Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0D01144g8.851ON84844134e-54
Kwal_27.102098.851ON84843433e-43
NDAI0E002508.851ON93833416e-43
ZYRO0C14894g8.851ON84843354e-42
NCAS0B002608.851ON88833338e-42
AFR450C8.851ON84843294e-41
Ecym_46248.851ON84843285e-41
TDEL0B002008.851ON86833261e-40
Suva_13.4768.851ON83833232e-40
Skud_13.4598.851ON83833191e-39
YMR286W (MRPL33)8.851ON86833182e-39
KLTH0C03630g8.851ON84843102e-38
KLLA0C06270g8.851ON84843102e-38
KAFR0A028708.851ON85843016e-37
TPHA0I003308.851ON88833001e-36
Kpol_237.28.851ON86843001e-36
CAGL0I02706g8.851ON89832955e-36
KNAG0G034808.851ON84812931e-35
Smik_13.5028.851ON84832912e-35
TBLA0B029108.851ON85832886e-35
KLTH0D14938g4.274ON101434680.32
Kwal_14.803na 1ON69360631.3
ZYRO0G00836gna 2ON70234612.4
Kwal_23.41244.274ON101333594.4
NDAI0E045207.220ON63832577.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0D01144g
         (84 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0D01144g Chr4 complement(85723..85977) [255 bp, 84 aa] {ON} ...   163   4e-54
Kwal_27.10209 s27 (241628..241882) [255 bp, 84 aa] {ON} YMR286W ...   136   3e-43
NDAI0E00250 Chr5 complement(29470..29751) [282 bp, 93 aa] {ON} A...   135   6e-43
ZYRO0C14894g Chr3 (1157672..1157926) [255 bp, 84 aa] {ON} highly...   133   4e-42
NCAS0B00260 Chr2 complement(27274..27540) [267 bp, 88 aa] {ON} A...   132   8e-42
AFR450C Chr6 complement(1248240..1248494) [255 bp, 84 aa] {ON} S...   131   4e-41
Ecym_4624 Chr4 (1221125..1221379) [255 bp, 84 aa] {ON} similar t...   130   5e-41
TDEL0B00200 Chr2 (38779..39039) [261 bp, 86 aa] {ON} Anc_8.851 Y...   130   1e-40
Suva_13.476 Chr13 (823880..824128) [249 bp, 83 aa] {ON} YMR286W ...   129   2e-40
Skud_13.459 Chr13 (815502..815750) [249 bp, 83 aa] {ON} YMR286W ...   127   1e-39
YMR286W Chr13 (841942..842202) [261 bp, 86 aa] {ON}  MRPL33Mitoc...   127   2e-39
KLTH0C03630g Chr3 (315520..315774) [255 bp, 84 aa] {ON} similar ...   124   2e-38
KLLA0C06270g Chr3 (554658..554912) [255 bp, 84 aa] {ON} highly s...   124   2e-38
KAFR0A02870 Chr1 (598363..598620) [258 bp, 85 aa] {ON} Anc_8.851...   120   6e-37
TPHA0I00330 Chr9 (63570..63836) [267 bp, 88 aa] {ON} Anc_8.851 Y...   120   1e-36
Kpol_237.2 s237 (2310..2570) [261 bp, 86 aa] {ON} (2310..2570) [...   120   1e-36
CAGL0I02706g Chr9 (241613..241882) [270 bp, 89 aa] {ON} highly s...   118   5e-36
KNAG0G03480 Chr7 (745051..745305) [255 bp, 84 aa] {ON} Anc_8.851...   117   1e-35
Smik_13.502 Chr13 (824481..824732) [252 bp, 84 aa] {ON} YMR286W ...   116   2e-35
TBLA0B02910 Chr2 (670926..671183) [258 bp, 85 aa] {ON} Anc_8.851...   115   6e-35
KLTH0D14938g Chr4 (1220665..1223709) [3045 bp, 1014 aa] {ON} sim...    31   0.32 
Kwal_14.803 s14 (54544..56625) [2082 bp, 693 aa] {ON} YHL016C (D...    29   1.3  
ZYRO0G00836g Chr7 complement(65269..67377) [2109 bp, 702 aa] {ON...    28   2.4  
Kwal_23.4124 s23 complement(582149..585190) [3042 bp, 1013 aa] {...    27   4.4  
NDAI0E04520 Chr5 complement(1012409..1014325) [1917 bp, 638 aa] ...    27   7.6  

