: 430 XXXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFWSPV 489
                       + A  A     +     A + P +L + +G+         M      +
Sbjct: 426 VSYTLGLLALFSTAAFNAFVGAAVLCLCTATVIPLILVLISGRRSIRNAPVKMKYKLGWI 485

Query: 490 INWTSXXXXXXXXXXXXXPSSQHNITADTMNYTCVFVGFVWFGSIAYYYFYKHRTF---H 546
           +N  S             P  Q  +T  TMNY  +   F        Y+ +    F   H
Sbjct: 486 VNILSVAWLLLAMVSVCFP-PQIPVTFSTMNYALMVYIFCLIIITVLYFQWGKNNFVLPH 544

Query: 547 GPKSNLTDDEFVDAVGQDVID 567
             K++LT +    A+ + ++D
Sbjct: 545 PMKTSLTSNPSTYAMSKSLVD 565

>KLLA0B00385g Chr2 complement(25847..27541) [1695 bp, 564 aa] {ON}
           similar to uniprot|P53744 Saccharomyces cerevisiae
           YNR056C BIO5 Putative transmembrane protein involved in
           the biotin biosynthesis pathway responsible for uptake
           of 7-keto 8-aminopelargonic acid BIO5 is in a cluster of
           3 genes (BIO3 BIO4 and BIO5) that mediate biotin
           synthesis
          Length = 564

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 102/225 (45%), Gaps = 21/225 (9%)

Query: 266 IFGNFENFGDW-ADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKN--ATKAVPIGILTSI 322
           IF  F N   W ++G  F+V+   P +W     DS  HM +E  +  A   VP  I+T+I
Sbjct: 263 IFYKFHNNTGWKSNGMAFVVSLINP-LWSFVGIDSATHMVDEVGHVAAQVLVPKVIITTI 321

Query: 323 SVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGKKWAMTFM---TLIAFC 379
            + +I  F  SIA+  C+  + +A+L+++   P+  I Y A G +    FM   T++A  
Sbjct: 322 FIGFITSFSYSIALFYCV-RDTAAVLESI--APVVTIYYQATGNRNLAVFMQASTIVA-- 376

Query: 380 QFIMGASTLTAISRQIWAFARD------DGLPFSWWIKK---VNTKLSSPLRATWFXXXX 430
               G ++ T  SR +W+ +R+      DG+   +   +   +++    PL A +F    
Sbjct: 377 GLTCGVASGTWQSRMLWSLSREMETMRPDGILSGFVTARFATIDSVNKVPLYAHFFSQAL 436

Query: 431 XXXXXXXXXXXSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIF 475
                      + A  A+ S  +     ++  P+L+ +  G+  F
Sbjct: 437 VVIIGCIMLGSTKAFNAIVSAAVTLLIVSYAIPSLILLVRGRNKF 481

>KNAG0C00980 Chr3 complement(191133..193277) [2145 bp, 714 aa] {ON}
           Anc_1.173 YKL174C
          Length = 714

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 69/368 (18%), Positives = 141/368 (38%), Gaps = 28/368 (7%)

Query: 52  INAKAAHDDTELLAEIGYKQELNRHF-STIQVFGIAFSIMGLLPSIASILGMAFA---GG 107
           I+  +  ++ E++    Y+QEL++   S   + G+ F +M   P +     MA     GG
Sbjct: 28  IHEDSDENEPEIVEHFKYEQELDKSLLSRSSIVGLGFGLMS--PVLGMCTSMAIGLINGG 85

Query: 108 AISLVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNS 167
             +++WG+LISG  I      + E+ S  P    +       AP   K + S+  G    
Sbjct: 86  PATIMWGFLISGICIWFCSLSLGEIVSKFPME--IHVGSAMLAPASLKLISSWYTGWLML 143

Query: 168 LALIACLCSIDYGLAQEILSIVVIS-----KDGDFEITNAKTYGVYAGCIIXXXXXXXXX 222
           +       SI +  AQ  +S+++++     KD    +     + +    +          
Sbjct: 144 IGNWTMSTSITFAGAQLTISLILMNNNDLIKDPHLVLYTVIVFYLVVTIVGLINLKFARF 203

Query: 223 XXXXXKLQTFSIVSNXXXXXXXXXXXXXGVSQSDDVTFNGGKFIFGNFEN----FGDWAD 278
                K+  + I+               G        +   K+   +F+N    +G++  
Sbjct: 204 IETINKVCVYWILYAVIFIDILLLIFHKG-------KYRSLKYALTHFDNSRSGYGNFVI 256

Query: 279 GWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVA 338
            +   + GFQ   + +  F     +++E +   K +P G+  ++ +    G    + I+ 
Sbjct: 257 SF---IIGFQQSNFTLQGFSMLPALADEVRVPEKDIPRGMSNAVLLSAFSGIISLLPIMI 313

