Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0C10472g3.188ON60860831840.0
KLTH0G16038g3.188ON60960922640.0
Kwal_56.231173.188ON60760621130.0
TDEL0D043303.188ON59861318960.0
KAFR0C008703.188ON61261818950.0
Suva_2.1423.188ON60361918300.0
TBLA0F007403.188ON65364818160.0
YBR015C (MNN2)3.188ON59761018010.0
Smik_2.1343.188ON59761317840.0
KLLA0E17755g3.188ON63864517770.0
Skud_2.1273.188ON59661017650.0
ZYRO0A04950g3.188ON61854117580.0
NCAS0E015903.188ON60861417230.0
TPHA0A043803.188ON64258617260.0
Ecym_53143.188ON61562216670.0
KNAG0K012903.188ON61152316250.0
NCAS0A03650singletonON60761215950.0
CAGL0I04532g3.188ON61261515930.0
NDAI0G017903.188ON60761315760.0
AER018C3.188ON60661115640.0
Kpol_1036.503.188ON67652415590.0
NDAI0A065003.188ON63754814860.0
TPHA0C04560singletonON57351714730.0
Kpol_1045.703.188ON61752414690.0
KAFR0E01030singletonON64062514630.0
KNAG0K01300singletonON59761713750.0
SAKL0C04598g1.150ON61153210861e-140
KAFR0G002801.150ON57953810581e-136
NDAI0A007801.150ON58753010561e-136
KLTH0F03938g1.150ON56253410411e-134
Kwal_33.136931.150ON55852610171e-130
NCAS0B084501.150ON58653210151e-130
Kpol_2002.571.150ON60553110071e-128
TBLA0D030301.150ON6055029981e-127
YJL186W (MNN5)1.150ON5865109891e-126
ZYRO0D17160g1.150ON5795269771e-124
Skud_10.311.150ON5865139751e-124
TPHA0E034801.150ON7095319651e-121
Ecym_81281.150ON5925509421e-119
CAGL0M02871g1.150ON6005089281e-117
Smik_10.461.150ON5865449261e-117
AEL148W1.150ON5735529041e-113
KLLA0C16467g1.150ON6075419021e-113
Suva_6.2661.150ON5865158841e-110
KNAG0C009001.150ON6235668791e-109
SAKL0H22616gsingletonON7416068771e-107
TDEL0C03020na 1ON6605778581e-106
TBLA0J011901.150ON6164608451e-104
ZYRO0F13244gna 1ON6645898201e-100
TBLA0A002703.188ON9575178151e-96
KLLA0F24574gna 2ON7115957668e-92
SAKL0C08888gna 2ON6795966801e-79
KLTH0C08976gna 2ON7026166761e-78
Kwal_56.22779na 2ON6955906574e-76
Ecym_3545na 2ON6706276065e-69
CAGL0L08096g1.150ON5644505761e-65
AEL082Wna 2ON6815985032e-54
TDEL0B00160singletonON5624531626e-11
NDAI0H012707.123ON6562901582e-10
KNAG0G01070singletonON6323891474e-09
Kwal_55.209847.123ON6194111449e-09
Suva_5.322na 3ON5532381377e-08
KLTH0F13486g7.123ON6233301323e-07
KNAG0J02990singletonON6442871304e-07
KNAG0G010607.123ON6943571305e-07
Skud_7.10na 3ON5661901271e-06
KNAG0D03070singletonON6502861271e-06
CAGL0C03916gsingletonON6283001243e-06
TDEL0H032607.123ON6411371233e-06
CAGL0C03938gsingletonON6373261225e-06
NDAI0A085507.123ON6643141191e-05
Kwal_23.2926na 4ON5682381181e-05
NCAS0F007807.123ON6392711172e-05
KNAG0D05360singletonON5332841126e-05
CAGL0C03894g7.123ON6272601136e-05
CAGL0C03960gsingletonON6233181127e-05
AEL345WsingletonON6452741118e-05
CAGL0C04048gsingletonON6203471111e-04
CAGL0C04004gsingletonON6323601091e-04
TDEL0F05640singletonON5543721082e-04
KNAG0E03170singletonON7463131082e-04
CAGL0H09262gsingletonON6253281082e-04
AAR183CsingletonON6482471072e-04
KAFR0K012407.123ON6664021073e-04
Suva_14.418na 5ON5802371064e-04
TPHA0L008207.123ON7302571047e-04
Skud_14.395na 5ON5803291037e-04
TBLA0G03680singletonON7512901048e-04
CAGL0H09240gsingletonON6421971030.001
Smik_7.4na 3ON5621741020.001
Smik_9.1807.123ON6303601010.001
ZYRO0G04048g7.123ON6411541000.002
CAGL0C04026gsingletonON6361651000.002
Kpol_298.4singletonON6312621000.002
YIL014W (MNT3)7.123ON630354990.002
YNR059W (MNT4)na 5ON580255990.003
TPHA0H00240singletonON829209980.003
CAGL0C03982gsingletonON629138980.003
KLTH0G07986gna 4ON569240970.004
Suva_9.1917.123ON625279980.004
Smik_14.393na 5ON580177970.004
CAGL0G04279gsingletonON660143970.005
KLLA0E09813gsingletonON746264970.005
YGL257C (MNT2)na 3ON558174960.006
SAKL0D15180gsingletonON577238960.006
Kpol_1015.13singletonON743286950.009
ABR245CsingletonON641130940.009
KLTH0G19690gsingletonON588299940.009
TBLA0C06250singletonON736299930.012
KAFR0K01260singletonON628130930.013
AFL235WsingletonON381192910.017
TBLA0H00130singletonON687144920.018
NCAS0I004807.123ON657248910.021
Kwal_23.5454singletonON583282910.023
SAKL0H19316gna 6ON797302910.024
TBLA0A00640singletonON747143910.024
Skud_9.1587.123ON629356900.028
Kwal_55.22238singletonON584275880.055
KLLA0D13376gna 7ON663180870.062
Suva_5.87na 8ON766312860.088
Smik_5.115na 8ON762309840.15
YER001W (MNN1)na 8ON762315840.17
Kpol_1057.22singletonON764196830.19
TPHA0F00700singletonON856187830.21
TPHA0F00130singletonON758234800.48
TBLA0A011607.123ON663141800.53
Skud_5.100na 8ON762310742.4
Ecym_24382.500ON38845698.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0C10472g
         (608 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0C10472g Chr3 (953238..955064) [1827 bp, 608 aa] {ON} simila...  1231   0.0  
KLTH0G16038g Chr7 (1404292..1406121) [1830 bp, 609 aa] {ON} simi...   876   0.0  
Kwal_56.23117 s56 complement(407699..409522) [1824 bp, 607 aa] {...   818   0.0  
TDEL0D04330 Chr4 complement(790232..792028) [1797 bp, 598 aa] {O...   734   0.0  
KAFR0C00870 Chr3 complement(175651..177489) [1839 bp, 612 aa] {O...   734   0.0  
Suva_2.142 Chr2 complement(246653..248464) [1812 bp, 603 aa] {ON...   709   0.0  
TBLA0F00740 Chr6 (187874..189835) [1962 bp, 653 aa] {ON} Anc_3.1...   704   0.0  
YBR015C Chr2 complement(267710..269503) [1794 bp, 597 aa] {ON}  ...   698   0.0  
Smik_2.134 Chr2 complement(247923..249716) [1794 bp, 597 aa] {ON...   691   0.0  
KLLA0E17755g Chr5 complement(1572985..1574901) [1917 bp, 638 aa]...   689   0.0  
Skud_2.127 Chr2 complement(241232..243022) [1791 bp, 596 aa] {ON...   684   0.0  
ZYRO0A04950g Chr1 complement(397314..399170) [1857 bp, 618 aa] {...   681   0.0  
NCAS0E01590 Chr5 (302992..304818) [1827 bp, 608 aa] {ON} Anc_3.188    668   0.0  
TPHA0A04380 Chr1 (982546..984474) [1929 bp, 642 aa] {ON} Anc_3.1...   669   0.0  
Ecym_5314 Chr5 complement(634571..636418) [1848 bp, 615 aa] {ON}...   646   0.0  
KNAG0K01290 Chr11 (254881..256716) [1836 bp, 611 aa] {ON}             630   0.0  
NCAS0A03650 Chr1 complement(729502..731325) [1824 bp, 607 aa] {O...   619   0.0  
CAGL0I04532g Chr9 (404659..406497) [1839 bp, 612 aa] {ON} simila...   618   0.0  
NDAI0G01790 Chr7 (392941..394764) [1824 bp, 607 aa] {ON} Anc_3.188    611   0.0  
AER018C Chr5 complement(661035..662855) [1821 bp, 606 aa] {ON} S...   607   0.0  
Kpol_1036.50 s1036 complement(135897..137927) [2031 bp, 676 aa] ...   605   0.0  
NDAI0A06500 Chr1 complement(1475305..1477218) [1914 bp, 637 aa] ...   577   0.0  
TPHA0C04560 Chr3 (983249..984970) [1722 bp, 573 aa] {ON}              572   0.0  
Kpol_1045.70 s1045 complement(162608..164461) [1854 bp, 617 aa] ...   570   0.0  
KAFR0E01030 Chr5 (212679..214601) [1923 bp, 640 aa] {ON}              568   0.0  
KNAG0K01300 Chr11 (257271..259064) [1794 bp, 597 aa] {ON}             534   0.0  
SAKL0C04598g Chr3 (447448..449283) [1836 bp, 611 aa] {ON} simila...   422   e-140
KAFR0G00280 Chr7 (92838..94577) [1740 bp, 579 aa] {ON} Anc_1.150...   412   e-136
NDAI0A00780 Chr1 (156271..158034) [1764 bp, 587 aa] {ON} Anc_1.150    411   e-136
KLTH0F03938g Chr6 (351536..353224) [1689 bp, 562 aa] {ON} simila...   405   e-134
Kwal_33.13693 s33 (354321..355997) [1677 bp, 558 aa] {ON} YJL186...   396   e-130
NCAS0B08450 Chr2 complement(1614300..1616060) [1761 bp, 586 aa] ...   395   e-130
Kpol_2002.57 s2002 (129140..130957) [1818 bp, 605 aa] {ON} (1291...   392   e-128
TBLA0D03030 Chr4 complement(734007..735824) [1818 bp, 605 aa] {O...   389   e-127
YJL186W Chr10 (80155..81915) [1761 bp, 586 aa] {ON}  MNN5Alpha-1...   385   e-126
ZYRO0D17160g Chr4 complement(1417469..1419208) [1740 bp, 579 aa]...   380   e-124