>SAKL0D01144g Chr4 complement(85723..85977) [255 bp, 84 aa] {ON}
          highly similar to uniprot|P20084 Saccharomyces
          cerevisiae YMR286W MRPL33 Mitochondrial ribosomal
          protein of the large subunit
          Length = 84

 Score =  163 bits (413), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 84/84 (100%), Positives = 84/84 (100%)

Query: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60
          MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE
Sbjct: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60

Query: 61 KALSKEEQRELRKSNPGFVVEKRL 84
          KALSKEEQRELRKSNPGFVVEKRL
Sbjct: 61 KALSKEEQRELRKSNPGFVVEKRL 84

>Kwal_27.10209 s27 (241628..241882) [255 bp, 84 aa] {ON} YMR286W
          (MRPL33) - Mitochondrial ribosomal protein MRPL33
          (YmL33) (E. coli L30) [contig 39] FULL
          Length = 84

 Score =  136 bits (343), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 66/84 (78%), Positives = 75/84 (89%)

Query: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60
          MVFYKITL RSTIGLPKA K +V SLGLGK GS VYR+V+PSIAGSI KIKE+V ++V E
Sbjct: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60

Query: 61 KALSKEEQRELRKSNPGFVVEKRL 84
          +ALSKE+QRELRKSNPGF+VEKRL
Sbjct: 61 QALSKEQQRELRKSNPGFIVEKRL 84

>NDAI0E00250 Chr5 complement(29470..29751) [282 bp, 93 aa] {ON}
          Anc_8.851 YMR286W
          Length = 93

 Score =  135 bits (341), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 63/83 (75%), Positives = 76/83 (91%)

Query: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60
          MVFYKITL RS IGLPK T++IVK++GLGKRGS VYRRVTP++AGS+ K+KEL+D+E+TE
Sbjct: 1  MVFYKITLQRSLIGLPKQTRTIVKTIGLGKRGSIVYRRVTPAMAGSLAKVKELIDVEITE 60

Query: 61 KALSKEEQRELRKSNPGFVVEKR 83
          KAL+K EQRELRKSNPGF +EKR
Sbjct: 61 KALNKMEQRELRKSNPGFTIEKR 83

>ZYRO0C14894g Chr3 (1157672..1157926) [255 bp, 84 aa] {ON} highly
          similar to uniprot|P20084 Saccharomyces cerevisiae
          YMR286W
          Length = 84

 Score =  133 bits (335), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 61/84 (72%), Positives = 75/84 (89%)

Query: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60
          MVFYK+TL+RS IG+P   +++VKSLGLGKRGSTVYRRVTP  AGS+ K+KELV++EVT+
Sbjct: 1  MVFYKVTLSRSLIGVPHTVRNVVKSLGLGKRGSTVYRRVTPQCAGSLAKVKELVNVEVTQ 60

Query: 61 KALSKEEQRELRKSNPGFVVEKRL 84
           AL+KE+QRELRKSNPGF VEKR+
Sbjct: 61 HALTKEQQRELRKSNPGFTVEKRV 84

>NCAS0B00260 Chr2 complement(27274..27540) [267 bp, 88 aa] {ON}
          Anc_8.851 YMR286W
          Length = 88

 Score =  132 bits (333), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 77/83 (92%)

Query: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60
          MV+YKITLARS IGLP+AT+ IVK+LGLGKRGS +YR+VTP+IAGS+ K+KE++D+EVT+
Sbjct: 1  MVYYKITLARSVIGLPQATRDIVKTLGLGKRGSVIYRQVTPAIAGSMIKVKEIIDVEVTK 60

Query: 61 KALSKEEQRELRKSNPGFVVEKR 83
           +L+K EQR+LRKSNPGFVVEKR
Sbjct: 61 DSLNKFEQRQLRKSNPGFVVEKR 83

>AFR450C Chr6 complement(1248240..1248494) [255 bp, 84 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR286W
          (MRPL33)
          Length = 84

 Score =  131 bits (329), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 72/84 (85%)

Query: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60
          MVFYKITLARSTIGLP   K +V SLGLGKRG+TVYR+V+P  AGSI KIKELV +EVTE
Sbjct: 1  MVFYKITLARSTIGLPDKVKGVVHSLGLGKRGTTVYRKVSPGSAGSIAKIKELVKVEVTE 60

Query: 61 KALSKEEQRELRKSNPGFVVEKRL 84
           AL+KEEQR LRKSNPGF VEKR+
Sbjct: 61 HALTKEEQRMLRKSNPGFTVEKRV 84

>Ecym_4624 Chr4 (1221125..1221379) [255 bp, 84 aa] {ON} similar to
          Ashbya gossypii AFR450C
          Length = 84