Query: 339 CMGSNISAILDTVYGQPLAQILYNALGK-KWAMTFMTLIAFCQFIMGASTLTAISRQIWA 397
            +    + I       P+  I   +      +   + LI    F  G  ++TA SR +++
Sbjct: 314 ILPDMDTFIFYDGRVLPIVNIFTQSTDSVILSTLLVLLILGNLFFSGIGSITASSRSVYS 373

Query: 398 FARDDGLP 405
           F+RD  +P
Sbjct: 374 FSRDHAIP 381

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 81/192 (42%), Gaps = 20/192 (10%)

Query: 4   SSSYVEKNQIKTSARELHPIVSANANGEVQQITSLRTITSKRAGEVNYINA----KAAHD 59
            SS   K  IKT+  EL P V ++ N +  +   +      ++   N+++     +    
Sbjct: 12  ESSLNGKLAIKTAVEELSPDVESDQNHDYYK-DKVHVNDPNKSRFQNFVDGFRELRMEDV 70

Query: 60  DTEL-----LAEIGYKQELNRHFST--IQVFGIAFSI-MGLLPSIASILGMAFAGGAISL 111
           D  L      A       L RH     +Q+  I  SI  GL       L +   GG  ++
Sbjct: 71  DPNLTAAERAAIATASSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRI---GGPAAV 127

Query: 112 VWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLS--FLIGN--SNS 167
           V  W+++G+ + SV   + ELA A+P SG           P F   ++  +LIGN  +  
Sbjct: 128 VIAWIMTGSMVYSVVQALGELAVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMP 187

Query: 168 LALIACLCSIDY 179
           L LIA   +++Y
Sbjct: 188 LELIAASITVNY 199

>YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON}
           TPO5Protein involved in excretion of putrescine and
           spermidine; putative polyamine transporter in the Golgi
           or post-Golgi vesicles
          Length = 618

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 70/360 (19%), Positives = 131/360 (36%), Gaps = 37/360 (10%)

Query: 70  KQELNRHFSTIQVFGIAF----SIMGL-LPSIASILGMAFA-------GGAISLVWGWLI 117
           + E   HF+  QV   +     SI+GL L  ++ +LGM  +       GG ++++ G+LI
Sbjct: 38  ENEEAEHFNYDQVLDKSLLSRGSIVGLGLGLMSPVLGMCTSMAIGLINGGPLTIMLGFLI 97

Query: 118 SGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSI 177
           SG  I      + E+ S  P    L       AP K K V S+  G    +       SI
Sbjct: 98  SGVCIWFSSLSLGEIVSKFPME--LHVGSAMLAPEKLKLVCSWYTGWLMLIGNWTMSTSI 155

Query: 178 DYGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSN 237
            +  AQ  +S+++++        +   Y V    ++               L+    +  
Sbjct: 156 TFAGAQLTISLILMTNSNLISEAHLIFYTVIVFYLVVTVVGLV-------NLKFARFIET 208

Query: 238 XXXXXXXXXXXXXGVSQSDDVTFNGGKF------IFGNFENFGDWADGWEFMVAGFQPCV 291
                               + F+ GKF      +F    N   +   +   + GFQ   
Sbjct: 209 INKVCVYWIIYAIIFIDILLLVFHKGKFRSLKYALFHFDNNLSGYKSAFLSFIIGFQQSN 268

Query: 292 WVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTV 351
           + +  F     +++E K   K +P G+  ++ +    G    I I+  +  N     D +
Sbjct: 269 FTLQGFSMLPALADEVKVPEKDIPRGMSNAVLLSAFSGVIFLIPIMLILPDN-----DLL 323

Query: 352 YGQPLAQILYNALGKKWAMTFMTLIAFCQFIM-----GASTLTAISRQIWAFARDDGLPF 406
           +       + N   K      ++       +      G  ++T  SR +++F+RD  +P+
Sbjct: 324 FTNHKVLPIVNIFTKSTDSVVLSFFLVLLILGNLLFSGIGSITTSSRAVYSFSRDQAIPY 383

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 57/126 (45%), Gaps = 10/126 (7%)

Query: 61  TELLAEIGYKQELNRHFST--IQVFGIAFSI-MGLLPSIASILGMAFAGGAISLVWGWLI 117
           TE  A    +  L RH     +Q+  I  SI  GL       L +   GG  +++  W++
Sbjct: 72  TERAAIATARSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRI---GGPAAVILAWIL 128

Query: 118 SGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLS--FLIGN--SNSLALIAC 173
           +G+ + SV   + EL  A+P SG           P F   ++  +L+GN  +  L ++A 
Sbjct: 129 TGSMVYSVVQAIGELCVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAA 188

Query: 174 LCSIDY 179
             ++DY
Sbjct: 189 SITVDY 194

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score = 38.5 bits (88), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 43/100 (43%), Gaps = 6/100 (6%)

Query: 56  AAHDDTELLAEIGYKQELN-RHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWG 114
           A   D E L      ++L+ RH  T+ V G   +  GL  +  S L     GG  SLV G
Sbjct: 128 ARDKDEETLLATDMNKDLSVRHLLTLAVGGAIGT--GLFVNSGSSLN---TGGPASLVIG 182

