Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0D01188g8.849ON58158131030.0
Kwal_27.101998.849ON57256516970.0
KLTH0C03586g8.849ON57857816900.0
TDEL0B001808.849ON58256816860.0
ZYRO0C14850g8.849ON59454915760.0
NCAS0C003208.849ON60857515360.0
KAFR0L019508.849ON58858215030.0
NDAI0K003608.849ON62057514910.0
KLLA0C06226g8.849ON59256814650.0
YMR284W (YKU70)8.849ON60257014560.0
Suva_13.4748.849ON60255714400.0
Smik_13.5008.849ON60256114310.0
Skud_13.4578.849ON60256114080.0
TPHA0I003108.849ON60859213630.0
KNAG0M02650singletonON57456113191e-176
TBLA0B028908.849ON64861413161e-175
CAGL0I02662g8.849ON60657412721e-169
Kpol_1068.18.849ON51447412211e-162
AFR443CsingletonON57657811051e-144
Ecym_46208.849ON59755510241e-131
ABL117C8.849ON6025417114e-85
Kwal_14.24442.238ON28846696.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0D01188g
         (581 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0D01188g Chr4 complement(87783..89528) [1746 bp, 581 aa] {ON...  1199   0.0  
Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284...   658   0.0  
KLTH0C03586g Chr3 (311969..313705) [1737 bp, 578 aa] {ON} simila...   655   0.0  
TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849...   654   0.0  
ZYRO0C14850g Chr3 (1154196..1155980) [1785 bp, 594 aa] {ON} simi...   611   0.0  
NCAS0C00320 Chr3 complement(44190..46016) [1827 bp, 608 aa] {ON}...   596   0.0  
KAFR0L01950 Chr12 (368933..370699) [1767 bp, 588 aa] {ON} Anc_8....   583   0.0  
NDAI0K00360 Chr11 (76452..78314) [1863 bp, 620 aa] {ON} Anc_8.849     578   0.0  
KLLA0C06226g Chr3 (550683..552461) [1779 bp, 592 aa] {ON} simila...   568   0.0  
YMR284W Chr13 (838187..839995) [1809 bp, 602 aa] {ON}  YKU70Subu...   565   0.0  
Suva_13.474 Chr13 (820105..821913) [1809 bp, 602 aa] {ON} YMR284...   559   0.0  
Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284...   555   0.0  
Skud_13.457 Chr13 (811730..813538) [1809 bp, 602 aa] {ON} YMR284...   546   0.0  
TPHA0I00310 Chr9 (59576..61402) [1827 bp, 608 aa] {ON} Anc_8.849...   529   0.0  
KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {...   512   e-176
TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.8...   511   e-175
CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} simila...   494   e-169
Kpol_1068.1 s1068 complement(1..1542) [1542 bp, 514 aa] {ON} com...   474   e-162
AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}...   430   e-144
Ecym_4620 Chr4 complement(1213899..1215692) [1794 bp, 597 aa] {O...   399   e-131
ABL117C Chr2 complement(179060..180868) [1809 bp, 602 aa] {ON} S...   278   4e-85
Kwal_14.2444 s14 (760105..760971) [867 bp, 288 aa] {ON} YIL124W ...    31   6.6  

>SAKL0D01188g Chr4 complement(87783..89528) [1746 bp, 581 aa] {ON}
           similar to uniprot|P32807 Saccharomyces cerevisiae
           YMR284W YKU70 Forms heterodimer with Yku80p known as Ku
           binds chromosome ends and is involved in maintaining
           normal telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 581

 Score = 1199 bits (3103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/581 (100%), Positives = 581/581 (100%)

Query: 1   MGDSDRVDGSNYGDDQTVYKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAE 60
           MGDSDRVDGSNYGDDQTVYKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAE
Sbjct: 1   MGDSDRVDGSNYGDDQTVYKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAE 60

Query: 61  LMSQLIVTSPNTGVGCYFFQCNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRAT 120
           LMSQLIVTSPNTGVGCYFFQCNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRAT
Sbjct: 61  LMSQLIVTSPNTGVGCYFFQCNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRAT 120

Query: 121 LEEKFPFVPSLDVSLESVLVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRS 180
           LEEKFPFVPSLDVSLESVLVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRS
Sbjct: 121 LEEKFPFVPSLDVSLESVLVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRS 180

Query: 181 GLRKIVNDLNDCYINFTPFFIDTEEKPFDQSFYSDILKLRAKTDYVDGSEMFDGPNTTPI 240
           GLRKIVNDLNDCYINFTPFFIDTEEKPFDQSFYSDILKLRAKTDYVDGSEMFDGPNTTPI
Sbjct: 181 GLRKIVNDLNDCYINFTPFFIDTEEKPFDQSFYSDILKLRAKTDYVDGSEMFDGPNTTPI 240

Query: 241 PASYIKSRVSRKKETRRVKFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQL 300
           PASYIKSRVSRKKETRRVKFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQL
Sbjct: 241 PASYIKSRVSRKKETRRVKFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQL 300

Query: 301 RKEAFSHRRYLDASTGVDVSDKVAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGF 360
           RKEAFSHRRYLDASTGVDVSDKVAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGF
Sbjct: 301 RKEAFSHRRYLDASTGVDVSDKVAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGF 360

Query: 361 RSTDQCLFYYNNVDKTAFVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPG 420
           RSTDQCLFYYNNVDKTAFVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPG
Sbjct: 361 RSTDQCLFYYNNVDKTAFVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPG 420

Query: 421 IYLMTPSTENDPNEGFYLTRIPFIDEIRRFPSVPQYGDVLSSQDYGHMCQATETIIAYFN 480
           IYLMTPSTENDPNEGFYLTRIPFIDEIRRFPSVPQYGDVLSSQDYGHMCQATETIIAYFN
Sbjct: 421 IYLMTPSTENDPNEGFYLTRIPFIDEIRRFPSVPQYGDVLSSQDYGHMCQATETIIAYFN 480

Query: 481 LRNGYKPSEFKNPGLQHYFSLLHDQLLEAKEESSADEEQESLKDDTLLKLSQIRDKIIES 540
           LRNGYKPSEFKNPGLQHYFSLLHDQLLEAKEESSADEEQESLKDDTLLKLSQIRDKIIES
Sbjct: 481 LRNGYKPSEFKNPGLQHYFSLLHDQLLEAKEESSADEEQESLKDDTLLKLSQIRDKIIES 540

Query: 541 SKSDEPGRQRLSKYFKGWNTLYNKEYNQHLSFECGEKKTKR 581
           SKSDEPGRQRLSKYFKGWNTLYNKEYNQHLSFECGEKKTKR
Sbjct: 541 SKSDEPGRQRLSKYFKGWNTLYNKEYNQHLSFECGEKKTKR 581

>Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284W
           (YKU70) - DNA binding protein [contig 39] FULL
          Length = 572

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/565 (55%), Positives = 427/565 (75%), Gaps = 4/565 (0%)

Query: 19  YKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLIVTSPNTGVGCYF 78
           Y+K+EVH GI+FCIEL+  M+ K +++N K+QLVEILE+L ELMSQ+I++ P TG+GCYF
Sbjct: 10  YQKFEVHEGIIFCIELSKGMFEKSSDMN-KVQLVEILETLLELMSQVIISLPGTGIGCYF 68

Query: 79  FQCNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFPFVPSLDVSLESV 138
           F C  +N+  GIYE LPL DVNA++MKKLNDLL+D+     TLE++FP    L   LE+V
Sbjct: 69  FHCGHENATGGIYELLPLLDVNARSMKKLNDLLDDITAANTTLEKQFPLDEQLSTPLETV 128

Query: 139 LVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKIVNDLNDCYINFTP 198
            + L+EQF+ ++P +KAYNN K+FLFTDN  P    + ++R  LRK+V+DL+DC+INFT 
Sbjct: 129 FILLQEQFLNQVPGQKAYNNKKIFLFTDNDSPKEAHDSDTRLRLRKVVDDLDDCHINFTT 188

Query: 199 FFIDTEEKPFDQSFYSDILKLRAKTDYVDGSEMFDGPNTTPIPASYIKSRVSRKKETRRV 258
           FFI TE+KPFDQSFYSDILKL AK     G   F+GP+T PI A+ IK+R  RKKE +R+
Sbjct: 189 FFIGTEQKPFDQSFYSDILKLGAKKTASQGGSTFNGPSTAPINANLIKARALRKKEIKRI 248

Query: 259 KFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEAFSHRRYLDASTGVD 318
           +FQC L L++  +F +SIKGYT++SHE+ GT+YK VY++  LRKE  SHR+YL+A+TG D
Sbjct: 249 RFQCFLELNEATDFKVSIKGYTVVSHERTGTKYKQVYDHNGLRKEVISHRKYLNANTGED 308

Query: 319 VSDKVAKIFPYGDENIELSQEDMAKLDK-LDPNYNSFLKIIGFRSTDQCLFYYNNVDKTA 377
           V+D +A++F + + +IE S+E++AK+ K   PN +SFLK+IGFR T +CLF+Y+N+  ++
Sbjct: 309 VTDSIARVFRFAEIDIEFSEEELAKISKDYSPN-DSFLKLIGFRDTSKCLFFYDNIGNSS 367

Query: 378 FVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYLMTPSTENDPNEGFY 437
           FVVPDE   EGSI+ M+SL+R+L  K KSAVVWGKLK NSNP +Y+++PST  D NEGFY
Sbjct: 368 FVVPDESVLEGSIKTMSSLFRSLSKKQKSAVVWGKLKSNSNPAVYILSPSTSKDLNEGFY 427

Query: 438 LTRIPFIDEIRRFPSVPQYGDVLSSQDYGHMCQATETIIAYFNLRNGYKPSEFKNPGLQH 497
           LTR+PF+DE+R+FP +P+Y + L  +++  MC+ TET+I+YF+LR  YKPS+FKNP LQ 
Sbjct: 428 LTRVPFVDEVRKFPPIPRYDEELGGKNFEQMCKITETLISYFSLRRPYKPSDFKNPTLQK 487