 Score =  130 bits (328), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 75/84 (89%)

Query: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60
          MVFYKI L+RSTIG+P  T+++VKSLGLGKRGS VY  V+P++AG+I K+KELV++EVT+
Sbjct: 1  MVFYKIVLSRSTIGMPAKTRAVVKSLGLGKRGSVVYHSVSPTVAGAIAKVKELVNVEVTD 60

Query: 61 KALSKEEQRELRKSNPGFVVEKRL 84
          KALSKEEQR+LR SNPG+ VEKRL
Sbjct: 61 KALSKEEQRQLRTSNPGYTVEKRL 84

>TDEL0B00200 Chr2 (38779..39039) [261 bp, 86 aa] {ON} Anc_8.851
          YMR286W
          Length = 86

 Score =  130 bits (326), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 63/83 (75%), Positives = 71/83 (85%)

Query: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60
          M FYKITLARS IG P  TKSIVKSLGLGK GS VY++VTP+ AG++ K+KELV +EVTE
Sbjct: 1  MAFYKITLARSVIGTPHTTKSIVKSLGLGKTGSIVYKQVTPACAGALAKVKELVKVEVTE 60

Query: 61 KALSKEEQRELRKSNPGFVVEKR 83
            LSKEEQRELRKSNPGF+VEKR
Sbjct: 61 NKLSKEEQRELRKSNPGFIVEKR 83

>Suva_13.476 Chr13 (823880..824128) [249 bp, 83 aa] {ON} YMR286W
          (REAL)
          Length = 83

 Score =  129 bits (323), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 62/83 (74%), Positives = 72/83 (86%)

Query: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60
          MVFYKITL+RS IG+P  TKS+VKSLGLGKRGS VY+RV P+IAGS+ K+KELV +EVTE
Sbjct: 1  MVFYKITLSRSLIGMPHTTKSVVKSLGLGKRGSIVYKRVNPAIAGSLAKVKELVTVEVTE 60

Query: 61 KALSKEEQRELRKSNPGFVVEKR 83
            L+  +QRELRKSNPGFVVEKR
Sbjct: 61 HELTPYQQRELRKSNPGFVVEKR 83

>Skud_13.459 Chr13 (815502..815750) [249 bp, 83 aa] {ON} YMR286W
          (REAL)
          Length = 83

 Score =  127 bits (319), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 70/83 (84%)

Query: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60
          MVFYKITL RS IG+P  TKSIVKSLGLGKRGS  Y+RV P+IAGS+ K+KEL+ +EVTE
Sbjct: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60

Query: 61 KALSKEEQRELRKSNPGFVVEKR 83
            L+  +QRELRKSNPGFVVEKR
Sbjct: 61 HELTSTQQRELRKSNPGFVVEKR 83

>YMR286W Chr13 (841942..842202) [261 bp, 86 aa] {ON}
          MRPL33Mitochondrial ribosomal protein of the large
          subunit
          Length = 86

 Score =  127 bits (318), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (86%)

Query: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60
          MVFYK+TL+RS IG+P  TKSIVKSLGLGKRGS VY++V P+IAGS+ K+KELV +EVTE
Sbjct: 1  MVFYKVTLSRSLIGVPHTTKSIVKSLGLGKRGSIVYKKVNPAIAGSLAKVKELVKVEVTE 60

Query: 61 KALSKEEQRELRKSNPGFVVEKR 83
            L+  +QRELRKSNPGF+VEKR
Sbjct: 61 HELTPSQQRELRKSNPGFIVEKR 83

>KLTH0C03630g Chr3 (315520..315774) [255 bp, 84 aa] {ON} similar
          to uniprot|P20084 Saccharomyces cerevisiae YMR286W
          MRPL33 Mitochondrial ribosomal protein of the large
          subunit
          Length = 84

 Score =  124 bits (310), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 68/84 (80%), Positives = 77/84 (91%)

Query: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60
          MVFYKITL+RSTIGLPKATKS+V SLGLGK GS VYR+VTPSIAGSI K+KE+V +EVTE
Sbjct: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAKVKEVVRVEVTE 60

Query: 61 KALSKEEQRELRKSNPGFVVEKRL 84
           AL+KE+QRELRKSNPGF VEKR+
Sbjct: 61 HALTKEQQRELRKSNPGFTVEKRV 84

>KLLA0C06270g Chr3 (554658..554912) [255 bp, 84 aa] {ON} highly
          similar to uniprot|P20084 Saccharomyces cerevisiae
          YMR286W MRPL33 Mitochondrial ribosomal protein of the
          large subunit
          Length = 84