Query: 115 WLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKF 154
           W+I    + +V   + ELA+A P  GG          P F
Sbjct: 183 WVIVSTALFTVINSLGELAAAFPVVGGFSVYMDKFVDPSF 222

>Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {ON}
           YKL174C (REAL)
          Length = 619

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 75/374 (20%), Positives = 135/374 (36%), Gaps = 38/374 (10%)

Query: 58  HDDTELLAEIGYKQ-----ELNRHFSTIQVFGIAF----SIMGL-LPSIASILGMAFA-- 105
           HD  E L  I ++      E   HF+  QV   +     SI+GL L  ++ +LGM+ +  
Sbjct: 21  HDIFENLHTIVHEDDDQENEEAEHFNYDQVLDKSLLSRGSIVGLGLGLMSPVLGMSTSMA 80

Query: 106 -----GGAISLVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSF 160
                GG ++++ G+LISG  I      + E+ S  P    L       AP K K   S+
Sbjct: 81  IGLINGGPLTIMLGFLISGVCIWFSSLSLGEIVSKFPME--LHVGSAMLAPEKLKLACSW 138

Query: 161 LIGNSNSLALIACLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXX 220
             G    +       SI +  AQ  +S+++++        +   Y V     I       
Sbjct: 139 YTGWLMLIGNWTMSTSITFAGAQLTISLILMTNSNLISEAHLTFYTV-----IVFYLVVT 193

Query: 221 XXXXXXXKLQTFSIVSNXXXX---XXXXXXXXXGVSQSDDVTFNGGKFIFGNFEN-FGDW 276
                  K   F    N                 +       F   K+   +F+N    +
Sbjct: 194 IVGLVNLKFARFIETINKVCVYWIIYAIIFIDILLLIFHKGKFRSLKYALFHFDNSLSGY 253

Query: 277 ADGWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAI 336
              +   + GFQ   + +  F     +++E K   + +P G+  ++ +    G    I I
Sbjct: 254 KSAFLSFIIGFQQSNFTLQGFSMLPALADEVKVPERDIPRGMSNAVLLSAFSGVIFLIPI 313

Query: 337 VACMGSNISAILDTVYGQPLAQILYNALGKKWAMTFMTLIAFCQFIM-----GASTLTAI 391
           +  +  N     D ++       + N   K  A   ++       +      G  ++T  
Sbjct: 314 MLILPDN-----DLLFTNHKVLPIVNIFTKSTASVVLSFFLVLLILGNLLFSGIGSITTS 368

Query: 392 SRQIWAFARDDGLP 405
           SR +++F+RD  +P
Sbjct: 369 SRAVYSFSRDRAIP 382

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 43/103 (41%), Gaps = 6/103 (5%)

Query: 53  NAKAAHDDTELLAEIGYKQELN-RHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISL 111
           N  +  D  E +      Q+LN RH  T+ V G   +  GL  +  + L     GG  SL
Sbjct: 70  NPGSPDDIKEDIHTSNMNQDLNVRHLITLAVGGAIGT--GLFVNSGASLN---TGGPASL 124

Query: 112 VWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKF 154
           V GW I    + +V   + ELA+A P  GG          P F
Sbjct: 125 VIGWTIVSTALFTVINSLGELAAAYPVVGGFNVYMTRFVDPSF 167

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 51/107 (47%), Gaps = 11/107 (10%)

Query: 41  ITSKRAGEVNYINAKAAHDDTELLAE-----IGYKQELN-RHFSTIQVFGIAFSIMGLLP 94
           I +  +G    IN  +  +D+ +L++         ++LN RH  T+ V G   +  GL  
Sbjct: 56  IQTTSSGATKNINGTSNPNDSNMLSKEDIDGSNLNKDLNIRHLLTLAVGGAIGT--GLFV 113

Query: 95  SIASILGMAFAGGAISLVWGWLISGAFILSVGAGMAELASAIPTSGG 141
           +  + L     GG  SLV GW+I    + +V   + ELA+A P  GG
Sbjct: 114 NSGASLN---TGGPASLVIGWVIVSTALFTVINSLGELAAAYPVVGG 157

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 63/154 (40%), Gaps = 18/154 (11%)

Query: 2   SDSSSYVEKNQIKTSARELHPIVSANANGEVQQITSLRTITSKRAGEVNYINAKAAHDDT 61
           S + S V K +      ELHP+        V Q  +LRT+T+   G       +A + DT
Sbjct: 12  SPTISPVGKTEQDKYGYELHPL------DPVTQQVTLRTVTNVCDGLEEEDAEEAGYHDT 65

Query: 62  ELLAEIGYKQEL-NRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGA 120
            +      K+ L  RH   I + G   +  GL   IA+ L  A   G +  +  +L  G+
Sbjct: 66  RV------KRALKQRHIGMIALGGTIGT--GLFVGIATPLSNA---GPVGSLIAYLFMGS 114