Query: 498 YFSLLHDQLLEAKEESSADEEQESLK-DDTLLKLSQIRDKIIESSKSDEPGRQRLSKYFK 556
           +F LL+D LL+ + + S++    +LK DDTLLKL Q+R KI ES  S +P  +RL  Y K
Sbjct: 488 HFKLLYDYLLQVEVDCSSESVDGALKHDDTLLKLYQVRRKIQESLSSKDPEEERLGTYVK 547

Query: 557 GWNTLYNKEYNQHLSFECGEKKTKR 581
            WN+LYNK  NQ L+ + G KK K+
Sbjct: 548 AWNSLYNKISNQELTPDKGMKKQKK 572

>KLTH0C03586g Chr3 (311969..313705) [1737 bp, 578 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 578

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/578 (54%), Positives = 446/578 (77%), Gaps = 2/578 (0%)

Query: 5   DRVDGSNYGDDQTVYKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQ 64
           D   G+   D ++ YKK+EVH GI+FC+EL+  M+++  +LN K+QL+EILE+L ELM+Q
Sbjct: 2   DATVGNEGKDSESKYKKFEVHEGIIFCVELSEAMFKEPFDLN-KVQLLEILETLLELMTQ 60

Query: 65  LIVTSPNTGVGCYFFQCNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEK 124
           +I+  P TG+GC+FFQC+ + ++ GIYEFLPL DVNA++MKKLNDLL+DL+    TL E+
Sbjct: 61  VIIILPGTGIGCFFFQCSHEGAKGGIYEFLPLLDVNARSMKKLNDLLDDLKMNITTLNEQ 120

Query: 125 FPFVPSLDVSLESVLVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRK 184
           FPF    + SLE+V V L+EQF + +  +KAYNN K+FLFTDN +P   ++ E+++ LRK
Sbjct: 121 FPFNDKQNTSLEAVFVLLQEQFSRSVQGQKAYNNKKIFLFTDNDRPKESDDREAKNRLRK 180

Query: 185 IVNDLNDCYINFTPFFIDTEEKPFDQSFYSDILKLRAKTDYVDGSEMFDGPNTTPIPASY 244
           +++DL+D +IN  PFF+ +E++PFDQSFYSDILKL AK    DG   ++GPNTTPI A  
Sbjct: 181 VIDDLDDSFINIIPFFVGSEQRPFDQSFYSDILKLGAKKKASDGPFKYEGPNTTPISAKL 240

Query: 245 IKSRVSRKKETRRVKFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEA 304
           IKSRV RKKE +RV+FQC LIL++ ++F +SIKGYT ISHE+ G++YK VY+++ LRKEA
Sbjct: 241 IKSRVLRKKEIKRVRFQCSLILNEASDFQVSIKGYTTISHERAGSKYKQVYDHDGLRKEA 300

Query: 305 FSHRRYLDASTGVDVSDKVAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGFRSTD 364
            SHR+YLDA+TG DV+++V K+F + + +IELS++++AK+++   +Y+SFLK++GFR T+
Sbjct: 301 LSHRKYLDANTGEDVTERVVKVFKFAEVDIELSEDEIAKMNRDYSSYDSFLKLVGFRDTN 360

Query: 365 QCLFYYNNVDKTAFVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYLM 424
           +C+FY+NN+  ++FVVPD+  ++GSI+ MASL+R LR K KSAVVWGKLK NSNP +Y +
Sbjct: 361 RCVFYFNNISNSSFVVPDDSVFKGSIKTMASLFRKLREKQKSAVVWGKLKSNSNPSLYTL 420

Query: 425 TPSTENDPNEGFYLTRIPFIDEIRRFPSVPQYGDVLSSQDYGHMCQATETIIAYFNLRNG 484
           TPS  ND NEGFYLTR+PFIDEIR+FP    +G++  ++ +  MC+ TET+I+YF+LR+ 
Sbjct: 421 TPSNFNDHNEGFYLTRVPFIDEIRKFPPTAYHGNLSKTKTFEQMCKITETLISYFSLRHS 480

Query: 485 YKPSEFKNPGLQHYFSLLHDQLLEAK-EESSADEEQESLKDDTLLKLSQIRDKIIESSKS 543
           Y+PS+F+NP LQ +F LLHD LL+ + + +S  +E    KDDTLLKL Q+R KI+ES++S
Sbjct: 481 YRPSDFENPTLQKHFELLHDYLLQVEVDPTSGSKEHLLKKDDTLLKLHQVRAKILESAES 540

Query: 544 DEPGRQRLSKYFKGWNTLYNKEYNQHLSFECGEKKTKR 581
           D+P + RLS Y K WN++YN+E N  L  E   KK+K+
Sbjct: 541 DDPVQARLSNYVKAWNSMYNRELNGDLEPETTSKKSKK 578

>TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849
           YMR284W
          Length = 582

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/568 (54%), Positives = 427/568 (75%), Gaps = 8/568 (1%)

Query: 19  YKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLIVTSPNTGVGCYF 78
           Y++Y++H GI+FCIEL++ M+ ++ ELN+KIQL+EILE+L +LMSQL++T P+TG+GCYF
Sbjct: 16  YRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTGIGCYF 75

Query: 79  FQCNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFPFVPSLDVSLESV 138
           F CN+ +++ GIY FLPLKDVNA+ MKKL+DLLEDLQ++R TL +  P+  S    LES+
Sbjct: 76  FNCNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQFLPYDASKHTPLESL 135

Query: 139 LVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKIVNDLNDCYINFTP 198
           L  +RE+F+K++P++KA+NN K+F FTDN  P    +++++S LR +VNDL+D +INFT 
Sbjct: 136 LELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDLDDRFINFTT 195

Query: 199 FFIDTEEKPFDQSFYSDILKLRAKTDYVDGSEMFDGPNTTPIPASYIKSRVSRKKETRRV 258
           FFI     PFD+ FYSDIL+L A T     S+ FDGPNTTPI A+YIKSRV RK+E +R+
Sbjct: 196 FFIGKPGLPFDEGFYSDILRLGATTK---ASDEFDGPNTTPISAAYIKSRVLRKQEIKRI 252

Query: 259 KFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEAFSHRRYLDASTGVD 318
            FQCPLIL++++ F + +KGYTIISHEKPG RYKLVYENE +R+EAFS R+YL+A TG +
Sbjct: 253 MFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFSRRKYLNAKTGEE 312

Query: 319 VSDKVAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGFRSTDQCLFYYNNVDKTAF 378
           + D + K++PYGD +IELS+ D+A++        SFLK+IGF+ST+ CL YYNN++K  F
Sbjct: 313 IKDGLTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQSTETCLHYYNNIEKATF 372

Query: 379 VVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYLMTPSTENDPNEGFYL 438
           VVPDE  YEGSIR ++SL++NLR K K A+VWGKLK NSNP I+   PS E  PNEGFYL
Sbjct: 373 VVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVPSDEASPNEGFYL 432

Query: 439 TRIPFIDEIRRFPSVPQYGDVLSSQDYGHMCQATETIIAYFNLRNGYKPSEFKNPGLQHY 498
            R+PF+DE+RR P +      +   DY ++ +AT+ +I +FNL+NG++PSEFKNPGLQ +
Sbjct: 433 YRVPFLDELRRIPPMLISHGEIQDDDYENLKEATKKLINHFNLKNGFEPSEFKNPGLQKH 492

Query: 499 FSLLHDQLLEAKEESSAD--EEQESL---KDDTLLKLSQIRDKIIESSKSDEPGRQRLSK 553
           F +LHD LL+ +EE   D  E Q S    +DD+L ++SQIRDKI ES+ S +P +Q+LSK
Sbjct: 493 FKILHDYLLQIEEEPEKDDVEWQRSKLLEEDDSLRRISQIRDKIDESANSKDPNKQKLSK 552

Query: 554 YFKGWNTLYNKEYNQHLSFECGEKKTKR 581
           Y   WN+LY+K ++Q  +     K  K+
Sbjct: 553 YLAIWNSLYDKIFDQETAIADAPKTKKK 580

>ZYRO0C14850g Chr3 (1154196..1155980) [1785 bp, 594 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 594

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/549 (52%), Positives = 410/549 (74%), Gaps = 7/549 (1%)

Query: 19  YKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLIVTSPNTGVGCYF 78
           Y+KYEVH GI+FCIEL++ M+++++ELN+K+QLVEILE+L +LMSQL++  P TG+GCYF
Sbjct: 24  YRKYEVHEGIIFCIELSAGMFQELSELNYKVQLVEILETLEQLMSQLVIVRPGTGIGCYF 83

Query: 79  FQCNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFPFVPSLDVSLESV 138
           + CNKD++++ IYEF PL+D+NAK+MKKL+DLL+DL   R TL++  P+  S    L+ +
Sbjct: 84  YNCNKDDAKNHIYEFFPLRDINAKSMKKLSDLLDDLANDRITLQKFLPYDESERTPLDFL 143

Query: 139 LVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKIVNDLNDCYINFTP 198
             F++++F+KE+  +KA+NN KVFLFTDN  P   E+ E++S LR +V+D++D +INFT 
Sbjct: 144 YGFIQDEFLKEVEGQKAFNNKKVFLFTDNDSPPEAEDNETKSRLRHLVDDMDDHFINFTT 203

Query: 199 FFIDTEEKPFDQSFYSDILKLRAKTDYVDGSEMFDGPNTTPIPASYIKSRVSRKKETRRV 258
           FFI  EE PFD SFYSD+LKL A  +  D +  FDGPNTTPI ASYIKSRV RK+E +R+
Sbjct: 204 FFIGKEEAPFDDSFYSDVLKLGATAE--DPNTEFDGPNTTPISASYIKSRVLRKQEVKRI 261