Skud_10.31 Chr10 (54975..56735) [1761 bp, 586 aa] {ON} YJL186W (...   380   e-124
TPHA0E03480 Chr5 complement(735664..737793) [2130 bp, 709 aa] {O...   376   e-121
Ecym_8128 Chr8 complement(266920..268698) [1779 bp, 592 aa] {ON}...   367   e-119
CAGL0M02871g Chr13 (324009..325811) [1803 bp, 600 aa] {ON} simil...   362   e-117
Smik_10.46 Chr10 (78173..79933) [1761 bp, 586 aa] {ON} YJL186W (...   361   e-117
AEL148W Chr5 (351089..352810) [1722 bp, 573 aa] {ON} Syntenic ho...   352   e-113
KLLA0C16467g Chr3 (1442002..1443825) [1824 bp, 607 aa] {ON} simi...   352   e-113
Suva_6.266 Chr6 complement(467727..469487) [1761 bp, 586 aa] {ON...   345   e-110
KNAG0C00900 Chr3 (167471..169342) [1872 bp, 623 aa] {ON} Anc_1.1...   343   e-109
SAKL0H22616g Chr8 complement(1966196..1968421) [2226 bp, 741 aa]...   342   e-107
TDEL0C03020 Chr3 (537820..539802) [1983 bp, 660 aa] {ON}              335   e-106
TBLA0J01190 Chr10 complement(267291..269141) [1851 bp, 616 aa] {...   330   e-104
ZYRO0F13244g Chr6 (1084412..1086406) [1995 bp, 664 aa] {ON} simi...   320   e-100
TBLA0A00270 Chr1 complement(39183..42056) [2874 bp, 957 aa] {ON}...   318   1e-96
KLLA0F24574g Chr6 complement(2285387..2287522) [2136 bp, 711 aa]...   299   8e-92
SAKL0C08888g Chr3 (814687..816726) [2040 bp, 679 aa] {ON} weakly...   266   1e-79
KLTH0C08976g Chr3 (751731..753839) [2109 bp, 702 aa] {ON} weakly...   265   1e-78
Kwal_56.22779 s56 complement(277096..279183) [2088 bp, 695 aa] {...   257   4e-76
Ecym_3545 Chr3 complement(1030762..1032774) [2013 bp, 670 aa] {O...   238   5e-69
CAGL0L08096g Chr12 complement(886827..888521) [1695 bp, 564 aa] ...   226   1e-65
AEL082W Chr5 (474072..476117) [2046 bp, 681 aa] {ON} Non-synteni...   198   2e-54
TDEL0B00160 Chr2 (29809..31497) [1689 bp, 562 aa] {ON}                 67   6e-11
NDAI0H01270 Chr8 (306136..308106) [1971 bp, 656 aa] {ON} Anc_7.123     65   2e-10
KNAG0G01070 Chr7 complement(232251..234149) [1899 bp, 632 aa] {O...    61   4e-09
Kwal_55.20984 s55 complement(634833..636692) [1860 bp, 619 aa] {...    60   9e-09
Suva_5.322 Chr5 (525925..527586) [1662 bp, 553 aa] {ON} YGL257C ...    57   7e-08
KLTH0F13486g Chr6 complement(1108786..1110657) [1872 bp, 623 aa]...    55   3e-07
KNAG0J02990 Chr10 (576491..578425) [1935 bp, 644 aa] {ON}              55   4e-07
KNAG0G01060 Chr7 complement(228987..231071) [2085 bp, 694 aa] {O...    55   5e-07
Skud_7.10 Chr7 complement(16816..18516) [1701 bp, 566 aa] {ON} Y...    54   1e-06
KNAG0D03070 Chr4 (552018..553970) [1953 bp, 650 aa] {ON}               54   1e-06
CAGL0C03916g Chr3 complement(383989..385875) [1887 bp, 628 aa] {...    52   3e-06
TDEL0H03260 Chr8 complement(542810..544735) [1926 bp, 641 aa] {O...    52   3e-06
CAGL0C03938g Chr3 complement(386673..388586) [1914 bp, 637 aa] {...    52   5e-06
NDAI0A08550 Chr1 complement(1967085..1969079) [1995 bp, 664 aa] ...    50   1e-05
Kwal_23.2926 s23 complement(78806..80512) [1707 bp, 568 aa] {ON}...    50   1e-05
NCAS0F00780 Chr6 (156307..158226) [1920 bp, 639 aa] {ON} Anc_7.123     50   2e-05
KNAG0D05360 Chr4 (981032..982633) [1602 bp, 533 aa] {ON}               48   6e-05
CAGL0C03894g Chr3 complement(381514..383397) [1884 bp, 627 aa] {...    48   6e-05
CAGL0C03960g Chr3 complement(389250..391121) [1872 bp, 623 aa] {...    48   7e-05
AEL345W Chr5 (1961..3898) [1938 bp, 645 aa] {ON} Non-syntenic ho...    47   8e-05
CAGL0C04048g Chr3 complement(399734..401596) [1863 bp, 620 aa] {...    47   1e-04
CAGL0C04004g Chr3 complement(394614..396512) [1899 bp, 632 aa] {...    47   1e-04
TDEL0F05640 Chr6 complement(1055778..1057442) [1665 bp, 554 aa] ...    46   2e-04
KNAG0E03170 Chr5 complement(632635..634875) [2241 bp, 746 aa] {O...    46   2e-04
CAGL0H09262g Chr8 complement(908258..910135) [1878 bp, 625 aa] {...    46   2e-04
AAR183C Chr1 complement(672091..674037) [1947 bp, 648 aa] {ON} N...    46   2e-04
KAFR0K01240 Chr11 complement(258683..260683) [2001 bp, 666 aa] {...    46   3e-04
Suva_14.418 Chr14 (721586..723328) [1743 bp, 580 aa] {ON} YNR059...    45   4e-04
TPHA0L00820 Chr12 complement(162210..164402) [2193 bp, 730 aa] {...    45   7e-04
Skud_14.395 Chr14 (704847..706589) [1743 bp, 580 aa] {ON} YNR059...    44   7e-04
TBLA0G03680 Chr7 complement(975688..977943) [2256 bp, 751 aa] {O...    45   8e-04
CAGL0H09240g Chr8 complement(905670..907598) [1929 bp, 642 aa] {...    44   0.001
Smik_7.4 Chr7 complement(8045..9733) [1689 bp, 562 aa] {ON} YGL2...    44   0.001
Smik_9.180 Chr9 (300789..302681) [1893 bp, 630 aa] {ON} YIL014W ...    44   0.001
ZYRO0G04048g Chr7 complement(328792..330717) [1926 bp, 641 aa] {...    43   0.002
CAGL0C04026g Chr3 complement(397303..399213) [1911 bp, 636 aa] {...    43   0.002
Kpol_298.4 s298 (12426..14321) [1896 bp, 631 aa] {ON} (12426..14...    43   0.002
YIL014W Chr9 (326103..327995) [1893 bp, 630 aa] {ON}  MNT3Alpha-...    43   0.002
YNR059W Chr14 (736803..738545) [1743 bp, 580 aa] {ON}  MNT4Putat...    43   0.003
TPHA0H00240 Chr8 (40339..42828) [2490 bp, 829 aa] {ON}                 42   0.003
CAGL0C03982g Chr3 complement(391909..393798) [1890 bp, 629 aa] {...    42   0.003
KLTH0G07986g Chr7 complement(646652..648361) [1710 bp, 569 aa] {...    42   0.004
Suva_9.191 Chr9 (314586..316463) [1878 bp, 625 aa] {ON} YIL014W ...    42   0.004
Smik_14.393 Chr14 (693641..695383) [1743 bp, 580 aa] {ON} YNR059...    42   0.004
CAGL0G04279g Chr7 complement(404144..406126) [1983 bp, 660 aa] {...    42   0.005
KLLA0E09813g Chr5 (867899..870139) [2241 bp, 746 aa] {ON} simila...    42   0.005
YGL257C Chr7 complement(12481..14157) [1677 bp, 558 aa] {ON}  MN...    42   0.006
SAKL0D15180g Chr4 complement(1259592..1261325) [1734 bp, 577 aa]...    42   0.006
Kpol_1015.13 s1015 complement(31451..33682) [2232 bp, 743 aa] {O...    41   0.009
ABR245C Chr2 complement(854587..856512) [1926 bp, 641 aa] {ON} N...    41   0.009
KLTH0G19690g Chr7 complement(1704559..1706325) [1767 bp, 588 aa]...    41   0.009
TBLA0C06250 Chr3 (1512916..1515126) [2211 bp, 736 aa] {ON}             40   0.012
KAFR0K01260 Chr11 complement(261190..263076) [1887 bp, 628 aa] {...    40   0.013
AFL235W Chr6 (2..1147) [1146 bp, 381 aa] {ON} Non-syntenic homol...    40   0.017
TBLA0H00130 Chr8 complement(8943..11006) [2064 bp, 687 aa] {ON}        40   0.018
NCAS0I00480 Chr9 (77950..79923) [1974 bp, 657 aa] {ON}                 40   0.021
Kwal_23.5454 s23 (1171360..1173111) [1752 bp, 583 aa] {ON} YGL25...    40   0.023
SAKL0H19316g Chr8 complement(1705548..1707941) [2394 bp, 797 aa]...    40   0.024
TBLA0A00640 Chr1 (128803..131046) [2244 bp, 747 aa] {ON}               40   0.024
Skud_9.158 Chr9 (296090..297979) [1890 bp, 629 aa] {ON} YIL014W ...    39   0.028
Kwal_55.22238 s55 complement(1166321..1168075) [1755 bp, 584 aa]...    39   0.055
KLLA0D13376g Chr4 (1150858..1152849) [1992 bp, 663 aa] {ON} simi...    38   0.062
Suva_5.87 Chr5 (129322..131622) [2301 bp, 766 aa] {ON} YER001W (...    38   0.088
Smik_5.115 Chr5 (157563..159851) [2289 bp, 762 aa] {ON} YER001W ...    37   0.15 
YER001W Chr5 (153520..155808) [2289 bp, 762 aa] {ON}  MNN1Alpha-...    37   0.17 
Kpol_1057.22 s1057 complement(42104..44398) [2295 bp, 764 aa] {O...    37   0.19 
TPHA0F00700 Chr6 (158182..160752) [2571 bp, 856 aa] {ON}               37   0.21 
TPHA0F00130 Chr6 (14360..16636) [2277 bp, 758 aa] {ON}                 35   0.48 
TBLA0A01160 Chr1 complement(267341..269332) [1992 bp, 663 aa] {O...    35   0.53 
Skud_5.100 Chr5 (150236..152524) [2289 bp, 762 aa] {ON} YER001W ...    33   2.4  
Ecym_2438 Chr2 (854968..856134) [1167 bp, 388 aa] {ON} similar t...    31   8.2  