Query: 121 FILSVGAGMAELASAIPTSGGLXXXXXXXAPPKF 154
            +  +   + E+A+ IP +  +         P F
Sbjct: 115 IVYFITQSLGEMATFIPVTSSITVFSKRFLSPAF 148

>Smik_11.55 Chr11 complement(105857..107716) [1860 bp, 619 aa] {ON}
           YKL174C (REAL)
          Length = 619

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 71/360 (19%), Positives = 128/360 (35%), Gaps = 37/360 (10%)

Query: 70  KQELNRHFSTIQVFGIAF----SIMGL-LPSIASILGMAFA-------GGAISLVWGWLI 117
             E   HF+  QV   +     SI+GL L  ++ +LGM  +       GG  +++ G+LI
Sbjct: 38  HNEEAEHFNYDQVLDKSLLSRSSIVGLGLGLMSPVLGMCTSMAIGLINGGPFTIMLGFLI 97

Query: 118 SGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLALIACLCSI 177
           SG  I      + E+ S  P    L       AP   K V S+  G    +       SI
Sbjct: 98  SGVCIWFSSLSLGEIVSKFPME--LHVGSAMLAPETLKLVCSWYTGWLMLIGNWTMSTSI 155

Query: 178 DYGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXXXXXXKLQTFSIVSN 237
            +  AQ  +S+++++        +   Y V     I              K   F  + N
Sbjct: 156 TFAGAQLTISLILMTNSDLISEAHLIFYTV-----IVFYLVVTAVGLVNLKFARFIEIIN 210

Query: 238 XXXXXXXXXXXXXGVSQSDDVTFNGGKF------IFGNFENFGDWADGWEFMVAGFQPCV 291
                               + F+ GKF      +F    N   +   +   + GFQ   
Sbjct: 211 KVCVYWIIYAIIFIDILL--LVFHKGKFRSLKYALFHFDNNLSGYKSAFISFIIGFQQSN 268

Query: 292 WVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTV 351
           + +  F     +++E K   + +P G+  ++ +    G    I I+  +  N     D +
Sbjct: 269 FTLQGFSMLPALADEVKVPERDIPRGMSNAVLLSAFSGVIFLIPIMIILPDN-----DLL 323

Query: 352 YGQPLAQILYNALGKKWAMTFMTLIAFCQFIM-----GASTLTAISRQIWAFARDDGLPF 406
           +       + N   K      ++       +      G  ++T  SR +++F+RD  +P+
Sbjct: 324 FTNHKVLPIVNIFTKSTDSVVLSFFLVLLILGNLLFSGIGSITTSSRAVYSFSRDQAIPY 383

>Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {ON}
           YKL174C (REAL)
          Length = 616

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 72/368 (19%), Positives = 136/368 (36%), Gaps = 35/368 (9%)

Query: 57  AHDDTELLAEIGYKQELNRHFSTIQVFGIAF----SIMGL-LPSIASILGMAFA------ 105
            H+D +      ++ E   HF+  QV   +     SI+GL L  ++ +LGM  +      
Sbjct: 31  VHEDDD------HENEEAEHFNYDQVLDKSLLSRSSIVGLGLGLMSPVLGMCTSMAIGLI 84

Query: 106 -GGAISLVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGN 164
            GG ++++ G+LISG         + E+ S  P    L       AP   K V S+  G 
Sbjct: 85  NGGPLTIMLGFLISGMCTWFSSLSLGEIVSKFPME--LHVGSAMLAPKNLKLVCSWYTGW 142

Query: 165 SNSLALIACLCSIDYGLAQEILSIVVISKDGDFEITNAKTYGVYAGCIIXXXXXXXXXX- 223
              +       SI +  AQ  +S+++++        +   Y V    ++           
Sbjct: 143 LMLIGNWTMSTSITFAGAQLTISLILMTNSDLISEAHLIFYTVIVFYLVVTVVGLVNLKF 202

Query: 224 ----XXXXKLQTFSIVSNXXXXXXXXXXXXXGVSQSDDVTFNGGKFIFGNFE-NFGDWAD 278
                   K+  + IV               G        F   K+   +F+ N   +  
Sbjct: 203 ARFIETINKVCVYWIVYAIIFIDILLLIFHKG-------KFRSLKYALFHFDNNLSGYKS 255

Query: 279 GWEFMVAGFQPCVWVIGAFDSCIHMSEEAKNATKAVPIGILTSISVCWIVGFFISIAIVA 338
            +   + GFQ   + +  F     +++E K   + +P G+  ++ +    G    I I+ 
Sbjct: 256 AFLSFIIGFQQSNFTLQGFSMLPALADEVKVPERDIPRGMSNAVLLSAFSGVIFLIPIML 315

Query: 339 CMGSNISAILDTVYGQPLAQILYNALGKKWAMTFMTLIAFCQFIM-GASTLTAISRQIWA 397
            +  N  A+       P+  I   +        F+ L+     +  G  ++T  SR +++
Sbjct: 316 ILPDN-DALFTNHKVLPIVNIFTKSTDSVVLSFFLVLLILGNLLFSGIGSITTSSRAVYS 374