Query: 259 KFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEAFSHRRYLDASTGVD 318
            FQC LIL++R  F + IKGYTII  E+PG RY+LVYE +++RKEA S R++LD++TG  
Sbjct: 262 MFQCCLILEERMQFMVGIKGYTIIIQERPGQRYRLVYEKDEVRKEANSKRKFLDSNTGEV 321

Query: 319 VSDKVAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGFRSTDQCLFYYNNVDKTAF 378
           + + + K+FPYGD +I ++ E++ ++ K      SFLKIIGFR  ++C+ Y+NN+D+  F
Sbjct: 322 IEEGLTKVFPYGDLDITITDEELNEVRKSYTEEESFLKIIGFRDYNKCIHYFNNIDRALF 381

Query: 379 VVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYLMTPSTENDPNEGFYL 438
           VVPDE+ +EGSIR +ASL++NLR KGK AVVWGKLK NS+P +++++PS   DPNEGFYL
Sbjct: 382 VVPDEFRFEGSIRTLASLFKNLRAKGKVAVVWGKLKTNSHPAVFVLSPSRNEDPNEGFYL 441

Query: 439 TRIPFIDEIRRFPSVPQYGDVLSSQDYGHMCQATETIIAYFNLRNGYKPSEFKNPGLQHY 498
            RIPF +E+RRFP      +   + +Y  +   T++II +F    GY+PSEF+NP LQ +
Sbjct: 442 YRIPFAEELRRFPQSLIRHNSYDTPEYNQLKDTTKSIIDHFQFAKGYRPSEFRNPDLQKH 501

Query: 499 FSLLHDQLLEAKEESSADEEQESLK-----DDTLLKLSQIRDKIIESSKSDEPGRQRLSK 553
           F +LHD LL+ ++E   D  + S +     DD+LLKL+QIRDKI++S++S +P + +L +
Sbjct: 502 FKILHDYLLQVEQEEEDDSPESSKQRLLSEDDSLLKLAQIRDKIMDSAQSSDPKKFQLDE 561

Query: 554 YFKGWNTLY 562
           YF+ WN LY
Sbjct: 562 YFQLWNRLY 570

>NCAS0C00320 Chr3 complement(44190..46016) [1827 bp, 608 aa] {ON}
           Anc_8.849
          Length = 608

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/575 (51%), Positives = 412/575 (71%), Gaps = 25/575 (4%)

Query: 15  DQTVYKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLIVTSPNTGV 74
           D   +KKY++H GI+FCIEL+ +M+ +V ELN+K+QL+EILESL ELMSQL++  P+TG+
Sbjct: 10  DHPSFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVIIRPSTGI 69

Query: 75  GCYFFQCNKDN--SEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFPFVPSLD 132
           GCYF  C++ N  S++GIYEF PL+DVNA++MKK++DL+EDL  KR TL E F F P+LD
Sbjct: 70  GCYFHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFNFDPTLD 129

Query: 133 ------VSLESVLVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKIV 186
                 V LE++  FL +QF K   +   Y++ K+FLFTDN  P+   + ++   +R+IV
Sbjct: 130 NDSQKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATLRIRRIV 189

Query: 187 NDLNDCYINFTPFFIDTEEKPFDQSFYSDILKLRAKTD-----YVDGS-----EMFDGPN 236
           +D+ND YINF  FFI  E KPF  SFYS+ILKL +K +       DG+       +DGPN
Sbjct: 190 DDMNDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSEYDGPN 249

Query: 237 TTPIPASYIKSRVSRKKETRRVKFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYE 296
           TTPIPASYIKS++ RKKE +R  FQCPLIL + NNF +S++GY I++ EKP TRYKLVYE
Sbjct: 250 TTPIPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATRYKLVYE 309

Query: 297 NEQLRKEAFSHRRYLDASTGVDVS-DKVAKIFPYGDENIELSQEDMAKLDKLDPNYNSFL 355
           +E +RKEA S R++L+ +TG ++  D++ K+FPYGD++IEL+ +++AK++     + SFL
Sbjct: 310 HENIRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKINDDYSKHESFL 369

Query: 356 KIIGFRSTDQCLFYYNNVDKTAFVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKI 415
           K+IGFRST   + Y+NN+DK  FVVPDE  YEG+I+ MASL+R L+ + K  +VWGK+K 
Sbjct: 370 KVIGFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIVWGKVKS 429

Query: 416 NSNPGIYLMTPSTENDPNEGFYLTRIPFIDEIRRFPSVPQYGDVLSSQDYGHMCQATETI 475
           NSN  +Y+++P+T  D NEGFYL RIPF+DEIR+FP +  Y  + +S+DY ++ + TE I
Sbjct: 430 NSNLRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSEDYLNLVRITENI 489

Query: 476 IAYFNLRNGYKPSEFKNPGLQHYFSLLHDQLLE----AKEESSADEEQESL--KDDTLLK 529
           I YFNL+ GY+PS+FKNP LQ ++  LHD LL+     +E+  +D +      +DDTL K
Sbjct: 490 IGYFNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKEDDTLNK 549

Query: 530 LSQIRDKIIESSKSDEPGRQRLSKYFKGWNTLYNK 564
           +  IR+KII S +SD+  +QRLSKY   WNT Y K
Sbjct: 550 ILHIREKIIASKESDDVTQQRLSKYVSLWNTFYIK 584

>KAFR0L01950 Chr12 (368933..370699) [1767 bp, 588 aa] {ON} Anc_8.849
           YMR284W
          Length = 588

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/582 (49%), Positives = 400/582 (68%), Gaps = 11/582 (1%)

Query: 7   VDGSNYGDDQTV-YKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQL 65
           VD     DDQ   YKK+E H  ++F +EL+  M+  V ELN KIQL+EILESL ELMSQL
Sbjct: 4   VDSEVNEDDQNASYKKFESHEAMIFSVELSDGMFETVPELN-KIQLIEILESLEELMSQL 62

Query: 66  IVTSPNTGVGCYFFQCNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKF 125
           IV  PN  +GCYF  C K+ +++GIYEF PL D+NAKNMKKL+DLLEDL+  R  L + F
Sbjct: 63  IVVRPNAAIGCYFHYCGKEGNDYGIYEFFPLSDINAKNMKKLSDLLEDLRLDRINLIDFF 122

Query: 126 PFVPSLDVSLESVLVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKI 185
            +  +   S+E +  F   QF  E+  ++ Y   ++FLFTDN  P   E+ E++S LRKI
Sbjct: 123 QYNNAKKTSMEKLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILRKI 182

Query: 186 VNDLNDCYINFTPFFIDTEEKPFDQSFYSDILKLRAKTDYVDGSEMFDGPNTTPIPASYI 245
           V+DL++ ++NF PFFI   + PF+ + YS+ILKL A+ D    S  +DGPNTTPI ASYI
Sbjct: 183 VDDLDESHVNFVPFFIGRPDAPFNSALYSEILKLGARKD---SSTEYDGPNTTPIQASYI 239

Query: 246 KSRVSRKKETRRVKFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEAF 305
           KS+V RK+E +RV F+CPLIL+++ NF + ++GY  +SHEK  TRYKLVYE E LR+EAF
Sbjct: 240 KSKVLRKREIKRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQEAF 299

Query: 306 SHRRYLDASTGVDVSDK-VAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGFRSTD 364
           S R++L + T  ++  K + KIF  GD +IE+ +    +++K D +  SFLK++GFRS  
Sbjct: 300 SRRKFLSSETAEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVGFRSIK 359

Query: 365 QCLFYYNNVDKTAFVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYLM 424
            C+ Y NN+DK  FVVPDE  Y  SI+ + SL++ LRTKGK+A++WGKLK NSNP ++++
Sbjct: 360 SCVKYINNIDKVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLFVL 419

Query: 425 TPSTENDPNEGFYLTRIPFIDEIRRFPSVPQYGDVLSSQDYGHMCQATETIIAYFNLRNG 484
            PS E DPNEGFYL R+PF+DEIR+ P++  Y    ++ DY ++ + TE I+AYFNL+ G
Sbjct: 420 EPSGEKDPNEGFYLHRVPFLDEIRKLPTMITYECGENTSDYENLIKVTEYIMAYFNLKGG 479

Query: 485 YKPSEFKNPGLQHYFSLLHDQLLE----AKEESSADEEQESLK-DDTLLKLSQIRDKIIE 539
           Y P + KNP +Q YF +LHD LL+      +ESS + +Q  L+ DDTL K+S IR+KII 
Sbjct: 480 YNPMDLKNPCIQKYFKILHDYLLQIEDKTSDESSTERKQRLLREDDTLRKVSHIREKIIS 539

Query: 540 SSKSDEPGRQRLSKYFKGWNTLYNKEYNQHLSFECGEKKTKR 581
           SS+S++ G Q+LSKY K WN  Y K   + +S E  + K ++
Sbjct: 540 SSRSEDAGAQKLSKYIKVWNNFYAKIEKESVSLEPSKTKKRK 581

>NDAI0K00360 Chr11 (76452..78314) [1863 bp, 620 aa] {ON} Anc_8.849
          Length = 620

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/575 (52%), Positives = 407/575 (70%), Gaps = 29/575 (5%)

Query: 19  YKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLIVTSPNTGVGCYF 78
           YKKY++H GI+FCIEL+  M+++V ELN+ +QL+EILESL ELMS L++  P+TGVGCY 
Sbjct: 25  YKKYDIHEGIIFCIELSKEMFQEVPELNYTVQLLEILESLLELMSHLVIIRPSTGVGCYI 84

Query: 79  FQCNKD-------NSEH--GIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFPFVP 129
             CNK        N++H  GIYE  PL+DVNA +MKKL+DL EDLQ +R TL + F F  
Sbjct: 85  HYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMKYFQFDN 144

Query: 130 SLD----VSLESVLVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKI 185
             +    V LE +  FL ++F     +R +Y++ K+FLFTDN  P   E  E++  +R++
Sbjct: 145 DENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDNDSPIESEEHEAKLRIRRL 204