>SAKL0C10472g Chr3 (953238..955064) [1827 bp, 608 aa] {ON} similar
           to uniprot|P38069 Saccharomyces cerevisiae YBR015C MNN2
           Alpha-1 2-mannosyltransferase responsible for addition
           of the first alpha-1 2-linked mannose to form the
           branches on the mannan backbone of oligosaccharides
           localizes to an early Golgi compartment
          Length = 608

 Score = 1231 bits (3184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 596/608 (98%), Positives = 596/608 (98%)

Query: 1   MVLLTKRFAKVFKLAAXXXXXXXXXXXXNKYISQDLPVDEYKSYLQNYIDKYTSGSGNPP 60
           MVLLTKRFAKVFKLAA            NKYISQDLPVDEYKSYLQNYIDKYTSGSGNPP
Sbjct: 1   MVLLTKRFAKVFKLAAITTLCCLLFILTNKYISQDLPVDEYKSYLQNYIDKYTSGSGNPP 60

Query: 61  AVVPSPPQKGRDREPMTDVSRQPASKKELQRRQKLQDFYSQVFKYLHLYSPKGKSTRVYD 120
           AVVPSPPQKGRDREPMTDVSRQPASKKELQRRQKLQDFYSQVFKYLHLYSPKGKSTRVYD
Sbjct: 61  AVVPSPPQKGRDREPMTDVSRQPASKKELQRRQKLQDFYSQVFKYLHLYSPKGKSTRVYD 120

Query: 121 PRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLVLPKD 180
           PRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLVLPKD
Sbjct: 121 PRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLVLPKD 180

Query: 181 SYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAK 240
           SYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAK
Sbjct: 181 SYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAK 240

Query: 241 CIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKS 300
           CIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKS
Sbjct: 241 CIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKS 300

Query: 301 TGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHDL 360
           TGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHDL
Sbjct: 301 TGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHDL 360

Query: 361 DGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGA 420
           DGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGA
Sbjct: 361 DGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGA 420

Query: 421 NFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTS 480
           NFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTS
Sbjct: 421 NFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTS 480

Query: 481 NSIHLDKDYTPESFYRKYFEGDDIKEVDIMFVHSNLPKFDPLTLWREKDLIVNGKHIRSY 540
           NSIHLDKDYTPESFYRKYFEGDDIKEVDIMFVHSNLPKFDPLTLWREKDLIVNGKHIRSY
Sbjct: 481 NSIHLDKDYTPESFYRKYFEGDDIKEVDIMFVHSNLPKFDPLTLWREKDLIVNGKHIRSY 540

Query: 541 TNLKRLNGYDLELESFKVFQDYLCVQRSHFKYLDEHLQEEAQWQSMCDYIHNRLKFLDST 600
           TNLKRLNGYDLELESFKVFQDYLCVQRSHFKYLDEHLQEEAQWQSMCDYIHNRLKFLDST
Sbjct: 541 TNLKRLNGYDLELESFKVFQDYLCVQRSHFKYLDEHLQEEAQWQSMCDYIHNRLKFLDST 600

Query: 601 HKDAVSVA 608
           HKDAVSVA
Sbjct: 601 HKDAVSVA 608

>KLTH0G16038g Chr7 (1404292..1406121) [1830 bp, 609 aa] {ON} similar
           to uniprot|P38069 Saccharomyces cerevisiae YBR015C MNN2
           Alpha-1 2-mannosyltransferase responsible for addition
           of the first alpha-1 2-linked mannose to form the
           branches on the mannan backbone of oligosaccharides
           localizes to an early Golgi compartment
          Length = 609