 Score =  124 bits (310), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 71/84 (84%)

Query: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60
          MVFY+ITL RS IG P+ T+++VKSLGLGKRGS  Y+  TPSIAG++ +IKELV +E+ +
Sbjct: 1  MVFYRITLQRSVIGTPQKTRAVVKSLGLGKRGSVAYQPATPSIAGAVAQIKELVSVELAD 60

Query: 61 KALSKEEQRELRKSNPGFVVEKRL 84
          KALSK EQRELRKSNPGF VEKR+
Sbjct: 61 KALSKAEQRELRKSNPGFTVEKRV 84

>KAFR0A02870 Chr1 (598363..598620) [258 bp, 85 aa] {ON} Anc_8.851
          YMR286W
          Length = 85

 Score =  120 bits (301), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 74/84 (88%)

Query: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60
          MV+Y+ TL RS IGLPK T++IVK+LG  KRGST+YR+VTP+I GS+ K+KEL+ L++TE
Sbjct: 1  MVYYRATLVRSLIGLPKTTRTIVKTLGFTKRGSTIYRKVTPAITGSLLKVKELISLKLTE 60

Query: 61 KALSKEEQRELRKSNPGFVVEKRL 84
          K+++K EQRE+RKSNPG++VEKR+
Sbjct: 61 KSVTKAEQREIRKSNPGYIVEKRI 84

>TPHA0I00330 Chr9 (63570..63836) [267 bp, 88 aa] {ON} Anc_8.851
          YMR286W
          Length = 88

 Score =  120 bits (300), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 69/83 (83%)

Query: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60
          MVFYKITLARS IG P   K++VK++GLGKRGS VYR  TP++AG++  +KE+V +EVTE
Sbjct: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60

Query: 61 KALSKEEQRELRKSNPGFVVEKR 83
            LSKE+QRELRKSNPGF V+KR
Sbjct: 61 NQLSKEQQRELRKSNPGFTVQKR 83

>Kpol_237.2 s237 (2310..2570) [261 bp, 86 aa] {ON} (2310..2570)
          [261 nt, 87 aa]
          Length = 86

 Score =  120 bits (300), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 57/84 (67%), Positives = 71/84 (84%)

Query: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60
          M FYKITL RS IGLP+AT++IVK++GLGKRGS VYR VTPSIAGS+ K+KELV +E+++
Sbjct: 1  MAFYKITLTRSLIGLPQATRNIVKTIGLGKRGSIVYREVTPSIAGSLAKVKELVSVELSD 60

Query: 61 KALSKEEQRELRKSNPGFVVEKRL 84
          K L++EE    RKSNPGF VEKR+
Sbjct: 61 KMLTREEVNASRKSNPGFTVEKRV 84

>CAGL0I02706g Chr9 (241613..241882) [270 bp, 89 aa] {ON} highly
          similar to uniprot|P20084 Saccharomyces cerevisiae
          YMR286w MRPL33
          Length = 89

 Score =  118 bits (295), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 73/83 (87%)

Query: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60
          M +YK+TL RS IG P+AT++IVK++GLGKRGS VYR+V+PS+AGS+ KIKEL+ ++VT+
Sbjct: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60

Query: 61 KALSKEEQRELRKSNPGFVVEKR 83
            L+K++QRELRK+NPGF VEK+
Sbjct: 61 SRLTKQQQRELRKTNPGFTVEKQ 83

>KNAG0G03480 Chr7 (745051..745305) [255 bp, 84 aa] {ON} Anc_8.851
          YMR286W
          Length = 84

 Score =  117 bits (293), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 55/81 (67%), Positives = 70/81 (86%)

Query: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60
          MVFYK+TLARS IG+P+AT+ IVK+LGLGKRGSTVY+R TP+IAGS+ K+KEL+ +EV+ 
Sbjct: 1  MVFYKVTLARSLIGMPRATRQIVKTLGLGKRGSTVYKRATPAIAGSLLKVKELITVEVSP 60

Query: 61 KALSKEEQRELRKSNPGFVVE 81
          + +SK E R  RKSNPG+VVE
Sbjct: 61 QKVSKGEMRLARKSNPGYVVE 81

>Smik_13.502 Chr13 (824481..824732) [252 bp, 84 aa] {ON} YMR286W
          (REAL)
          Length = 84

 Score =  116 bits (291), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 57/83 (68%), Positives = 67/83 (80%)

Query: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60
          M FYKI L RS IG+P  TKSIVKSLGLGKRGS VY+RV P+IAGS+ K+KELV ++VT+
Sbjct: 1  MAFYKIALKRSLIGVPHTTKSIVKSLGLGKRGSIVYKRVNPAIAGSLAKVKELVTVKVTK 60