Query: 398 FARDDGLP 405
           F+RD  +P
Sbjct: 375 FSRDHAIP 382

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score = 34.3 bits (77), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 60/153 (39%), Gaps = 17/153 (11%)

Query: 3   DSSSYVEKNQIKT-SARELHPIVSANANGEVQQITSLRTITSKRAGEVNYINAKAAHDDT 61
           DSS++V +   KT S   L    S+  N     ITS     S    +   IN      +T
Sbjct: 31  DSSAFVTEQTPKTDSGFPLSAKGSSGVNQTTNDITSSGRFHSDDDVQQEDIN------NT 84

Query: 62  ELLAEIGYKQELNRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAF 121
            L  E+       RH  T+ V G   +  GL  +  + L     GG  SLV  W+I    
Sbjct: 85  NLSKELSV-----RHLLTLAVGGAIGT--GLFVNTGAALS---TGGPASLVIDWVIISTC 134

Query: 122 ILSVGAGMAELASAIPTSGGLXXXXXXXAPPKF 154
           + +V   + EL++A P  GG          P F
Sbjct: 135 LFTVINSLGELSAAFPVVGGFNVYSMRFVEPSF 167

>AER412W Chr5 (1429639..1429935) [297 bp, 98 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL086W
          Length = 98

 Score = 31.6 bits (70), Expect = 1.2,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 20 LHPIVSANANGEVQQITSLRTITSKRAGEVNYINAKAAHDDTELLAEIG-YKQELNR 75
          +H I+S+N  G  Q IT LR   +    + N +  K+  D+ ELL E G  K+EL R
Sbjct: 18 VHSILSSNLEGIYQAITELRESQALLVMKFNQVK-KSFMDEQELLQEEGSLKEELAR 73

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 53/119 (44%), Gaps = 8/119 (6%)

Query: 27  NANGEVQQITSLRTITSKRAGEVNYINAKAAHDDTELLAEIGYKQELNRHFST--IQVFG 84
           N  GE +     + I S +  EV  ++      + E +A I     L  H  +  +Q+  
Sbjct: 45  NQTGEEKGSKWRQFIDSFKRVEVPELDPNLT--EQERIAIITAHTPLKHHLKSRHLQMIA 102

Query: 85  IAFSI-MGLLPSIASILGMAFAGGAISLVWGWLISGAFILSVGAGMAELASAIPTSGGL 142
           I  +I  GL     + L  A   G  SL+ GW I+G+ I S+   +AE+A   P SGG 
Sbjct: 103 IGGAIGTGLFVGSGTALRTA---GPASLIIGWSITGSMIYSMVMAVAEMAVLYPISGGF 158

>Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W
           (REAL)
          Length = 583

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 40/78 (51%), Gaps = 7/78 (8%)

Query: 64  LAEIGYKQELN-RHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFI 122
           LA   YK+ L+ RH + I + G   +  GL       LG + A G  SL+ G+L+ GA +
Sbjct: 64  LANQPYKKVLDQRHLTMIAIGGTLGT--GLFIG----LGESLASGPASLLIGFLLVGASM 117

Query: 123 LSVGAGMAELASAIPTSG 140
           L V    AEL+   P SG
Sbjct: 118 LCVVQCGAELSCQYPVSG 135

>YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}
           MMP1High-affinity S-methylmethionine permease, required
           for utilization of S-methylmethionine as a sulfur
           source; has similarity to S-adenosylmethionine permease
           Sam3p
          Length = 583

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 40/78 (51%), Gaps = 7/78 (8%)

Query: 64  LAEIGYKQELN-RHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFI 122
           LA   YK+ L+ RH + I + G   +  GL       LG + A G  SL+ G+L+ GA +
Sbjct: 64  LANQPYKKVLDQRHLTMIAIGGTLGT--GLFIG----LGESLASGPASLLIGFLLVGASM 117

Query: 123 LSVGAGMAELASAIPTSG 140
           L V    AEL+   P SG
Sbjct: 118 LCVVQCGAELSCQYPVSG 135

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 39/91 (42%), Gaps = 6/91 (6%)

Query: 53  NAKAAHDDTELLAEIGYKQEL-NRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISL 111
           N   A     + A+   K  L NRH   I + G   +  GLL    + L     GG  SL
Sbjct: 70  NLTEAEKVAFVTAQTPLKHHLKNRHLQMIAIGGAIGT--GLLVGSGTALR---TGGPASL 124

Query: 112 VWGWLISGAFILSVGAGMAELASAIPTSGGL 142
           + GW  +G  I S+   + ELA   P SGG 
Sbjct: 125 LIGWGSTGTMIYSMVMALGELAVIFPISGGF 155

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 23/49 (46%)

Query: 106 GGAISLVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKF 154
           GG  SLV GW+I    + +V   + ELA+A P  GG          P F
Sbjct: 121 GGPASLVIGWVIVSTCLFTVINSLGELAAAFPVVGGFNVYITRFIEPSF 169

>TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 58/137 (42%), Gaps = 20/137 (14%)