Query: 186 VNDLNDCYINFTPFFIDTEEKPFDQSFYSDILKLRAKT------DYVDGSE----MFDGP 235
           V+D+ND YINFT FFI T ++PFD SFYSD+LKL AKT      DY+D  +     FDGP
Sbjct: 205 VDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSDQDYIDAVDDEYSEFDGP 264

Query: 236 NTTPIPASYIKSRVSRKKETRRVKFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVY 295
           NT PIPA YIKSR+ RKKE +R+ FQ PLIL++   F I I+GY + SHEKP TRYKLVY
Sbjct: 265 NTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRGYMLYSHEKPNTRYKLVY 324

Query: 296 ENEQLRKEAFSHRRYLDASTGVDV-SDKVAKIFPYGDENIELSQEDMAKLDKLDPNYNSF 354
           E E +RKEAFS R+YL+ +TG ++ +D+  KIFPYGD NIEL+ +++ K+++      +F
Sbjct: 325 EQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELNDKEVYKVEEEISCPEAF 384

Query: 355 LKIIGFRSTDQCLFYYNNVDKTAFVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLK 414
           LKIIGFRS +QCL+Y+NN+  T FVVPDE  YEGSIR MASL+R L+ K K A++WGK+K
Sbjct: 385 LKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAIIWGKMK 444

Query: 415 INSNPGIYLMTPSTENDPNEGFYLTRIPFIDEIRRFPSVPQYGDVLSSQDYGHMCQATET 474
            NS P +YL+ P++ +D NEGFYL R+PF++EIR+FP +  Y D  S+ DY ++ + T  
Sbjct: 445 TNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLLDYKDRSSNPDYTNLIKITSK 504

Query: 475 IIAYFNLRNGYKPSEFKNPGLQHYFSLLHDQLLEAKEESSADEEQESLK-----DDTLLK 529
           I+ YF+LRNGY PSEF+NP LQ ++ +LHD LL+ ++  +  +EQ  ++     DDTL K
Sbjct: 505 IVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAEGDEQHQIQKLLEEDDTLRK 564

Query: 530 LSQIRDKIIESSKSDEPGRQRLSKYFKGWNTLYNK 564
           +SQIRDKI+ S KSD+P +QRL KY   WNT Y K
Sbjct: 565 ISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVK 599

>KLLA0C06226g Chr3 (550683..552461) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 592

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/568 (48%), Positives = 398/568 (70%), Gaps = 9/568 (1%)

Query: 15  DQTVYKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLIVTSPNTGV 74
           D   +++YE H GIVFCI+LT TMY    +L  KIQL+EIL+SL +LMSQL+V  P+T V
Sbjct: 24  DHKKWRRYEAHDGIVFCIQLTPTMYLSNPDLGGKIQLLEILDSLNDLMSQLVVVMPSTAV 83

Query: 75  GCYFFQCNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFPFV-PSLDV 133
           GCY + C+  N+E  +YE +PL+DVN KNMK+++DLLED++  R  L+++ P   P+  +
Sbjct: 84  GCYIYNCSHPNAEDNVYELIPLRDVNYKNMKRVSDLLEDIEQDRILLKDEIPIADPNNPI 143

Query: 134 SLESVLVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKIVNDLNDCY 193
            L  VL+ +RE F++ +  +K   N K+F FTD+ KP  + N++SRS LRK+V+DL D Y
Sbjct: 144 ELSPVLIKVRETFLQPIEGQKQLTNKKIFFFTDDDKPAEFLNVDSRSRLRKVVDDLYDYY 203

Query: 194 INFTPFFIDTEEKPFDQSFYSDILKLRAKTDYVDGSEMFDGPNTTPIPASYIKSRVSRKK 253
           INF  FFI +E+KPFD S Y+DILK  +K +         GP+T PI ASYIKS+V R K
Sbjct: 204 INFVTFFIGSEDKPFDDSMYADILKWGSKINEAQSWLSSHGPSTNPINASYIKSKVKRTK 263

Query: 254 ETRRVKFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEAFSHRRYLDA 313
           E +R+KF+CPL+LD+R +  +S+ GYTI+SHE PG++YKLVY N  +R+EA+SHR YLDA
Sbjct: 264 EIKRIKFRCPLMLDERADLVVSVNGYTIVSHEIPGSKYKLVYANGSVRREAYSHREYLDA 323

Query: 314 STGVDVSD-KVAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGFRSTDQCLFYYNN 372
            TG  V + +++K++ +GDE IEL++++  K+      + SFLK+IGFRST+QCL YY+N
Sbjct: 324 ETGEAVDNSQLSKVYTFGDEIIELTEDENLKIQSGYSEHESFLKLIGFRSTEQCLHYYDN 383

Query: 373 VDKTAFVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYLMTPSTENDP 432
           +D  AFVVP+E  Y GSI+ +ASLYR +  K KSA+VWGKL+ NS P ++++TPS++ D 
Sbjct: 384 IDVPAFVVPNEEDYAGSIKTLASLYRTMLFKKKSAMVWGKLRPNSPPSMFVLTPSSKKDY 443

Query: 433 NEGFYLTRIPFIDEIRRFPSVPQYGDVLSSQDYGHMCQATETIIAYFNLRNGYKPSEFKN 492
           N+GFYL ++PF++E+R+ P    +  ++ S DY  M + TET+I +FNL+NGY+PS+F N
Sbjct: 444 NQGFYLYKVPFMEEVRKLPDFLNHSALIESDDYKVMSKVTETLINFFNLKNGYRPSDFHN 503

Query: 493 PGLQHYFSLLHDQLLEAKEESSADEEQESLKDDTLLKLSQIRDKIIESSKSDEPGRQRLS 552
           P LQ +F +L + LL+ + + S  E++    D+TL K+ QI  +I  S+KSD+  +QRL 
Sbjct: 504 PALQKHFKILREYLLQIEVDKSKPEDE---GDETLQKVKQIYARIASSAKSDDVKQQRLV 560

Query: 553 KYFKGWNTLYNKEYNQHLSFECGEKKTK 580
           KY K WN+ YN+  N     E   K TK
Sbjct: 561 KYLKLWNSFYNRLSN----LEVDTKPTK 584

>YMR284W Chr13 (838187..839995) [1809 bp, 602 aa] {ON}  YKU70Subunit
           of the telomeric Ku complex (Yku70p-Yku80p), involved in
           telomere length maintenance, structure and telomere
           position effect; relocates to sites of double-strand
           cleavage to promote nonhomologous end joining during DSB
           repair
          Length = 602

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/570 (48%), Positives = 403/570 (70%), Gaps = 11/570 (1%)

Query: 15  DQTVYKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLIVTSPNTGV 74
           D+T Y+K+++H GI+FCIEL+ TM+++ ++L +K  L+EILESL ELMSQL++T P T +
Sbjct: 19  DETGYRKFDIHEGILFCIELSETMFKESSDLEYKSPLLEILESLDELMSQLVITRPGTAI 78

Query: 75  GCYFFQCNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFPFVPS---L 131
           GCYF+ CN+++++ GIYE  PL+D+NA  MKKLNDLLEDL   R +L + F F  +    
Sbjct: 79  GCYFYYCNREDAKEGIYELFPLRDINATFMKKLNDLLEDLSSGRISLYDYFMFQQTGSEK 138

Query: 132 DVSLESVLVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKIVNDLND 191
            V L  +  F+ + F++E+P +K  +N +VFLFTD  KP   ++++ R+ LR++  DL D
Sbjct: 139 QVRLSVLFTFMLDTFLEEIPGQKQLSNKRVFLFTDIDKPQEAQDIDERARLRRLTIDLFD 198

Query: 192 CYINFTPFFIDTEEKPFDQSFYSDILKLRAKTDYVDGSEM-FDGPNTTPIPASYIKSRVS 250
             +NF  FFI   +KPFD  FYSDIL+L + T+   G +  FDGP+T PI A YIKSR+ 
Sbjct: 199 NKVNFATFFIGYADKPFDNEFYSDILQLGSHTNENTGLDSEFDGPSTKPIDAKYIKSRIL 258

Query: 251 RKKETRRVKFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEAFSHRRY 310
           RKKE +R+ FQCPLILD++ NF + +KGYT+ +HEK G RYKLVYE+E +R+EA+S R++
Sbjct: 259 RKKEVKRIMFQCPLILDEKTNFIVGVKGYTMYTHEKAGVRYKLVYEHEDIRQEAYSKRKF 318

Query: 311 LDASTGVDVSDKVAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGFRSTDQCLFYY 370
           L+  TG DV+ K  K++PYGD +I LS      + +     ++FLKIIGFRS+ + + Y+
Sbjct: 319 LNPITGEDVTGKTVKVYPYGDLDINLSDSQDQIVMEAYTQKDAFLKIIGFRSSSKSIHYF 378

Query: 371 NNVDKTAFVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYLMTPSTEN 430
           NN+DK++F+VPDE  YEGSIR +ASL + LR K K A++WGKLK NS+P +Y ++PS+  
Sbjct: 379 NNIDKSSFIVPDEAKYEGSIRTLASLLKILRKKDKIAILWGKLKSNSHPSLYTLSPSSVK 438

Query: 431 DPNEGFYLTRIPFIDEIRRFPSVPQYGDVLSSQ-DYGHMCQATETIIAYFNLRNGYKPSE 489
           D NEGFYL R+PF+DEIR+FPS+  Y D    + DY +M + T++I+ YFNLR+GY PS+
Sbjct: 439 DYNEGFYLYRVPFLDEIRKFPSLLSYDDGSEHKLDYDNMKKVTQSIMGYFNLRDGYNPSD 498

Query: 490 FKNPGLQHYFSLLHDQLLEAK------EESSADEEQESLKDDTLLKLSQIRDKIIESSKS 543
           FKNP LQ ++ +LHD LL+ +      E  +  +++   +DD+L KL  IR+KI+ES KS
Sbjct: 499 FKNPLLQKHYKVLHDYLLQIETTFDENETPNTKKDRMMREDDSLRKLYYIRNKILESEKS 558