 Score =  876 bits (2264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/609 (68%), Positives = 490/609 (80%), Gaps = 1/609 (0%)

Query: 1   MVLLTKRFAKVFKLAAXXXXXXXXXXXXNKYISQDLPVDEYKSYLQNYIDKYTSGSGNPP 60
           MVLLTKRF K+F+ +              +YI QDL   EY  YLQNY + Y+       
Sbjct: 1   MVLLTKRFNKIFRFSLVAALCCLIFVLSTRYIDQDLSSLEYVRYLQNYHETYSGNGNKVE 60

Query: 61  AVVPSPPQKGRDREPMTDVSRQPASKKELQRRQKLQDFYSQVFKYLHLYSPKGKSTRVYD 120
             V +PP    + +  +       S ++ +RRQ LQ+FY QVFK L  +SP G S+R YD
Sbjct: 61  PEVETPPAPAANDKIKSPSGGPVLSAQDQKRRQALQEFYKQVFKNLRQHSPTGSSSRQYD 120

Query: 121 PRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLVLPKD 180
            +C+L+GDIGAR +DY++W KLTS+ LG CL LS +EK MLKE H  FVE+L SLVLPK 
Sbjct: 121 EKCQLNGDIGARANDYNSWSKLTSKNLGNCLKLSNKEKTMLKETHYDFVESLKSLVLPKG 180

Query: 181 SYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAK 240
           +YKG+GIVTVGGGKFS+L+FLIIKTLRN+ T LPVEV IPP DEGE +FC+ LLPKYNAK
Sbjct: 181 TYKGDGIVTVGGGKFSMLSFLIIKTLRNLGTHLPVEVFIPPNDEGEEEFCNTLLPKYNAK 240

Query: 241 CIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKS 300
           CIYISDVLP+ +++NF+FKGYQFKS+SIIASSFENLLLLDADNFPIK LD+IF+EEPYKS
Sbjct: 241 CIYISDVLPEDIIENFDFKGYQFKSISIIASSFENLLLLDADNFPIKALDNIFEEEPYKS 300

Query: 301 TGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHDL 360
           TGMVLWPDFWRRTTNPAYY+IADI ++Y KRVRNC+D+ITPP+ YT+DM++L NVPLHDL
Sbjct: 301 TGMVLWPDFWRRTTNPAYYEIADIAVNYKKRVRNCMDDITPPQAYTKDMKNLENVPLHDL 360

Query: 361 DGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGA 420
           +GTIPDVSTESGQLMI KS HLPT+LLSLYYNVNGP+WYYPIFSQKA+GEGDKETFIA A
Sbjct: 361 EGTIPDVSTESGQLMIRKSRHLPTILLSLYYNVNGPTWYYPIFSQKASGEGDKETFIAAA 420

Query: 421 NFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTS 480
           NFYGLPFYQVKS TAVDGYHQPD KGFRGVAMLQHDFVQDY RY+WA  DI  +Y+GK  
Sbjct: 421 NFYGLPFYQVKSVTAVDGYHQPDNKGFRGVAMLQHDFVQDYSRYKWAKSDIENKYAGKVP 480

Query: 481 NSIHLDKDYTPESFYRKYFEGDDIKEVDIMFVHSNLPKFDPLTLWREKDLIVNGKHIRSY 540
             I  D  Y+P++ Y+ YFE +D+KEVDIMFVHSNLPKFDP TLW +KDLIV+GKHIRSY
Sbjct: 481 QFIKQDTSYSPDAMYKTYFEPEDLKEVDIMFVHSNLPKFDPYTLWNDKDLIVDGKHIRSY 540

Query: 541 TNLKRLNGYDLELESFKVFQDYLCVQRSHFKYLDEHLQ-EEAQWQSMCDYIHNRLKFLDS 599
           TNL+RLN YDLELE+FKVF++YLCV R+ FKYLD+ LQ +E QW+SMC YI  RL FLD 
Sbjct: 541 TNLRRLNNYDLELENFKVFKEYLCVSRTKFKYLDDSLQGDERQWKSMCGYIKERLNFLDQ 600

Query: 600 THKDAVSVA 608
           TH DA++ +
Sbjct: 601 THSDAINAS 609

>Kwal_56.23117 s56 complement(407699..409522) [1824 bp, 607 aa] {ON}
           YBR015C (MNN2) - putative Golgi
           alpha-1,2-mannosyltransferase [contig 183] FULL
          Length = 607

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/606 (64%), Positives = 466/606 (76%), Gaps = 3/606 (0%)

Query: 1   MVLLTKRFAKVFKLAAXXXXXXXXXXXXNKYISQDLPVDEYKSYLQNYIDKYTSGSGNPP 60
           MV LTKRF+K+FKL+              KY  +DL   EY   +  ++    +G G   
Sbjct: 1   MVFLTKRFSKIFKLSLVAALCCLAFMFSTKYFDKDLTSLEYGKLVDTFMAD--AGYGKDA 58

Query: 61  AVVPSPPQKGRDREPMTDVSRQPASKKELQRRQKLQDFYSQVFKYLHLYSPKGKSTRVYD 120
             V      G           + ++    +R+  ++ FY+ VF  L  +SP G S R Y 
Sbjct: 59  QEVAGSSSDGTADNNGIGAGAKVSTSSNEKRKIAMRKFYTDVFNSLKKHSPTGVSKREYG 118

Query: 121 PRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLVLPKD 180
            +CKL GDIGAR DDYDNW KLTS+ LGQCL++S +EK MLKE H  +VE+L SLVLPK 
Sbjct: 119 AQCKLSGDIGARADDYDNWSKLTSKNLGQCLIVSDKEKRMLKEKHRGYVESLESLVLPKG 178

Query: 181 SYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAK 240
           +YKG+GIVTVGGGKFS+LAFLIIKTLRN+HT+LPVEV IPP DEGET FC+ LLP+YNAK
Sbjct: 179 AYKGDGIVTVGGGKFSMLAFLIIKTLRNLHTSLPVEVFIPPADEGETFFCNELLPQYNAK 238

Query: 241 CIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKS 300
           CIYISDVLPQ ++DNFEFKGYQFKS++IIASSF+NLLLLDADNFPIK LD++F+EEPYKS
Sbjct: 239 CIYISDVLPQEIIDNFEFKGYQFKSIAIIASSFDNLLLLDADNFPIKDLDNVFNEEPYKS 298

Query: 301 TGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHDL 360
            GMVLWPDFWRRTTNP YYDIADI ++Y KRVRNC+D++TPP +YT+DM DLSNVPLHDL
Sbjct: 299 KGMVLWPDFWRRTTNPIYYDIADIEVNYKKRVRNCMDDVTPPAVYTKDMSDLSNVPLHDL 358

Query: 361 DGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGA 420
           +GTIPDVSTESGQLMI KS HL T+LLSLYYNVNGPSWYYPIFSQKA+GEGDKETFIA A
Sbjct: 359 EGTIPDVSTESGQLMIRKSDHLGTILLSLYYNVNGPSWYYPIFSQKASGEGDKETFIAAA 418

Query: 421 NFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTS 480
           NFY LPFYQVKS TAVDGYHQP  KGFRGVAMLQHDFVQDY R  WA  +IR+ ++GK +
Sbjct: 419 NFYDLPFYQVKSVTAVDGYHQPHDKGFRGVAMLQHDFVQDYGRQMWAQVEIRSHFAGKDT 478

Query: 481 NSIHLDKDYTPESFYRKYFEGDDIKEVDIMFVHSNLPKFDPLTLWREKDLIVNGKHIRSY 540
                D  Y+P++ Y+K+F  D+I E DIMFVHSNLPKFDP  LW ++DLIV+GKHIRSY
Sbjct: 479 QYAKYDPSYSPDAVYKKFFSDDNIGETDIMFVHSNLPKFDPYQLWHDQDLIVDGKHIRSY 538

Query: 541 TNLKRLNGYDLELESFKVFQDYLCVQRSHFKYLDEHLQ-EEAQWQSMCDYIHNRLKFLDS 599
            NLKRLNGYDLELE+FK+F +YLC  ++ FKYLD+ L  ++  W+ MC YI  RLK+L+ 
Sbjct: 539 RNLKRLNGYDLELENFKIFNEYLCTTQARFKYLDDKLNGDQRNWKDMCSYIGERLKYLEQ 598