Query: 53  NAKAAHDDTEL-LAEIGYKQELN-RHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAIS 110
           N     + T+L LA   YK+ L+ RH + I + G   +  GL       LG A   G  +
Sbjct: 53  NDLTEREKTQLKLASQPYKKVLSQRHLTMISIGGTLGT--GLFIG----LGAALTSGPAA 106

Query: 111 LVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLA- 169
           L+ G+L+ GA +  V    +ELA   P +G               + + F +G + +LA 
Sbjct: 107 LLIGYLLVGASMFCVIQSASELACQFPVTGSYSSHVTRFV----DESVGFTVGTNYTLAW 162

Query: 170 -------LIACLCSIDY 179
                  LI C  +I Y
Sbjct: 163 LVLFPSELIGCSLTISY 179

>Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)
          Length = 583

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 40/78 (51%), Gaps = 7/78 (8%)

Query: 64  LAEIGYKQELN-RHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFI 122
           LA   YK+ L+ RH + I + G   +  GL       LG + A G  SL+ G+L+ GA +
Sbjct: 64  LANQPYKKVLSQRHLTMIAIGGTLGT--GLFIG----LGESLASGPASLLIGFLLVGASM 117

Query: 123 LSVGAGMAELASAIPTSG 140
           L V    AEL+   P SG
Sbjct: 118 LCVVQCGAELSCQYPVSG 135

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 5/72 (6%)

Query: 71  QELNRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFILSVGAGMA 130
           Q  NRH   I + G   +  GL     + L  A   G   ++ GW+I+G+ I  +   +A
Sbjct: 87  QLKNRHLQMISIGGAIGT--GLFVGSGTALRTA---GPAGILIGWIIAGSMIYCMVMSVA 141

Query: 131 ELASAIPTSGGL 142
           ELA A P +GG 
Sbjct: 142 ELAIAFPVAGGF 153

>TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa]
           {ON} 
          Length = 584

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 55/137 (40%), Gaps = 25/137 (18%)

Query: 58  HDDTEL------LAEIGYKQELN-RHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAIS 110
           HD TE       LA   Y++ L+ RH S I + G   +  GL       LG A   G  +
Sbjct: 53  HDLTEREKIQLRLANQPYQKVLHQRHLSMIAIGGTLGT--GLFIG----LGAALTSGPAA 106

Query: 111 LVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLA- 169
           L+ G+L+ G  +  V    AELA   P SG               + L F +  + +LA 
Sbjct: 107 LLIGYLLVGTSMFCVIQSAAELACQFPVSGSYASHVSRFV----DESLGFTVATNYTLAW 162

Query: 170 -------LIACLCSIDY 179
                  LI C  +I Y
Sbjct: 163 LVLFPSELIGCSLTISY 179

>TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 38/78 (48%), Gaps = 7/78 (8%)

Query: 64  LAEIGYKQELN-RHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFI 122
           LA   YK+ L+ RH + I + G   +  GL       LG + A G  SL+ G+LI G  +
Sbjct: 85  LAAQPYKKSLHQRHLTMIAIGGTLGT--GLFIG----LGYSLASGPASLLIGFLIVGTSM 138

Query: 123 LSVGAGMAELASAIPTSG 140
             V    AEL+   P SG
Sbjct: 139 FCVVQSAAELSCQYPVSG 156

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 35/80 (43%), Gaps = 5/80 (6%)

Query: 75  RHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFILSVGAGMAELAS 134
           RH  T+ V G   +  GL  +  + L     GG  SLV  W+I G  + +V   + EL++
Sbjct: 93  RHLLTLAVGGAIGT--GLYVNTGTALS---TGGPASLVIDWVIIGTCLFTVINSLGELSA 147

Query: 135 AIPTSGGLXXXXXXXAPPKF 154
           A P  GG          P F
Sbjct: 148 AFPVVGGFNVYGMRFVEPSF 167

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 39/91 (42%), Gaps = 6/91 (6%)

Query: 53  NAKAAHDDTELLAEIGYKQEL-NRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISL 111
           N   A     + A+   K  L NRH   I + G   +  GLL    + L     GG  SL
Sbjct: 70  NLSEAEKVAIITAQTPLKHHLKNRHLQMIAIGGAIGT--GLLVGSGTALR---TGGPASL 124

Query: 112 VWGWLISGAFILSVGAGMAELASAIPTSGGL 142
           + GW  +G  I ++   + ELA   P SGG 
Sbjct: 125 LIGWGSTGTMIYAMVMALGELAVIFPISGGF 155

>KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 599

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 73/187 (39%), Gaps = 20/187 (10%)

Query: 3   DSSSYVEKNQIKTSARELHPIVSANANGEVQQITSLRTITSKRAGEVNYINAK-AAHDDT 61
           D+ ++  ++     +R   P      +  + +IT     + +R   V Y +   +  D+ 
Sbjct: 18  DTKAWHGESSKTLGSRLTRPFQRKQMSSRMNRITQ----SFRRQDAVEYADVDLSMMDEQ 73