Query: 61 KALSKEEQRELRKSNPGFVVEKR 83
            L+  +QR LR SNPGFVVEKR
Sbjct: 61 HELTPSQQRVLRMSNPGFVVEKR 83

>TBLA0B02910 Chr2 (670926..671183) [258 bp, 85 aa] {ON} Anc_8.851
          YMR286W
          Length = 85

 Score =  115 bits (288), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 52/83 (62%), Positives = 72/83 (86%)

Query: 2  VFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTEK 61
          +FYKITL RS IGLP+ ++SIVKSLGLGKRGS  Y++++PS AG+I ++KELVD+E+T+K
Sbjct: 1  MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDK 60

Query: 62 ALSKEEQRELRKSNPGFVVEKRL 84
          AL+K E  + R+SNPGF++EKR+
Sbjct: 61 ALTKAEVHDSRRSNPGFIIEKRV 83

>KLTH0D14938g Chr4 (1220665..1223709) [3045 bp, 1014 aa] {ON}
           similar to uniprot|Q07468 Saccharomyces cerevisiae
           YDL077C VAM6 Protein involved in vacuolar morphogenesis
          Length = 1014

 Score = 30.8 bits (68), Expect = 0.32,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 19/34 (55%)

Query: 35  VYRRVTPSIAGSITKIKELVDLEVTEKALSKEEQ 68
           VY +  PS+ G  T++K   D E  EK L K ++
Sbjct: 590 VYLKFNPSMVGPFTRVKNSCDFETVEKQLLKHKR 623

>Kwal_14.803 s14 (54544..56625) [2082 bp, 693 aa] {ON} YHL016C
           (DUR3) - Urea transporter [contig 245] FULL
          Length = 693

 Score = 28.9 bits (63), Expect = 1.3,   Method: Composition-based stats.
 Identities = 13/60 (21%), Positives = 29/60 (48%)

Query: 11  STIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTEKALSKEEQRE 70
           S  GLP   K+++ +  LG    T+Y  VT +++  +  +  ++  ++ +  +    Q E
Sbjct: 341 SGFGLPYTLKALLGNKSLGALLLTIYLAVTSTVSAQMIAVSSIISFDIFKAYIRPSAQNE 400

>ZYRO0G00836g Chr7 complement(65269..67377) [2109 bp, 702 aa] {ON}
          similar to uniprot|P40215 Saccharomyces cerevisiae
          YMR145C NDE1 Mitochondrial external NADH dehydrogenase
          Length = 702

 Score = 28.1 bits (61), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 17/34 (50%)

Query: 14 GLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSI 47
          GLP+ T    K +  G   +++ RR  P   GS+
Sbjct: 10 GLPRLTNRFTKPISTGTHSNSIVRRCMPHHKGSV 43

>Kwal_23.4124 s23 complement(582149..585190) [3042 bp, 1013 aa] {ON}
           YDL077C (VAM6) - involved in vacuolar morphogenesis
           [contig 255] FULL
          Length = 1013

 Score = 27.3 bits (59), Expect = 4.4,   Method: Composition-based stats.
 Identities = 10/33 (30%), Positives = 18/33 (54%)

Query: 36  YRRVTPSIAGSITKIKELVDLEVTEKALSKEEQ 68
           Y +  PS+ G  T++    D +  E+ LSK ++
Sbjct: 592 YLKFNPSMLGPFTRVNNYCDFDTVEQELSKNQR 624

>NDAI0E04520 Chr5 complement(1012409..1014325) [1917 bp, 638 aa]
           {ON} Anc_7.220 YER049W
          Length = 638

 Score = 26.6 bits (57), Expect = 7.6,   Method: Composition-based stats.
 Identities = 15/32 (46%), Positives = 21/32 (65%)

Query: 42  SIAGSITKIKELVDLEVTEKALSKEEQRELRK 73
           SI  S++  KEL  + + +K LSKEE + LRK
Sbjct: 307 SITESLSIPKELKTIPLEDKFLSKEEVKYLRK 338

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,428,769
Number of extensions: 239631
Number of successful extensions: 840
Number of sequences better than 10.0: 35
Number of HSP's gapped: 840
Number of HSP's successfully gapped: 35
Length of query: 84
Length of database: 53,481,399
Length adjustment: 56
Effective length of query: 28
Effective length of database: 47,060,103
Effective search space: 1317682884
Effective search space used: 1317682884
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 59 (27.3 bits)