Query: 600 THKDAV 605
           TH DA+
Sbjct: 599 THLDAI 604

>TDEL0D04330 Chr4 complement(790232..792028) [1797 bp, 598 aa] {ON}
           Anc_3.188 YBR015C
          Length = 598

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/613 (56%), Positives = 446/613 (72%), Gaps = 25/613 (4%)

Query: 1   MVLLTKRFAKVFKLAAXXXXXXXXXXXXNKYISQDLPVDEYKSYLQNYIDKYTSGSGNPP 60
           M L+TKR+ K  KLA             ++++ + L V EY+ Y+++Y+     G+  P 
Sbjct: 1   MALITKRYRKALKLATVVLVLCVTFIATSRFMDEGLSVSEYQDYIKSYL-----GNAQPA 55

Query: 61  AVVPSPPQKGRDREPMTDVS----RQPASKKELQRRQKLQDFYSQVFKYLHLYSPKGKST 116
             +         R P  DV     R+P +        KL+ FY QVF+ L  YSP  KS 
Sbjct: 56  DTI--------SRNPAVDVGLNAGREPIANGG---NAKLKKFYEQVFEDLKNYSPSSKSA 104

Query: 117 RVYDPRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLV 176
           R Y  +C L GDIG R ++Y+ WFKLT  EL QCL++S  + A L+++H+ +V+ L SLV
Sbjct: 105 REYSKQCSLSGDIGFRPENYNEWFKLTERELSQCLVVSNADVAKLRQSHSDYVKALGSLV 164

Query: 177 LPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPK 236
           LPK+SYKG GIVTVGGGKFSL+A L+IKTLRN+HTTLPVEV IPP DEGETD C+ +  K
Sbjct: 165 LPKNSYKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSK 224

Query: 237 YNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEE 296
           YNAKCI++SD+LP   +  F+F GYQFKSL++IASSFE++L LDADNFP+K LD IF+++
Sbjct: 225 YNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQD 284

Query: 297 PYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVP 356
           PY STG+VLWPDFWRRTT P +YDIA I +   KRVRNC D++TPPE+YT+++ DLSNVP
Sbjct: 285 PYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVP 344

Query: 357 LHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETF 416
            HDL+G+IP+VSTESGQLMISKS HLPT+LL+LYYNVNGPSWYYP+FSQ+A+GEGDKETF
Sbjct: 345 FHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETF 404

Query: 417 IAGANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYS 476
           +  A+FYGLP+YQ+KSAT V+GYH+PDG+GFRGVAMLQHD  QDY RY+ A K I  +Y 
Sbjct: 405 LTAASFYGLPYYQLKSATGVEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYG 464

Query: 477 GKTSNSIHLDKDYTPESFYRKYFEGDD---IKEVDIMFVHSNLPKFDPLTLWREKDLIVN 533
            +    I  D  Y+   FY+ YF  D+     EVDIMF HS+ PKF+P TLW+ +DLI  
Sbjct: 465 AQA--KISYDSSYSLHEFYKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWE 522

Query: 534 GKHIRSYTNLKRLNGYDLELESFKVFQDYLCVQRSHFKYLDEHLQEEAQWQSMCDYIHNR 593
           GKHIRSYT L ++N YDLELE+FK   +Y+CV+R++ KYL+E+L   A+W SMCDYI +R
Sbjct: 523 GKHIRSYTALSKINRYDLELENFKAINEYVCVKRTNVKYLNENLATSAEWASMCDYIRDR 582

Query: 594 LKFLDSTHKDAVS 606
           L +L STH  AVS
Sbjct: 583 LAYLQSTHVQAVS 595

>KAFR0C00870 Chr3 complement(175651..177489) [1839 bp, 612 aa] {ON}
           Anc_3.188 YBR015C
          Length = 612

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/618 (58%), Positives = 455/618 (73%), Gaps = 19/618 (3%)

Query: 1   MVLLTKRFAKVFKLAAXXXXXXXXXXXXNKYISQD-LPVDEYKSYLQNYIDKYTSGSGNP 59
           M ++ KRF+K+F L                YI+ D + V +YK YLQ+YI+     S + 
Sbjct: 1   MAVVNKRFSKLFILLVSIGFFFLLTNRL--YINNDSVSVKDYKEYLQSYINNNAGDSTDA 58

Query: 60  PAVVPSPPQKGRDREPMTDVSRQPA--SKKELQRRQKLQDFYSQVFKYLHLYSPKGKSTR 117
                   + G +  P     + P   S  E   + +L++FY++VF+Y   YSP GKS R
Sbjct: 59  QGT-----KGGDESVPAASKGKNPVLMSTVESNTKNRLREFYNEVFQYFINYSPSGKSAR 113

Query: 118 VYDPRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLVL 177
            Y   C+L   +G R  +Y +W+KL+  EL +CL +S  +   LK +H +FVENL  LVL
Sbjct: 114 HYQDACQLSEKMGNRPHEYASWYKLSYTELNKCLSISKSDVLNLKTSHKEFVENLGKLVL 173

Query: 178 PKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDE-GETDFCDVLLPK 236
           PK+SYKGNGIVTVGGGKFSL++ L+I+TLRN+ TTLPVEV IPP++E GE +FC+ +LP+
Sbjct: 174 PKNSYKGNGIVTVGGGKFSLMSLLVIRTLRNLGTTLPVEVFIPPQEEKGEMEFCNKILPQ 233

Query: 237 YNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEE 296
           Y+AKCIYISD+LPQ ++DNFEF GYQFKSL+IIASSFENLLLLDADNFPIKPLD IF+EE
Sbjct: 234 YHAKCIYISDILPQQMIDNFEFAGYQFKSLAIIASSFENLLLLDADNFPIKPLDHIFEEE 293

Query: 297 PYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVP 356
           PY STG+VLWPDFWRRTT P YY+IAD+ + +  RVRN ID+ITPP +YT+DM DLSN+P
Sbjct: 294 PYVSTGLVLWPDFWRRTTQPLYYEIADVSVDFKTRVRNSIDDITPPPVYTKDMNDLSNIP 353

Query: 357 LHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETF 416
           LHDL GTIPDVSTESGQLMISKS HLPTVLL+LYYNVNGPSWYYPIFSQKA+GEGDKETF
Sbjct: 354 LHDLKGTIPDVSTESGQLMISKSKHLPTVLLALYYNVNGPSWYYPIFSQKASGEGDKETF 413

Query: 417 IAGANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYS 476
           +A ANFY LP+YQ+++   VDGYHQP+ KGFRGVAMLQHDF QDY+RY  A +++R +Y 
Sbjct: 414 LAAANFYDLPYYQIRTEVGVDGYHQPENKGFRGVAMLQHDFAQDYKRYVKAKEEVRLKYG 473

Query: 477 G-KTSNSIHLDKDYTPESFYRKYFEGDD------IKEVDIMFVHSNLPKFDPLTLWREKD 529
             + S+ I  D +Y  +SFYR YF+          +EVD+MF+HSNLPKF+PLT W+  D
Sbjct: 474 KDRYSSKIKYDPNYDVDSFYRTYFDSGSEPGQGGAQEVDVMFIHSNLPKFEPLTSWKTSD 533

Query: 530 LIVNGKHIRSYTNLKRLNGYDLELESFKVFQDYLCVQRSHFKYLDEHL-QEEAQWQSMCD 588
           LI++GKHIRS+TNLKRL  YD+ELE+FK++ + LC Q  HFKYLD+ L   +    SMC 
Sbjct: 534 LIIDGKHIRSFTNLKRLKNYDIELENFKIYHEVLCEQGLHFKYLDDALGNNKNDKSSMCK 593

Query: 589 YIHNRLKFLDSTHKDAVS 606
           YI +RL FL STH+ A+S
Sbjct: 594 YISDRLDFLQSTHEAAIS 611

>Suva_2.142 Chr2 complement(246653..248464) [1812 bp, 603 aa] {ON}
           YBR015C (REAL)
          Length = 603

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/619 (57%), Positives = 448/619 (72%), Gaps = 32/619 (5%)