Query: 544 DEPGRQRLSKYFKGWNTLYNKEYNQHLSFE 573
           ++P  QRL+KY K WN  Y K  + ++S +
Sbjct: 559 EDPIIQRLNKYVKIWNMFYKKFNDDNISIK 588

>Suva_13.474 Chr13 (820105..821913) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/557 (49%), Positives = 388/557 (69%), Gaps = 11/557 (1%)

Query: 19  YKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLIVTSPNTGVGCYF 78
           Y+K+++H GI+FCIEL+++M+++  ELN+K  L+EILESL ELMSQL++T P T +GCYF
Sbjct: 23  YRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQLVITRPGTSIGCYF 82

Query: 79  FQCNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFPFVPS---LDVSL 135
           + C +D+++ GIYE  PL+D+NAK MK LNDLLED+   R TL E F F  S   + + L
Sbjct: 83  YYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYFNFQHSEKQMQMPL 142

Query: 136 ESVLVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKIVNDLNDCYIN 195
             +  F+ + F++++P +K  ++ K+FLFTDN KP   ++ + R+ LR++  DL D  +N
Sbjct: 143 GKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERARLRRLTIDLFDNKVN 202

Query: 196 FTPFFIDTEEKPFDQSFYSDILKLRA-KTDYVDGSEMFDGPNTTPIPASYIKSRVSRKKE 254
           F  FFI      FD  FYSDIL+L + K   VD    FDGPNT PI A YIKS++ RKKE
Sbjct: 203 FATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEFDGPNTKPIDAKYIKSKILRKKE 262

Query: 255 TRRVKFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEAFSHRRYLDAS 314
            +R+ FQCPLI D+  NF I +KGYT+ SHEK G RYKLVYE+E +R+EA+S R++L+ +
Sbjct: 263 VKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHEDIRQEAYSKRKFLNPT 322

Query: 315 TGVDVSDKVAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGFRSTDQCLFYYNNVD 374
           TG DV+    K++PYGD +I LS++    + +     + FL+IIGFRS    + Y+NN++
Sbjct: 323 TGADVTGSTVKVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRIIGFRSPTSSIHYFNNIE 382

Query: 375 KTAFVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYLMTPSTENDPNE 434
           K+ F+VPDE  YEGSIR +ASL + LR K K A+VWGKLK NS+P +++++PS+  + NE
Sbjct: 383 KSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSHPSLFVLSPSSIEEYNE 442

Query: 435 GFYLTRIPFIDEIRRFPSVPQYGDVLSSQ-DYGHMCQATETIIAYFNLRNGYKPSEFKNP 493
           GFYL RIPF+DEIR+FPS+  Y      + +Y +M + +++I+ YFNLR+GY PS+FKNP
Sbjct: 443 GFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRISQSIMGYFNLRDGYNPSDFKNP 502

Query: 494 GLQHYFSLLHDQLL------EAKEESSADEEQESLKDDTLLKLSQIRDKIIESSKSDEPG 547
            LQ +F +LHD LL      E  E S A   +   +DD+L KL  IR+KI+ES KS++P 
Sbjct: 503 SLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDDSLRKLYHIRNKILESEKSEDPA 562

Query: 548 RQRLSKYFKGWNTLYNK 564
            QRL+KY K WNT YNK
Sbjct: 563 IQRLNKYVKIWNTFYNK 579

>Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/561 (49%), Positives = 394/561 (70%), Gaps = 11/561 (1%)

Query: 15  DQTVYKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLIVTSPNTGV 74
           D+  Y+K+++H GI+FC+EL+ TM+++ +EL++K  L+EILESL ELMSQL++T P T +
Sbjct: 19  DEPGYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNELMSQLVITRPGTAI 78

Query: 75  GCYFFQCNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFPFVPSLD-- 132
           GCYF+ C +D+++ GIYE  PL+D+N + MKKLNDLLEDL  +R TL E F F  + +  
Sbjct: 79  GCYFYYCYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSSERVTLYEYFNFQKTENQK 138

Query: 133 -VSLESVLVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKIVNDLND 191
            + L S+  F+ + F+++   +K  NN +VFLFTDN KP   +N + R+ LR++  DL D
Sbjct: 139 QMPLASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRARLRRLTVDLFD 198

Query: 192 CYINFTPFFIDTEEKPFDQSFYSDILKLRAKTDYVDG-SEMFDGPNTTPIPASYIKSRVS 250
             INFT FFI      FD  FYSDIL+L +  +   G +  FDGPNT PI A YIKSR+ 
Sbjct: 199 NKINFTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEFDGPNTKPIDAKYIKSRIL 258

Query: 251 RKKETRRVKFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEAFSHRRY 310
           RK+E +R+ FQC LI D++ +F I IKGYT+ SHEK G RYKLVYE+E +R+EA+S R++
Sbjct: 259 RKREVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVYEHEDIRQEAYSKRKF 318

Query: 311 LDASTGVDVSDKVAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGFRSTDQCLFYY 370
           L+  +G DV+D   K++PYGD +I LS+     + +     ++FLKI GFRS+   + Y+
Sbjct: 319 LNFMSGEDVTDNTVKVYPYGDLDINLSEHQDQIVMEAYTRKDAFLKITGFRSSSISMHYF 378

Query: 371 NNVDKTAFVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYLMTPSTEN 430
           NN++K++F+VPDE  YEGSIRA+ SL + LR K K A++WGKLK NS+P +++++PS   
Sbjct: 379 NNIEKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLKSNSHPSLFVLSPSNIK 438

Query: 431 DPNEGFYLTRIPFIDEIRRFPSVPQYGDVLSSQ-DYGHMCQATETIIAYFNLRNGYKPSE 489
           + NEGFYL R+PF+DEIR+FPS+  Y D    + DY +M + T++II YFNLR+GY PS+
Sbjct: 439 EYNEGFYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKVTQSIIGYFNLRDGYNPSD 498

Query: 490 FKNPGLQHYFSLLHDQLLEA----KEESSADEEQESL--KDDTLLKLSQIRDKIIESSKS 543
           FKNP LQ ++ +LHD LL+     +E  ++D + + +  +DD+L KL  IR+KI+ES KS
Sbjct: 499 FKNPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDDSLRKLYHIRNKILESEKS 558

Query: 544 DEPGRQRLSKYFKGWNTLYNK 564
           ++P  QRL+KY K WN  Y K
Sbjct: 559 EDPAIQRLNKYVKIWNMFYKK 579

>Skud_13.457 Chr13 (811730..813538) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/561 (47%), Positives = 391/561 (69%), Gaps = 11/561 (1%)

Query: 15  DQTVYKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLIVTSPNTGV 74
           D   Y+K+++H GI+FC+EL+ TM+++  EL++K  L+EILESL ELMSQL++T P T +
Sbjct: 19  DDAGYRKFDIHEGILFCVELSETMFKESQELDYKSPLLEILESLNELMSQLVITRPGTAI 78

Query: 75  GCYFFQCNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFPFVPS---L 131
           GCYF+ C++D+++ GI+EF PL+D+NA  MK+LNDLLEDL   R TL E F F P+    
Sbjct: 79  GCYFYYCSRDDAKQGIFEFSPLRDINATFMKRLNDLLEDLSSGRMTLYEYFNFQPTEKQR 138

Query: 132 DVSLESVLVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKIVNDLND 191
            + L  +  F+ + F++++P ++  ++ KVFLFTDN  P   ++ + R+ LR +  DL D
Sbjct: 139 QMPLGVLFTFMLDTFLQDIPGQRQLSSKKVFLFTDNDIPQEAQDTDDRARLRSLTIDLFD 198

Query: 192 CYINFTPFFIDTEEKPFDQSFYSDILKLRAKTDYVDG-SEMFDGPNTTPIPASYIKSRVS 250
             +NF+ FFI    K FD  FYSDIL+L + T+   G +  FDGPNT PI A YIKS++ 
Sbjct: 199 NKVNFSTFFIGYANKSFDNEFYSDILQLGSHTNKGVGLNSEFDGPNTKPINAKYIKSKIL 258

Query: 251 RKKETRRVKFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEAFSHRRY 310
           RKKE +R+ FQCPL+  +  +FT+ +KGYT+ SHEK G RYKLVYE+E +R+EAFS R++
Sbjct: 259 RKKEIKRIMFQCPLMFGENEDFTVGVKGYTMYSHEKAGVRYKLVYEHEDVRREAFSKRKF 318

Query: 311 LDASTGVDVSDKVAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGFRSTDQCLFYY 370
           L+  TG DV+    K++PYGD +I  S+     + +     ++FL+IIGFRS+ + + Y+
Sbjct: 319 LNPMTGEDVTSSTVKVYPYGDLDINFSENQNQIVMEAYTQKDAFLRIIGFRSSSKAIHYF 378

Query: 371 NNVDKTAFVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYLMTPSTEN 430
           NN++K+AF+VPDE  YEGS+R + SL++ LR K K A++WGKLK NS+  +++++PS+  
Sbjct: 379 NNIEKSAFIVPDEAKYEGSVRTLTSLFKTLRKKDKIAILWGKLKTNSHASLFVLSPSSIK 438

Query: 431 DPNEGFYLTRIPFIDEIRRFPSVPQYGDVLSSQ-DYGHMCQATETIIAYFNLRNGYKPSE 489
           + NEGFYL R+PF+DEIR+FPS+  Y +    + DY +M + T+ I+ YFNL++GY PS+
Sbjct: 439 EYNEGFYLYRVPFLDEIRKFPSLLSYDNGEKYKLDYENMKKITQNIMGYFNLKDGYNPSD 498

Query: 490 FKNPGLQHYFSLLHDQLLEAKEESSADEEQES------LKDDTLLKLSQIRDKIIESSKS 543
           F+NP LQ +F +LHD LL+ +     +E  ++       +DD+L KL  IR+KI++S KS
Sbjct: 499 FRNPSLQKHFKVLHDYLLQIETTPEGNETPDAKLNRIIHEDDSLRKLYHIRNKILDSEKS 558