Query: 62  ELLAEIGYKQELNRHFSTIQVFGIAFSIMGLLPSIASI-LGMAFAGGAISLVWGWLISGA 120
           +    +   Q L +  S   +  IA  I G L +   I +G + + G  SL+ G+LI G 
Sbjct: 74  QRRNYVLANQPLQKTLSQRHLMMIA--IGGTLGTGLFIGIGYSLSSGPGSLLIGFLIVGL 131

Query: 121 FILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLA--------LIA 172
            +  V    AELA   P SG           P     + F +  + +LA        LI 
Sbjct: 132 MMFCVVQSAAELACQYPVSGSYAVHVSRFMEPS----IGFTVATNYALAWLISFPSELIG 187

Query: 173 CLCSIDY 179
           C  ++ Y
Sbjct: 188 CAMTLQY 194

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 59/113 (52%), Gaps = 12/113 (10%)

Query: 28  ANGEVQQITSLRTITS--KRAGEVNYINAKAAHDDTELLAEIGYKQELNRHFSTIQVFGI 85
           A G V+++ +L T  S  ++ GEV  ++ + A  ++    + G+KQ   RH   + +  I
Sbjct: 7   ATGFVKRVDTLDTGNSDTQQNGEVYELDFQEAIGESSQTLQRGFKQ---RH---VDMLAI 60

Query: 86  AFSI-MGLLPSIASILGMAFAGGAISLVWGWLISGAFILSVGAGMAELASAIP 137
           A +I  GL+    + L     GG  SL+  ++ +G+ ++ V   +AE+AS  P
Sbjct: 61  AGAIGTGLVIGTGTALKR---GGPGSLLIAFIFTGSLLIGVLMSLAEMASFAP 110

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 39/91 (42%), Gaps = 6/91 (6%)

Query: 53  NAKAAHDDTELLAEIGYKQEL-NRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISL 111
           N   A     + A+   K  L NRH   I + G   +  GLL    + L     GG  SL
Sbjct: 70  NLTEAEKVAIVTAQTPLKHHLKNRHLQMIAIGGAIGT--GLLVGSGTALR---TGGPASL 124

Query: 112 VWGWLISGAFILSVGAGMAELASAIPTSGGL 142
           + GW  +G  I ++   + ELA   P SGG 
Sbjct: 125 LIGWGSTGTMIYAMVMALGELAVIFPISGGF 155

>KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 588

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 54/122 (44%), Gaps = 11/122 (9%)

Query: 63  LLAEIGYKQELN-RHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAF 121
           LLA+  Y++ L+ RH + I + G   +  GL   I    G + A G  +L+ G+L++G  
Sbjct: 68  LLAKQPYQKNLSQRHLTMIAIGGTLGT--GLFIGI----GWSLASGPGNLLIGFLLTGLA 121

Query: 122 ILSVGAGMAELASAIPTSGGLXXXXXXXAPPK--FKKVLSFLIGNSNSLA--LIACLCSI 177
           I  V    AEL+   P SG           P   F    ++ +  S S    LI C  +I
Sbjct: 122 IFCVVQCAAELSCQYPVSGSFASHVSRFVDPSWGFTVTTNYCLAWSISFPSELIGCAMTI 181

Query: 178 DY 179
            Y
Sbjct: 182 GY 183

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 38/91 (41%), Gaps = 6/91 (6%)

Query: 53  NAKAAHDDTELLAEIGYKQEL-NRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISL 111
           N   A     + A+   K +L NRH   I + G   +  GLL      L     GG  SL
Sbjct: 69  NLTEAEKVAFITAQTPLKHQLKNRHLQMIAIGGAIGT--GLLVGSGKALR---TGGPASL 123

Query: 112 VWGWLISGAFILSVGAGMAELASAIPTSGGL 142
           + GW   G  I ++   + ELA   P SGG 
Sbjct: 124 LIGWGSMGTMIYAMVMALGELAVVFPISGGF 154

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 65/152 (42%), Gaps = 15/152 (9%)

Query: 3   DSSSYVEKNQIKTSARELHPIVSANANGEVQQITSLRTITSKRAGEVNYINAKAAHDDTE 62
           +S+++V +   KT +    P+ S ++ G + Q T+   ITS      N    +   ++T 
Sbjct: 31  ESTTFVTELTSKTDSA--FPLSSKDSPG-INQTTN--DITSSDRFRRNEDTEQEDINNTN 85

Query: 63  LLAEIGYKQELNRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFI 122
           L  ++       RH  T+ V G   +  GL  +  + L     GG  SLV  W+I    +
Sbjct: 86  LSKDLSV-----RHLLTLAVGGAIGT--GLYVNTGAALS---TGGPASLVIDWVIISTCL 135

Query: 123 LSVGAGMAELASAIPTSGGLXXXXXXXAPPKF 154
            +V   + EL++A P  GG          P F
Sbjct: 136 FTVINSLGELSAAFPVVGGFNVYSMRFIEPSF 167

>Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {ON}
           YPL274W (SAM3) - High affinity S-adenosylMethionine
           Permease [contig 184] FULL
          Length = 596

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 51/125 (40%), Gaps = 19/125 (15%)

Query: 64  LAEIGYKQELN-RHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFI 122
           LA   Y++ L+ RH   I + G   +  GL       LG + A G  SL+ G+LI G  +
Sbjct: 75  LANQPYEKSLSQRHLMMISIGGTLGT--GLFIG----LGFSLASGPGSLLIGFLIVGLMM 128

Query: 123 LSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLSFLIGNSNSLA--------LIACL 174
             V    AE+A   P SG           P     + F +  + +LA        LI C 
Sbjct: 129 FCVVQSAAEMACQYPVSGSFSTHVSRFMEPS----IGFTVSTNYALAWLISFPSELIGCA 184

Query: 175 CSIDY 179
            ++ Y
Sbjct: 185 ITLRY 189

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 23/49 (46%)

Query: 106 GGAISLVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKF 154
           GG  SL+ GW+I  + + +V   + ELA+  P  GG          P F
Sbjct: 111 GGPASLIIGWVIISSALFTVINALGELAATFPIVGGFNVYMTRFVDPSF 159

>TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.368
           YOL020W
          Length = 590

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 1/60 (1%)

Query: 101 GMAFA-GGAISLVWGWLISGAFILSVGAGMAELASAIPTSGGLXXXXXXXAPPKFKKVLS 159
           G A A GG ++LV GW I+G+ I+    G+ E+    P  G           P    V+S
Sbjct: 103 GQALANGGPLALVLGWSIAGSQIVGTIHGLGEITVRFPVVGAFANYQTRFLDPSLSFVIS 162

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 36/80 (45%), Gaps = 5/80 (6%)

Query: 75  RHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFILSVGAGMAELAS 134
           RH  T+ V G A  + GL  +  + L    +GG  SLV  W+I    + +V   + ELA+
Sbjct: 85  RHLLTLAVGG-AIGV-GLFVNSGAALA---SGGPASLVIDWVIISTCLFTVINSLGELAA 139

Query: 135 AIPTSGGLXXXXXXXAPPKF 154
           A P  GG          P F
Sbjct: 140 AFPVVGGFNVYITRFVDPSF 159

>CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON}
           similar to uniprot|Q03770 Saccharomyces cerevisiae
           YDR160w SSY1
          Length = 853

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 8/89 (8%)

Query: 55  KAAHDDTELLAEIGYKQELNRHFSTIQVFGIAFSIMGLLPSIASILGMAFA-GGAISLVW 113
           K  HD T        + +L R+     +  +A S   L   I    G AF+  G    + 
Sbjct: 263 KYLHDSTRR------RNQLQRNLKVRHIQMLAISAC-LSAGIFMTSGKAFSIAGPFGCLL 315

Query: 114 GWLISGAFILSVGAGMAELASAIPTSGGL 142
           G++I+G  +++     AELA+ IP S G 
Sbjct: 316 GFIITGTVVIATMMSFAELATLIPVSSGF 344

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 31/69 (44%), Gaps = 5/69 (7%)

Query: 74  NRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFILSVGAGMAELA 133
           NRH   I + G   +  GL     S L     GG  +++ GW + G  I SV   M ELA
Sbjct: 86  NRHLQMIAIGGAIGT--GLFVGSGSALR---TGGPAAVLIGWGLIGLMIYSVVMAMGELA 140

Query: 134 SAIPTSGGL 142
              P +GG 
Sbjct: 141 VTFPVAGGF 149

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 50/105 (47%), Gaps = 21/105 (20%)

Query: 52  INAKAAHDD----TELLAEIGYKQELN----------RHFSTIQVFGIAFSI-MGLLPSI 96
           +++K  H+     T+  + I ++ ++N          RH  T+ V G   SI +GL  + 
Sbjct: 45  LDSKVPHEKIQTTTDFASVISHEDDINNVNLNKNLSIRHLLTLAVGG---SIGVGLFVNS 101

Query: 97  ASILGMAFAGGAISLVWGWLISGAFILSVGAGMAELASAIPTSGG 141
            + L    +GG  SLV  W+I    + +V   + E+A+A P  GG
Sbjct: 102 GAALA---SGGPASLVIDWIIISTCLFTVINALGEMAAAFPVVGG 143

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 106 GGAISLVWGWLISGAFILSVGAGMAELASAIPTSGG 141
           GG  SLV GW+I    + +V   + ELA+A P  GG
Sbjct: 76  GGPASLVVGWVIISTCLFTVINSLGELAAAFPIVGG 111

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.135    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,197,055
Number of extensions: 1837454
Number of successful extensions: 4658
Number of sequences better than 10.0: 148
Number of HSP's gapped: 4660
Number of HSP's successfully gapped: 187
Length of query: 574
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 459
Effective length of database: 40,294,809
Effective search space: 18495317331
Effective search space used: 18495317331
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 68 (30.8 bits)