Query: 2   VLLTKRFAKVFKLAAXXXXXXXXXXXXNKYISQDLPVDEYKSYLQNYIDKYTSGSGNPPA 61
           +LLTKRF+K+FKLA             NKY+ ++  V +YKS+LQ+YID Y +   + P 
Sbjct: 1   MLLTKRFSKLFKLAFIALLLCGLFVVTNKYMDENTSVKDYKSHLQSYIDSYANKDSSSPE 60

Query: 62  VVPSPPQ-------KGRDREPMTDVSRQPASKKELQRRQKLQDFYSQVFKYLHLYSPKGK 114
              +          KG D                    +KL+ FY+ VF +L L SP GK
Sbjct: 61  DAAAAAAADDAASLKGNDN----------------ASTEKLKSFYNNVFNFLMLDSPSGK 104

Query: 115 STRVYDPRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSS 174
           S RVY+ +C L GDIG R D Y + +KL+++EL +CL LS  E + LK++H  +VE+++S
Sbjct: 105 SKRVYNEKCPLKGDIGDRPDQYKDLYKLSAKELAKCLELSPDEVSKLKKSHKDYVEHIAS 164

Query: 175 LVLPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLL 234
           L+LPK +YKG+GI TVGGGKFSL+AFLIIKTLRNM TTLPVEVLIPP DEGET+FC  +L
Sbjct: 165 LILPKGTYKGSGIATVGGGKFSLMAFLIIKTLRNMGTTLPVEVLIPPGDEGETEFCSKIL 224

Query: 235 PKYNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFD 294
           PKYNAKCIYISD+LP   ++ F FKGYQFKSL++I SSFENLLLLDADNFPIK LD+IF 
Sbjct: 225 PKYNAKCIYISDILPAETIEKFVFKGYQFKSLALITSSFENLLLLDADNFPIKSLDNIFL 284

Query: 295 EEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSN 354
           EEPY STG+V+WPDFWRRTT+P YYDIA IP++  +RVRN  D+ITPP +YT+D++DL  
Sbjct: 285 EEPYVSTGLVMWPDFWRRTTHPLYYDIAGIPVNKERRVRNSQDDITPPAVYTKDLKDLDA 344

Query: 355 VPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKE 414
           VPL D++G IPDVSTESGQLMI+KS HL T LLSL+YNVNG +WYYPIFSQKAAGEGDKE
Sbjct: 345 VPLSDMEGAIPDVSTESGQLMINKSKHLATALLSLFYNVNGINWYYPIFSQKAAGEGDKE 404

Query: 415 TFIAGANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQ 474
           TFIA ANFYGLPFYQVK+ T V+GYH  D  GF GVAMLQHDFVQDY RY  A K I  +
Sbjct: 405 TFIAAANFYGLPFYQVKTKTGVEGYHDSD--GFHGVAMLQHDFVQDYSRYLTASKTINNK 462

Query: 475 YSG---KTSNSIHLDKDYTPESFYRKYFEGDDIK---EVDIMFVHSNLPKFDPLTLWREK 528
           Y     K+S  I  DKDY+ E + +++F+ +D      VD+MF+HSNLPKFDP  L +  
Sbjct: 463 YKDLIIKSSAPIKFDKDYSLEKYIKEFFDNEDSHAKDHVDVMFIHSNLPKFDPYDLSKSN 522

Query: 529 DLIVNGKHIRSYTNLKRLNGYDLELESFKVFQDYLCVQRSHFKYLDEHL-QEEAQWQSMC 587
            L  + K  RS+T+L +++ YD+ELE+FK   +Y+CV ++ FKYLD+ L Q+E  W+ MC
Sbjct: 523 FLTTDNKPARSFTSLGKIHKYDIELENFKALHEYVCVNKNPFKYLDDALGQDEKGWKKMC 582

Query: 588 DYIHNRLKFLDSTHKDAVS 606
           DYI  RL+FL+STH+ A++
Sbjct: 583 DYIAKRLQFLESTHEKAIA 601

>TBLA0F00740 Chr6 (187874..189835) [1962 bp, 653 aa] {ON} Anc_3.188
           YBR015C
          Length = 653

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/648 (54%), Positives = 447/648 (68%), Gaps = 45/648 (6%)

Query: 2   VLLTKRFAKVFKLAAXXXXXXXXXXXXNKYI--SQDLPVDEYKSYLQNYI----DKYTSG 55
           ++LT+RF K+ KL +            N Y+  +  + V +Y   LQ+YI    +   S 
Sbjct: 1   MILTRRFFKLLKLISAVIVLTGLFIATNNYLDDAVSVSVSDYTQRLQSYINLSPEIVNSN 60

Query: 56  SGNPPAVVPSPPQKGRDREPMTDVSRQPASKK---------------------------- 87
           +  PP       +   +   M  V+    +                              
Sbjct: 61  NEKPPLTAEIISEDSSNVNHMATVTSTANNNNNINSNSKLSNPKSNSGSSSSKSNIKTQE 120

Query: 88  --ELQRRQKLQDFYSQVFKYLHLYSPKGKSTRVYDPRCKLDGDIGARLDDYDNWFKLTSE 145
             E  R+QK+  FY  +F  L   +  GKS RVY   C+L GD+G R D+Y  W+KLTS+
Sbjct: 121 DDEATRKQKVYKFYQDIFNILKNTTIPGKSDRVYKLECQLKGDVGTRPDNYKEWYKLTSK 180

Query: 146 ELGQCLMLSTREKAMLKENHAKFVENLSSLVLPKDSYKGNGIVTVGGGKFSLLAFLIIKT 205
           EL  CL +      ML+E+HA +V+ + SLVLPK +Y G GIVTVGGGKFS+LAFLII+T
Sbjct: 181 ELSNCLEVPYETAKMLQESHADYVDKIGSLVLPKVAYGGKGIVTVGGGKFSVLAFLIIRT 240

Query: 206 LRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKCIYISDVLPQSLVDNFEFKGYQFKS 265
           LRN+ T+LPVEV IPP DEGETDFC+ +LP+YNAKCIY++D+LP+  VD FEFKGYQFKS
Sbjct: 241 LRNLGTSLPVEVFIPPSDEGETDFCNNVLPQYNAKCIYMTDILPKEFVDEFEFKGYQFKS 300

Query: 266 LSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIP 325
           L++IASSF++LL+LDADNFPIK LD+IF++EPY STG+V+WPDFWRRTTNP YY IAD+P
Sbjct: 301 LAMIASSFDDLLMLDADNFPIKDLDNIFEQEPYTSTGLVMWPDFWRRTTNPVYYSIADVP 360

Query: 326 ISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTV 385
           ++  KRVRN  D++TP E+YTED+ DLS+VP HDL+GT+PDVSTESGQLMI+K  H+ TV
Sbjct: 361 VNEKKRVRNTFDDLTPVEIYTEDISDLSDVPFHDLEGTLPDVSTESGQLMINKEKHIATV 420

Query: 386 LLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDGYHQPDGK 445
           LL+LYYN NGP+WYYPIFSQKAAGEGDKETFIA ANFYGL +YQV+++  VDGYHQ D K
Sbjct: 421 LLALYYNFNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLSYYQVRTSVGVDGYHQSDDK 480

Query: 446 GFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTSNSIHLDKDYTPESFYRKYFE-GDD- 503
           GFRGVAMLQHDFVQDY+RY+ A  +I  +Y G     +  D +Y+P+ FY+ YF+ GDD 
Sbjct: 481 GFRGVAMLQHDFVQDYERYERARNEIDIKYGG-AKKVMKYDYNYSPDDFYKTYFDSGDDS 539

Query: 504 -----IKEVDIMFVHSNLPKFDPLTLWREKDLIVNGKHIRSYTNLKRLNGYDLELESFKV 558
                IKEVDIMFVHSNLPKFDP TLW E DL ++G H RSY  L  L  YDLE E+FK+
Sbjct: 540 NVNQPIKEVDIMFVHSNLPKFDPFTLWDENDLTLDGSHFRSYLKLPHLTHYDLEYENFKI 599

Query: 559 FQDYLCVQRSHFKYLDEHLQ-EEAQWQSMCDYIHNRLKFLDSTHKDAV 605
           F   LCV ++ FKYL++  Q +E+  +SMC+YI +RLK+L  TH+ A+
Sbjct: 600 FHQSLCVLKNQFKYLEDKFQGKESNRESMCNYIMDRLKYLTDTHEMAL 647