Query: 544 DEPGRQRLSKYFKGWNTLYNK 564
           ++P  QRL+KY K WN  YNK
Sbjct: 559 EDPAIQRLNKYVKIWNVFYNK 579

>TPHA0I00310 Chr9 (59576..61402) [1827 bp, 608 aa] {ON} Anc_8.849
           YMR284W
          Length = 608

 Score =  529 bits (1363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/592 (47%), Positives = 395/592 (66%), Gaps = 25/592 (4%)

Query: 7   VDGSNYGDDQTVYKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLI 66
           +D S+  + +  Y+KYE H G +FCIEL+  M+ ++++LN+K+QL+E+LESL ELMSQL+
Sbjct: 23  IDYSSIDNPKASYRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLV 82

Query: 67  VTSPNTGVGCYFFQCNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFP 126
           +T P+TGVGC+FF C+   S+  IYEFLPL+D+N  +MKKL+DLL+D++ +R ++ + F 
Sbjct: 83  ITRPSTGVGCFFFNCDNKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFK 142

Query: 127 F--VPSLDVSLESVLVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRK 184
           F  +     SLES+ + ++++F   +P +K Y N KVFLFTDN KP    + E    LR+
Sbjct: 143 FDEINDKGNSLESLFLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRR 202

Query: 185 IVNDLNDCYINFTPFFIDTEEKP--FDQSFYSDILKLRAKTDYVDGSEMFDGPNTTPIPA 242
           + +D++D YI F  FFI+  +    FD SFYSDILKLR        S  FDGP+T PI  
Sbjct: 203 LFDDISDNYIQFVTFFINKIDSSDNFDDSFYSDILKLRNS-----NSIEFDGPSTKPISV 257

Query: 243 SYIKSRVSRKKETRRVKFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRK 302
           +YIK++V RKKE +R+ FQCPLIL+  ++F +++KGYTIISHEKPG+RYKLVYE+E +R+
Sbjct: 258 AYIKNKVLRKKEIKRIMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRR 317

Query: 303 EAFSHRRYLDASTGVDVS-DKVAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGFR 361
           EAFS R+ L+  TG  V+ D   KIF  G+ +I   + +  K +        FLK+IGFR
Sbjct: 318 EAFSKRKLLNGKTGTVVTKDDTEKIFQLGNFSINSFENEFEKGNDNPLPQEPFLKLIGFR 377

Query: 362 STDQCLFYYNNVDKTAFVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGI 421
           S +  L  +NN+ K  F+VPDE    GSIR ++S+YR +RTK ++A+VWGKLK NSNP I
Sbjct: 378 SPENSLHLFNNIGKALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNI 437

Query: 422 YLMTPS-TENDPNEGFYLTRIPFIDEIRRFPSVPQY-----GDVLSSQDYGHMCQATETI 475
           ++++PS    D NEGFYL ++PF+DEIR+ PS  QY      +++ ++DY ++ + T  I
Sbjct: 438 WILSPSDPTKDQNEGFYLYKVPFLDEIRKIPS--QYTHFPSDELIRNKDYENLKRVTRNI 495

Query: 476 IAYFNLRNGYKPSEFKNPGLQHYFSLLHDQLLEAKEESSADEEQESLK------DDTLLK 529
           + YFNL NGY P EFKNP LQ Y+ LLHD LL+ +     +  +E LK      DDT+ K
Sbjct: 496 LGYFNLTNGYSPLEFKNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQKILEEDDTIRK 555

Query: 530 LSQIRDKIIESSKSDEPGRQRLSKYFKGWNTLYNK-EYNQHLSFECGEKKTK 580
              IRDKII+S+ S E  +QRLS  F  WN +Y+K E N+    E   KK K
Sbjct: 556 TFSIRDKIIKSASSTESHKQRLSANFNIWNDIYSKLEGNEIAVKEMKPKKQK 607

>KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {ON}
           
          Length = 574

 Score =  512 bits (1319), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 269/561 (47%), Positives = 369/561 (65%), Gaps = 21/561 (3%)

Query: 7   VDGSNYGDDQTVYKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLI 66
           VDG  YG     YKKY+ H GI+FCIELT T++  V  L  +  L+EIL SL ELM QL+
Sbjct: 10  VDGE-YG-----YKKYDTHEGILFCIELTGTLFEPVESLQGRSNLLEILYSLKELMYQLV 63

Query: 67  VTSPNTGVGCYFFQCNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFP 126
           +  P + VGC F   + + +  G+YEFLPL+DVNAK+MK L+D LED++ KR  + + F 
Sbjct: 64  IVRPGSSVGCIFHYTDINGAVDGVYEFLPLRDVNAKDMKTLSDFLEDIEEKRINIFQYFK 123

Query: 127 FVPSLDVSLESVLVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKIV 186
           F  S  VSLE +   + E++ +E  + K + + + FLFTDN  P    + E+   + KIV
Sbjct: 124 FDGSKHVSLERLFQLIGEKYSEEREDGKKFTHKRAFLFTDNDAPPESNDTEATRRISKIV 183

Query: 187 NDLNDCYINFTPFFIDTEEKPFDQSFYSDILKLRAKTDYVDGSEMFDGPNTTPIPASYIK 246
           +DL++  ++FT FFI +EE PFD  FYS++LKL A+  + D    +DGP+  PI  S IK
Sbjct: 184 DDLDETAVSFTTFFIGSEEAPFDNRFYSNVLKLGAQLKHSD----YDGPSVRPITGSDIK 239

Query: 247 SRVSRKKETRRVKFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEAFS 306
           +R+ R KE +R  FQCPL L+  +NF I I+GY I++HEK GTRYKL YE E +R+EAFS
Sbjct: 240 ARILRGKEIKRTMFQCPLYLNKDSNFIIGIRGYAIVTHEKYGTRYKLTYEKEDIRQEAFS 299

Query: 307 HRRYLDASTGVDVSDK-VAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGFRSTDQ 365
            R+YL++ TG +V  K ++K+ PYGD NIELS E + ++         F+K++GFRSTD 
Sbjct: 300 KRKYLNSKTGEEVDPKDISKVIPYGDVNIELSAEALQQMRASYEEEGPFMKVLGFRSTDL 359

Query: 366 CLFYYNNVDKTAFVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYLMT 425
           C+ Y+NN+DK +F+VPDE  YEGSI+ +ASL+R LR+K KSA++WGK K NSN  +Y+M 
Sbjct: 360 CVKYFNNIDKPSFIVPDELQYEGSIKTLASLFRTLRSKNKSAIIWGKPKSNSNSALYIMV 419

Query: 426 PSTENDPNEGFYLTRIPFIDEIRRFPSVPQYGDVLSSQDYGHMCQATETIIAYFNLRNGY 485
           PS   D N+GFY+ RIPF+DE+R+ P   +  D   +Q    +   TETI+ YFNLR GY
Sbjct: 420 PSHREDRNDGFYMHRIPFLDELRKVPI--KMVDNDWTQLDNDLLTVTETILKYFNLRQGY 477

Query: 486 KPSEFKNPGLQHYFSLLHDQLLEAKE--ESSADEEQESL--KDDTLLKLSQIRDKIIESS 541
            PSEFKNPG+Q+Y+ +LHD +L+ +E      D  QE L  +DDTL K+S IR KI  S+
Sbjct: 478 IPSEFKNPGIQNYYKVLHDYILQVEEIKHEGWDFSQEELLRQDDTLKKISHIRGKIEASN 537

Query: 542 KSDEPGRQRLSKYFKGWNTLY 562
            SD    + LS Y   WN  Y
Sbjct: 538 DSD----KVLSGYMNMWNLFY 554

>TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.849
           YMR284W
          Length = 648

 Score =  511 bits (1316), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 280/614 (45%), Positives = 376/614 (61%), Gaps = 51/614 (8%)

Query: 2   GDSDRVDGSNYGDDQTVYKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAEL 61
            +S+ +   N       YKK+ +H GI+FC+EL+S M+  + EL  K QL+EILESL++L
Sbjct: 6   NNSNHLMDDNDASRNASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSDL 65

Query: 62  MSQLIVTSPNTGVGCYFFQCNKDNSEH---GIYEFLPLKDVNAKNMKKLNDLLEDLQFKR 118
             QLI++ PNT +G Y F    D+ E    GIYEF  L D+N K MKK+ DLLEDL   R
Sbjct: 66  FEQLIISRPNTAIGFYLFHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDR 125

Query: 119 ATLEEKFPFVPSLDVSLESVLVFLREQFIK--ELPNRKAYNNGKVFLFTDNGKPNGYENL 176
             LE+ F F  S    LE +   ++EQF+    L + K +N  KVFLFT+N KP   EN 
Sbjct: 126 KKLEDIFKFDNSRPTKLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENN 185

Query: 177 ESRSGLRKIVNDLNDCYINFTPFFIDTEEKPFDQSFYSDILKLRAKTD---------YVD 227
           E+R  LR++VNDLN+  I F+ FFI+  +  FD +FYSDILKL    D         Y D
Sbjct: 186 ETRKKLRRMVNDLNESEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYDD 245

Query: 228 GSE-----------------------------MFDGPNTTPIPASYIKSRVSRKKETRRV 258
             E                              F  PNT PI AS IK R+ RK+E RRV
Sbjct: 246 AGENGNHYLLINDLKDTSKSKTTDRKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRRV 305

Query: 259 KFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEAFSHRRYLDASTGVD 318
           +FQCPLILD+ +NF I I GY I S EKPGTRYKLVYE+E +RKEAFS R++LD +TG +
Sbjct: 306 RFQCPLILDEASNFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEE 365

Query: 319 VSDK-VAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGFRSTDQCLFYYNNVDKTA 377
           + D+   K++ YGD NIELS E    +         F+K++GFRS D  L YYNN+DK +
Sbjct: 366 LKDEDFQKVYKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKAS 425

Query: 378 FVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYLMTPSTENDPNEGFY 437
           FVVPDE +YEGSI+ MASL+R L  K K A+VWG      +P I++++PS EN+ NEG Y
Sbjct: 426 FVVPDESSYEGSIKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEHNEGLY 485

Query: 438 LTRIPFIDEIRRFPSVPQY--GDVLSSQDYGHMCQATETIIAYFNLRNGYKPSEFKNPGL 495
           L ++PF+DEIRRFP++  Y  G   +  +Y  M + TE I+   +LR GY+PS ++NP L
Sbjct: 486 LFQVPFLDEIRRFPALTSYSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSYRNPAL 545

Query: 496 QHYFSLLHDQLLEAKEESSADEEQESL-----KDDTLLKLSQIRDKIIESSKSDEPGRQR 550
           Q Y+ +LHD LL+ ++ S  D  QE L     +DDTL +L ++R +II+SS++ E   QR
Sbjct: 546 QKYYKILHDYLLQIEDTSLTDTPQEVLEREVYEDDTLYRLDKLRKRIIQSSQAPELYNQR 605

Query: 551 LSKYFKGWNTLYNK 564
           LSK+ + WN ++ K
Sbjct: 606 LSKFIEHWNRVFKK 619

>CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284w HDF1
           high-affinity DNA-binding protein
          Length = 606

 Score =  494 bits (1272), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 253/574 (44%), Positives = 378/574 (65%), Gaps = 19/574 (3%)

Query: 3   DSDRVDGSNYGDDQTVYKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELM 62
           DS + DG    + Q  +K++E+H GI+FCIEL+  M+    EL+ K Q+  IL SL+ELM
Sbjct: 17  DSGKEDGE--VNKQASFKRFEIHEGIMFCIELSEHMFEVQDELDGKSQIEVILTSLSELM 74

Query: 63  SQLIVTSPNTGVGCYFFQCNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLE 122
             LIVT P+T +GCYF+ C +++S+  I+EF+PL D+N + MKK+NDLLED+  +R T +
Sbjct: 75  ELLIVTRPSTAIGCYFYNCEREDSKESIFEFIPLVDLNVQWMKKVNDLLEDVSNQRITFK 134

Query: 123 EKFPF---------VPSLDVSLESVLVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGY 173
           E   +         +P L   LE +   + E F + +  +K +N+ KVFLFTDN  PN  
Sbjct: 135 EYLNYNIDQNKKLNIPIL---LEKLFSLILETFNRNIEGQKEFNSKKVFLFTDNDLPNVE 191

Query: 174 ENLESRSGLRKIVNDLNDCYINFTPFFIDTEEKPFDQSFYSDILKLRAKTDYVD-GSEMF 232
               S   L+ I+ D++D  INFT FFI  ++KPF+ +FYS +L  R   DY   GS+ +
Sbjct: 192 SQQRSIDVLKGILKDIDDNMINFTNFFISKKDKPFNPAFYSKVL--RNDRDYNSLGSQAY 249

Query: 233 DGPNTTPIPASYIKSRVSRKKETRRVKFQCPLILDDRNNFTISIKGYTIISHEKPGTRYK 292
            GP+T PI  + IK R+ ++KE RRV FQCPL+LD+  NF ISIKGY+I +HEK   RYK
Sbjct: 250 FGPSTKPIGVNDIKERIFQRKEIRRVVFQCPLVLDEGTNFVISIKGYSIFNHEKGSVRYK 309

Query: 293 LVYENEQLRKEAFSHRRYLDASTGVDVSDKVAKIFPYGDENIELSQEDMAKLDKLDPNYN 352
           LVYEN+++RKEAFS R++++  TG DVS +  KI PYG++ IE+  +++A    +  N +
Sbjct: 310 LVYENQEIRKEAFSKRKFINPKTGEDVSKQTVKIIPYGEKEIEMEDKNIANALNVYGNTS 369

Query: 353 SFLKIIGFRSTDQCLFYYNNVDKTAFVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGK 412
           + L +IGF + D  L +YNN+DKT F+ PDE   EGS  A ASL+R L+   K  VVWG 
Sbjct: 370 ASLTVIGFLNEDNSLVFYNNIDKTLFITPDENVIEGSFTAFASLFRTLKKLKKVGVVWGS 429

Query: 413 LKINSNPGIYLMTPSTENDPNEGFYLTRIPFIDEIRRFPSVPQYGDVLSSQDYGHMCQAT 472
            K NS+P +YL+ PS ++D N+GFYLT++PFIDEIR++P++         ++Y ++ + T
Sbjct: 430 TKSNSSPSLYLLWPSKDDDNNQGFYLTKVPFIDEIRKYPTLSNININEEWEEYKNVKELT 489

Query: 473 ETIIAYFNLRNGYKPSEFKNPGLQHYFSLLHDQLLEAK--EESSADEEQESLKDDTLLKL 530
           + II++FNL++GY   EF+NP L  ++ LLHD LL+ +  ++ +   ++   +DDTLLK+
Sbjct: 490 QGIISHFNLKSGYHAEEFRNPALNRHYKLLHDYLLQVEIPQDDNDIRDRYLREDDTLLKI 549

Query: 531 SQIRDKIIESSKSDEPGRQRLSKYFKGWNTLYNK 564
           ++IR++I++ +  D+  ++RLSKY + WN  Y K
Sbjct: 550 TKIRERIMKDTTIDDVEKRRLSKYLEVWNIYYRK 583

>Kpol_1068.1 s1068 complement(1..1542) [1542 bp, 514 aa] {ON}
           complement(1..1542) [1542 nt, 514 aa]
          Length = 514

 Score =  474 bits (1221), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 246/474 (51%), Positives = 344/474 (72%), Gaps = 4/474 (0%)

Query: 19  YKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLIVTSPNTGVGCYF 78
           Y+KY+VH GI+FC+EL+  M++++ ELN+K+QL+EILESL ELMSQL++T P TGVGCY 
Sbjct: 41  YRKYDVHEGIMFCVELSEQMFQQLPELNYKVQLLEILESLLELMSQLVITRPGTGVGCYI 100

Query: 79  FQCNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFPFVPSLDVSLESV 138
           + C+KDNS + I+ F+PL+DVN K MKK+NDLL+DL  +R TL + FP+  +    LES+
Sbjct: 101 YNCHKDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFPYDKTQRTPLESL 160

Query: 139 LVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKIVNDLNDCYINFTP 198
           L   +++ +K +   K +NN KVFLFTDN  P    +   ++ LR++ +D N+ +I F P
Sbjct: 161 LELTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASDKAGKARLRRLFDDNNENFITFVP 220

Query: 199 FFIDTEEKPFDQSFYSDILKLRAKTDYVDGSEM-FDGPNTTPIPASYIKSRVSRKKETRR 257
           FFI+ E KPFD SFYSDI KL    +     E+ FDGP+T PI ASYIKSRV RK+E +R
Sbjct: 221 FFINRENKPFDSSFYSDIFKLGNSENPSSDYEIEFDGPSTRPISASYIKSRVLRKQEIKR 280

Query: 258 VKFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEAFSHRRYLDASTGV 317
           V FQC LIL+   NFT++IKGY+I+S EK G+RYK+VYE+E +RKEAFS R+ L+  T  
Sbjct: 281 VLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILNCITAE 340

Query: 318 DVSDKVAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGFRSTDQCLFYYNNVDKTA 377
           +V + + K+FPYGD NIELS+ED+ K+ +       FLK++GFRS +  L YYNN+ K +
Sbjct: 341 EVKEGLTKVFPYGDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNNITKPS 400

Query: 378 FVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYLMTPSTENDPNEGFY 437
           FVVPDE   +GSIR +ASL+R +R K K AV+WGKLK NS+PG+++++ S  +DPNEGF+
Sbjct: 401 FVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDPNEGFF 460

Query: 438 LTRIPFIDEIRRFPSVPQYG---DVLSSQDYGHMCQATETIIAYFNLRNGYKPS 488
           L RIPF+DEIR+FP +       + +++ +Y ++ + TE I+ YFNL++GY PS
Sbjct: 461 LYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIKRTTENIVGYFNLKHGYIPS 514

>AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 576

 Score =  430 bits (1105), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 243/578 (42%), Positives = 364/578 (62%), Gaps = 20/578 (3%)

Query: 7   VDGSNYGDDQTVYKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLI 66
           +D +   +D   + +Y VH GIVFC+EL+  MY+   EL  K QL+EILE+L ELM QL+
Sbjct: 13  LDSTADKEDDKRHLRYNVHEGIVFCVELSHNMYKPSPELEGKKQLLEILEALLELMEQLV 72

Query: 67  VTSPNTGVGCYFFQCNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFP 126
              P+TGVGCYFFQC    ++ GIYE  PL+DVN  +MKK+  LLE ++  + +LEE+ P
Sbjct: 73  AVMPDTGVGCYFFQCRHREAKQGIYELFPLRDVNVAHMKKVFLLLEGIRTGKRSLEEELP 132

Query: 127 FVPSLDVSLESVLVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKIV 186
           +      SL+ V   +++QF++E+P ++ YNN K+FLFTDN  P   E+L SR+ LRK+V
Sbjct: 133 YDGRHPTSLDVVFTSIQDQFLQEVPEQRLYNNKKIFLFTDNDSPPEKESLGSRTRLRKVV 192

Query: 187 NDLNDCYINFTPFFIDTEEKPFDQSFYSDILKLRAKTDYVDGSE--MFDGPNTTPIPASY 244
           +DLND YINF+ FFI TE++PFD+SFYSDILKL A+    +GS   ++DGP+T PI  SY
Sbjct: 193 DDLNDYYINFSTFFIGTEQRPFDESFYSDILKLGAQVA-AEGSSKPLYDGPSTKPISVSY 251

Query: 245 IKSRVSRKKETRRVKFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEA 304
           I+SRV RKKE RR+++ CPL L++     +S+KGY   ++E+PG RY++VY++E +++EA
Sbjct: 252 IRSRVLRKKEVRRLRYSCPLFLNEEQGLVVSVKGYAATTYERPGARYRMVYQHEDVQREA 311