>YBR015C Chr2 complement(267710..269503) [1794 bp, 597 aa] {ON}
           MNN2Alpha-1,2-mannosyltransferase, responsible for
           addition of the first alpha-1,2-linked mannose to form
           the branches on the mannan backbone of oligosaccharides,
           localizes to an early Golgi compartment
          Length = 597

 Score =  698 bits (1801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/610 (56%), Positives = 447/610 (73%), Gaps = 20/610 (3%)

Query: 2   VLLTKRFAKVFKLAAXXXXXXXXXXXXNKYISQDLPVDEYKSYLQNYIDKYTSGSGNPPA 61
           +LLTKRF+K+FKL              NKY+ ++  V EYK YL  Y+  Y++       
Sbjct: 1   MLLTKRFSKLFKLTFIVLILCGLFVITNKYMDENTSVKEYKEYLDRYVQSYSN------- 53

Query: 62  VVPSPPQKGRDREPMTDVSRQPASKKELQRRQKLQDFYSQVFKYLHLYSPKGKSTRVYDP 121
                 +     +  +     P    +    +KL+ FY+ VF +L + SPKG + + Y+ 
Sbjct: 54  ------KYSSSSDAASADDSTPLRDNDEAGNEKLKSFYNNVFNFLMVDSPKGSTAKQYNE 107

Query: 122 RCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLVLPKDS 181
            C L GDIG R D Y + +KL+++EL +CL LS  E A L ++H  +VE++++LV PK +
Sbjct: 108 ACLLKGDIGDRPDHYKDLYKLSAKELSKCLELSPDEVASLTKSHKDYVEHIATLVSPKGT 167

Query: 182 YKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKC 241
           YKG+GI TVGGGKFSL+AFLIIKTLRNM TTLPVEVLIPP DEGET+FC+ +LPKYN+KC
Sbjct: 168 YKGSGIATVGGGKFSLMAFLIIKTLRNMGTTLPVEVLIPPGDEGETEFCNKILPKYNSKC 227

Query: 242 IYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKST 301
           IY+SD+LP+  ++ F FKGYQFKSL++IASSFENLLLLDADNFPIKPLD+IF+EEPY ST
Sbjct: 228 IYVSDILPRETIEKFVFKGYQFKSLALIASSFENLLLLDADNFPIKPLDNIFNEEPYVST 287

Query: 302 GMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHDLD 361
           G+V+WPDFWRRTT+P YYDIA I +   KRVRN  D+ITPP +YT+D++DLS+VPL DLD
Sbjct: 288 GLVMWPDFWRRTTHPLYYDIAGIAVDKKKRVRNSRDDITPPAVYTKDLKDLSDVPLSDLD 347

Query: 362 GTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGAN 421
           GTIPDVSTESGQLMI+K+ HL T LLSL+YNVNGP+WYYPIFSQKAAGEGDKETFIA AN
Sbjct: 348 GTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPTWYYPIFSQKAAGEGDKETFIAAAN 407

Query: 422 FYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSG-KTS 480
           FYGL FYQV++ T V+GYH  D  GF GVAMLQHDFVQDY RY  A + I  +Y G K++
Sbjct: 408 FYGLSFYQVRTRTGVEGYHDED--GFHGVAMLQHDFVQDYGRYLNAMESIGNKYGGTKSA 465

Query: 481 NSIHLDKDYTPESFYRKYFEGDDI---KEVDIMFVHSNLPKFDPLTLWREKDLIVNGKHI 537
           ++I  DK+Y+ E +  ++F+ +D+     VD+MF+HSN PKFDP  L +   L  NGK  
Sbjct: 466 DAIKFDKNYSLEKYTEEFFDNEDLNAKNHVDVMFIHSNFPKFDPYDLSKSNFLTTNGKPA 525

Query: 538 RSYTNLKRLNGYDLELESFKVFQDYLCVQRSHFKYLDEHL-QEEAQWQSMCDYIHNRLKF 596
           RSYT LK++  YD+ELE+FKV  +Y+CV ++ FKYLD+ L Q++ +W+ +C YI +RL F
Sbjct: 526 RSYTALKKVKNYDIELENFKVLNEYVCVNKNPFKYLDDLLGQDKTEWKRVCGYITDRLAF 585

Query: 597 LDSTHKDAVS 606
           L+STH  A++
Sbjct: 586 LESTHDKAIA 595

>Smik_2.134 Chr2 complement(247923..249716) [1794 bp, 597 aa] {ON}
           YBR015C (REAL)
          Length = 597

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/613 (56%), Positives = 444/613 (72%), Gaps = 26/613 (4%)

Query: 2   VLLTKRFAKVFKLAAXXXXXXXXXXXXNKYISQDLPVDEYKSYLQNYIDKYTSGSG---N 58
           +LLTKRFAK+FKL              NKY+ ++  V +YK YL + I+ Y+S      +
Sbjct: 1   MLLTKRFAKLFKLTFLVLILCGLFVVTNKYMDENTSVKDYKKYLLDNINSYSSKHSSSSD 60

Query: 59  PPAVVPSPPQKGRDREPMTDVSRQPASKKELQRRQKLQDFYSQVFKYLHLYSPKGKSTRV 118
                 S   KG D+                   +KL+ FY+ VF +L L SP GKS R 
Sbjct: 61  NAGADDSSSLKGNDK----------------VSNEKLKSFYNNVFNFLMLDSPTGKSARK 104

Query: 119 YDPRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLVLP 178
           Y+  C+L GDIG R D Y+  +KL++ EL +CL LS  E A L ++H  +V++++SL LP
Sbjct: 105 YNEACQLSGDIGDRPDQYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIASLALP 164

Query: 179 KDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYN 238
           K +YKG+GI TVGGGKFSL++FLIIKTLRNM TTLPVEVLIPP DEGE++FC+ +LP YN
Sbjct: 165 KGTYKGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYN 224

Query: 239 AKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPY 298
           AKCIY+SD+LP   ++ F FKGYQFKSL+++ASSFENLLLLDADNFPIKPLD+IF+EEPY
Sbjct: 225 AKCIYVSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPY 284

Query: 299 KSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLH 358
            STG+V+WPDFWRRTT+P YY+IADI ++   RVRN  D++TPP +YT++  DL  VPL 
Sbjct: 285 LSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLS 344

Query: 359 DLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIA 418
           DLDGTIPDVSTESGQLMI+K+ HL T LLSL+YNVNGP+WYYPIFSQKAAGEGDKETFIA
Sbjct: 345 DLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIA 404

Query: 419 GANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSG- 477
            ANFYGL FYQVK+ T V+GYH  D +GF GVAMLQHDFVQDY RY  A K I  +Y   
Sbjct: 405 AANFYGLSFYQVKTRTGVEGYH--DKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDI 462

Query: 478 KTSNSIHLDKDYTPESFYRKYFEGDDIK---EVDIMFVHSNLPKFDPLTLWREKDLIVNG 534
           K+S +I  DK+Y+ E + +++F+ +D+K    VD+MF+HSNLPKFDP TL     L  + 
Sbjct: 463 KSSAAIKYDKNYSLEKYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLSETNFLTTDD 522

Query: 535 KHIRSYTNLKRLNGYDLELESFKVFQDYLCVQRSHFKYLDEHLQEE-AQWQSMCDYIHNR 593
           K  RS+T L ++  YD+ELE+FKV ++Y+C +++ FKYLD+ L E+  +W+ MCDYI  R
Sbjct: 523 KPARSFTALHKVQNYDIELENFKVLKEYVCDKKNPFKYLDDKLGEDKKEWRRMCDYIAKR 582

Query: 594 LKFLDSTHKDAVS 606
           L+FL+STH   ++
Sbjct: 583 LQFLESTHDKVIA 595

>KLLA0E17755g Chr5 complement(1572985..1574901) [1917 bp, 638 aa]
           {ON} similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 638

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/645 (53%), Positives = 450/645 (69%), Gaps = 51/645 (7%)

Query: 1   MVLLTKRFAKVFKLAAXXXXXXXXXXXXNKYISQDLPVDEY----KSYLQNYIDKYT-SG 55
           MV  TKRF KVFK+              + Y+  ++  ++Y    K Y Q +I++Y  +G
Sbjct: 1   MVFTTKRFQKVFKVVVAFALAVVVLNSIHVYLKSEIATNDYTSSLKEYTQQFIEEYEDTG 60