Query: 305 FSHRRYLDASTGVDVSDKVAKIFPYGDENIELSQEDMAKLDKL-DPNYNSFLKIIGFRST 363
           FSHRRYLD  TG + ++ + K++  GD+ ++L  +    +     P  +SFL+++G R+ 
Sbjct: 312 FSHRRYLDPDTGEEATEDLCKVYQIGDDCLDLPDDLENLITNFAAPTSDSFLRMLGSRTA 371

Query: 364 DQCLFYYNNVDKTAFVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYL 423
              L YYNN+    F+VPD+  Y GS   +ASL+R LR   ++ V++GKL+  S P +Y 
Sbjct: 372 VAVLPYYNNIHHVTFLVPDDSVYAGSAAVLASLHRTLRASQRAVVLYGKLRATSLPALYA 431

Query: 424 MTPSTENDPNEGFYLTRIPFIDEIRRFPSVPQYGDVLSSQDYGHMCQATETIIAYFNLRN 483
           + P+    P+  F L R+PF +E+R+FP++      L+S DY  + + T  II    L +
Sbjct: 432 LAPAAAPLPDAVFILARLPFQEEVRKFPALSPPQASLASPDYAVLQKITSRIIDLLVLSS 491

Query: 484 GYKPSEFKNPGLQHYFSLLHDQLLEAKEESSADEEQESLKDDTLLKLSQIRDKIIESSKS 543
            Y P++FKNP +  +F LL D L E          Q+   DDT+ +L +     +     
Sbjct: 492 PYAPADFKNPVIATHFRLLSDHLFETA--------QDPRTDDTIARLLR-----LRHRVL 538

Query: 544 DEPGRQRLSKYFKGWNTLYNKEYNQHLSFECGEKKTKR 581
           D+P   RL+KY + WN  Y +  +Q ++     K +KR
Sbjct: 539 DDP-ESRLAKYLRHWNAFYAR--HQQVASPSPTKYSKR 573

>Ecym_4620 Chr4 complement(1213899..1215692) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABL117C
          Length = 597

 Score =  399 bits (1024), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 210/555 (37%), Positives = 340/555 (61%), Gaps = 10/555 (1%)

Query: 21  KYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLIVTSPNTGVGCYFFQ 80
           K+E    I+ CIEL+S +Y+  +E++ K QL E+LE+L ELM QL +  PN+ V CY +Q
Sbjct: 17  KHERRQSIIVCIELSSRVYQS-SEISPKAQLAEMLEALLELMKQLAMLLPNSEVCCYVYQ 75

Query: 81  CNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFPFVPSLDVSLESVLV 140
           C + N + GIYE LPL+ VN + + K++ LL D++ K+  L+++ PF       L SVL 
Sbjct: 76  CRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEIDGSPLSSVLA 135

Query: 141 FLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKIVNDLNDCYINFTPFF 200
            ++ Q   +  +   + N ++ L T N  P  Y + E +   +  +N L D   +   FF
Sbjct: 136 KIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDSFSIVTFF 195

Query: 201 IDTEEKPFDQSFYSDILK-LRAKTDYVDGSEMFDGPNTTPIPASYIKSRVSRKKETRRVK 259
           I ++ +PF+ +FY+D+LK LR   D     + +DGPNT PI    +K ++ +KKE  +  
Sbjct: 196 IHSQTRPFNDTFYADLLKPLRRPEDLDKNIQYYDGPNTKPIEIKELKGKLLQKKEGNKFH 255

Query: 260 FQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEAFSHRRYLDASTGVDV 319
           F+C  I++ +N+F IS+KG+  I+ EK G R+K +Y+     ++AFSHR++ +A+ G   
Sbjct: 256 FKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDAFSHRKFYNANDGEAA 315

Query: 320 SDKVAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGFRSTDQCLFYYNNVDKTAFV 379
             ++ K+F  G  NIE ++E   K+      + +FL++IGFRS D+  FYYNN+  +++V
Sbjct: 316 DSRLTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVDKVNFYYNNISTSSYV 375

Query: 380 VPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYLMTPSTENDPNEGFYLT 439
           +PD+  YEGS + ++ LY ++  KGK+A+VWGKL   ++P ++LM      + N+GFYL 
Sbjct: 376 IPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLMVAMDRKNTNQGFYLV 435

Query: 440 RIPFIDEIRRFPSVPQYGDVLSSQDYGHMCQATETIIAYFNLRNGYKPSEFKNPGLQHYF 499
           R+PFI+EIRRFP   Q    ++ Q+Y  M + T  IIA+FNL++ Y+ +EF +P L+ ++
Sbjct: 436 RLPFIEEIRRFPQTLQKNRSVNIQEYALMKKITGNIIAFFNLKSSYRAAEFPSPVLKSFY 495

Query: 500 SLLHDQLLEAKEESSADEEQESLK---DDTLLKLSQIRDKIIESSKSDEPGRQRLSKYFK 556
           + L D+LL   ++S +D+     K   D TL K+  +R+ I +SS++ E  +  L+KY K
Sbjct: 496 TTLSDKLL---QKSLSDQWGMGFKLSNDITLGKVQHLRELINKSSQNME--QPILAKYMK 550

Query: 557 GWNTLYNKEYNQHLS 571
            WNT YNKE N  ++
Sbjct: 551 YWNTYYNKEGNNSIT 565

>ABL117C Chr2 complement(179060..180868) [1809 bp, 602 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 602

 Score =  278 bits (711), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 162/541 (29%), Positives = 297/541 (54%), Gaps = 25/541 (4%)

Query: 28  IVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLIVTSPNTGVGCYFFQCNKDNSE 87
           IV CIEL+ T+      L     ++E++ +L  ++ +LI+  PN+ VGC  F+ N   +E
Sbjct: 30  IVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCLTFR-NGRRAE 88

Query: 88  HGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFPFVPSLDVSLESVLVFLREQFI 147
            GI E  PL+ ++A  ++ ++D + DL+ +   + + FPF  ++  SL+ +L      F 
Sbjct: 89  DGIVEAFPLRPLDANYVRNISDCVADLE-ETGMVGQHFPFTATVPASLDVMLAASDRYFT 147

Query: 148 KELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKIVNDLNDCYINFTPFFIDTEEKP 207
           ++  N     + ++FL TD   P  + +      ++  +  L    I+ T FF+ TE   
Sbjct: 148 EDTQN----ADNRIFLVTDVDTPVEFTDPIRLEKVQARLLSLYRRRIDITTFFLHTEHAA 203

Query: 208 FDQSFYSDILKLRAKTDYVDGSEMFDGPNTTPIPASYIKSRVSRKKETRRVKFQCPLILD 267
           F+ S Y++ILK R     + G+      +T+P+    ++ ++  +K+  R  F CPL+++
Sbjct: 204 FNDSSYAEILKTREWG--IPGAPQ----STSPLSICKLREKMLSQKDLNRAYFSCPLVIN 257

Query: 268 DRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEAFSHRRY--LDASTGVDVSDKVAK 325
              +  +S+ GY   +HE+PGTRYK + +++   K     R+Y  +D    +  +D+ + 
Sbjct: 258 KTADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKSVHQCRKYKTVDNEKYIRDADR-SS 316

Query: 326 IFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGFRSTDQCLFYYNNVDKTAFVVPDEYT 385
           ++  G   IE++  ++ K+ +    Y SFL+I+GFR+ +    YY+N+ +  +++P E  
Sbjct: 317 VYWIGGAGIEVTDAELRKMTRGCSKYESFLEILGFRAINTAAPYYSNIGRAYYILPRELP 376

Query: 386 YEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYLMTPSTENDPNEGFYLTRIPFID 445
           + GS + +ASL R++  KGK+A+VWG+LK   +P ++ + PS  +       L RIPFI+
Sbjct: 377 FSGSAKVLASLNRSMFEKGKAAIVWGQLKAGFHPTLFALIPS--DGETCALRLVRIPFIE 434

Query: 446 EIRRFPSVPQYGDVLSSQDYGHMCQATETIIAYFNLRNGYKPSEFKNPGLQHYFSLL-HD 504
           E+R FP++     +  +++Y  +   ++ +I +F+LR  Y+PS+ +NP L++++S L H+
Sbjct: 435 EVRCFPTLDGEDRLFHTREYELVKTVSQNLIRHFSLRTSYRPSDIRNPLLRNFYSTLYHE 494

Query: 505 QLLEAKEESSADEEQESL--KDDTLLKLSQIRDKIIESSKSDEPGRQRLSKYFKGWNTLY 562
           Q  +AK +     E + L   D TL K+  +RD+I  S   DEP    +S+Y   WN  Y
Sbjct: 495 QSQDAKRKMP---ELQYLPESDSTLHKVQLVRDRIENSIIHDEP--PIISEYINCWNIYY 549

Query: 563 N 563
           N
Sbjct: 550 N 550

>Kwal_14.2444 s14 (760105..760971) [867 bp, 288 aa] {ON} YIL124W
           (AYR1) - 1-Acyl dihydroxyacetone phosphate reductase
           [contig 224] FULL
          Length = 288

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 28/46 (60%), Gaps = 6/46 (13%)

Query: 120 TLEEKFP--FVP-SLDVSLESVLVFLREQFIKELPNRK---AYNNG 159
           TL ++FP   VP  LDVS    ++ LRE+  KELP++K    YNN 
Sbjct: 43  TLAKEFPELVVPVKLDVSEPEQIIHLRERLAKELPSQKLDVLYNNA 88

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 68,839,089
Number of extensions: 3346921
Number of successful extensions: 12368
Number of sequences better than 10.0: 43
Number of HSP's gapped: 12711
Number of HSP's successfully gapped: 43
Length of query: 581
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 466
Effective length of database: 40,294,809
Effective search space: 18777380994
Effective search space used: 18777380994
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)