Query: 56  SGNPPAVVPSPPQKGRDREPMTDVSRQP------------------------------AS 85
           S    A   +  Q+G  +   T+ +                                 AS
Sbjct: 61  SSYDDARQEASQQQGDKQGSQTNTNGDSNNKINGDKIKNNNNYYNENNNDGVVKDNVGAS 120

Query: 86  KKELQRRQKLQDFYSQVFKYLHLYSPKGKSTRVYDPRCKLDGDIGARLDDYDNWFKLTSE 145
                +++++Q FY QVFKYL  + P G +   Y+ +C L+GDIG R ++ D W+KLT+E
Sbjct: 121 STPSSKKKQVQGFYGQVFKYLKEFGPVGVNIATYNQKCSLNGDIGYRQENTDQWWKLTTE 180

Query: 146 ELGQCLMLSTREKAMLKENHAKFVENLSSLVLPKDSYKGNGIVTVGGGKFSLLAFLIIKT 205
           EL  CL LS  ++ MLKE H+ +V  LS LVLPKD+Y G+GIVTVGGGKFS++AFLIIKT
Sbjct: 181 ELNNCLQLSQEQRLMLKEAHSNYVHALSKLVLPKDTYSGDGIVTVGGGKFSMMAFLIIKT 240

Query: 206 LRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKCIYISDVLPQSLVDNFEFKGYQFKS 265
           +RN  TTLPVEV IPP DEG+ +FC+VLLP+YNAKCIY+SD  P  L++  +FKGYQFKS
Sbjct: 241 VRNFGTTLPVEVFIPPSDEGDDEFCNVLLPQYNAKCIYLSDAFPPDLIEKSDFKGYQFKS 300

Query: 266 LSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIP 325
           L+IIASSF+NLLLLDADNFPIKPLD IF+E+ YK TG++LWPDFWRRTT+P+YY IA+ P
Sbjct: 301 LAIIASSFKNLLLLDADNFPIKPLDGIFEEKSYKDTGLILWPDFWRRTTHPSYYSIANTP 360

Query: 326 ISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTV 385
           IS ++R+RN +D++TPP +YT+D++DLS+VPLHDLDGTIPD STESGQLMI+K  H PTV
Sbjct: 361 IS-SERIRNTMDDVTPPSVYTKDLKDLSDVPLHDLDGTIPDASTESGQLMINKLKHFPTV 419

Query: 386 LLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDGYHQPDGK 445
           LLSLYYNV GPSWYY IFSQ+++GEGDKETFIA A+FY LPFYQV+S   VDGYH+ + +
Sbjct: 420 LLSLYYNVYGPSWYYSIFSQRSSGEGDKETFIAAAHFYDLPFYQVRSEPRVDGYHRHNNE 479

Query: 446 GFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTSNSIHLDKDYTP-----ESFYRKYFE 500
           GFRGV MLQHDF QDY+RY+ A  +I T+Y+ +         DY P     E++  KYF 
Sbjct: 480 GFRGVCMLQHDFAQDYKRYRQAQNEIGTKYTNEPD-------DYDPKYNYQENYLGKYFT 532

Query: 501 GDDIKEVDIMFVHSNLPKFDPLTLWREKDLIVNGKHIRSYTNLKRLNGYDLELESFKVFQ 560
            D    VD+MFVHS+LPKFDP+ L   +DLI +GKHIRSY NLKR+NGYDLELE FK F+
Sbjct: 533 ND---PVDVMFVHSHLPKFDPVELALSQDLIQDGKHIRSYRNLKRMNGYDLELEVFKTFK 589

Query: 561 DYLCVQRSHFKYLDEHLQEEAQWQSMCDYIHNRLKFLDSTHKDAV 605
           +Y+C +R HFKY ++ ++ E+ W  +C+Y++ RL +L  +H +A+
Sbjct: 590 EYVCDKRVHFKYFEKAVKLESNWGIICNYVNERLVYLIESHSEAM 634

>Skud_2.127 Chr2 complement(241232..243022) [1791 bp, 596 aa] {ON}
           YBR015C (REAL)
          Length = 596

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/610 (57%), Positives = 447/610 (73%), Gaps = 21/610 (3%)

Query: 2   VLLTKRFAKVFKLAAXXXXXXXXXXXXNKYISQDLPVDEYKSYLQNYIDKYTSGSGNPPA 61
           +LLTKRF+K+FKLA             NKY+ ++  V EYKSYLQ+Y+D +++   +  A
Sbjct: 1   MLLTKRFSKLFKLAFIALILCGLFVITNKYMDENTSVREYKSYLQDYLDSHSNKHPSTDA 60

Query: 62  VVPSPPQKGRDREPMTDVSRQPASKKELQRRQKLQDFYSQVFKYLHLYSPKGKSTRVYDP 121
                        P+TD S           R KL+DFY +VF +L L SP GKS R Y  
Sbjct: 61  -------------PVTDDSSSSKVNDNAATR-KLKDFYDKVFNFLILDSPTGKSARNYGK 106

Query: 122 RCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLVLPKDS 181
            C L+GDIG R D Y+   KL++++L +CL LS  E + L ++H  +VE++++L+LPK +
Sbjct: 107 ACLLNGDIGDRPDQYEELHKLSAKQLSKCLELSPDEISRLTKSHRDYVEHIATLLLPKGT 166

Query: 182 YKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKC 241
           YKG+GI TVGGGKFSL+AFLIIKTLRN  T LPVEVLIPP DEGE++FC+ +LPKYN+KC
Sbjct: 167 YKGSGIATVGGGKFSLMAFLIIKTLRNRGTNLPVEVLIPPGDEGESEFCNKILPKYNSKC 226

Query: 242 IYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKST 301
           IY+SD+LP   +  F F+GYQFKSL++IASSFENLLLLDADNFPIK LD+IF+EEPY ST
Sbjct: 227 IYVSDILPVETIKKFHFEGYQFKSLALIASSFENLLLLDADNFPIKSLDNIFNEEPYVST 286

Query: 302 GMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHDLD 361
           G+V+WPDFWRRTT+P YY+IA IP++ NKRVRN  D+ITPP +YT+D+++L +VPL DLD
Sbjct: 287 GLVMWPDFWRRTTHPLYYEIAGIPVNMNKRVRNSQDDITPPAVYTKDLKNLDDVPLSDLD 346

Query: 362 GTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGAN 421
           GTIPDVSTESGQLMI+KS  L T LLSL+YNVNGP+WYYPIFSQKAAGEGDKETFIA AN
Sbjct: 347 GTIPDVSTESGQLMINKSKQLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAAN 406

Query: 422 FYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSG-KTS 480
           FYG PFYQV++ T V+GYH+   K F GVAMLQHDFVQDY RY  A K    +Y+  K+S
Sbjct: 407 FYGEPFYQVRTRTGVEGYHE--NKDFHGVAMLQHDFVQDYSRYLIASKKTNDKYNTMKSS 464

Query: 481 NSIHLDKDYTPESFYRKYFEGDDI---KEVDIMFVHSNLPKFDPLTLWREKDLIVNGKHI 537
            SI  DK Y+ E+++ ++FE +D      VD+MF+HSNLPKFDP  L     L ++ K  
Sbjct: 465 ASIKFDKSYSFENYFEEFFENEDTNAKNHVDVMFIHSNLPKFDPYDLSETNFLTIDKKPA 524

Query: 538 RSYTNLKRLNGYDLELESFKVFQDYLCVQRSHFKYLDEHLQEE-AQWQSMCDYIHNRLKF 596
           RSYT L ++  YD+ELE+FK  ++Y+C  ++ FKYLD+ L E+  +W+ MCDYI  RL+F
Sbjct: 525 RSYTALHKIQNYDIELENFKALKEYVCTNKNPFKYLDDALGEDKVKWKKMCDYITERLEF 584

Query: 597 LDSTHKDAVS 606
           L+STH  A++
Sbjct: 585 LESTHDKAIA 594

>ZYRO0A04950g Chr1 complement(397314..399170) [1857 bp, 618 aa] {ON}
           similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 618

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/541 (58%), Positives = 408/541 (75%), Gaps = 2/541 (0%)

Query: 68  QKGRDREPMTDVSRQPASKKELQRRQKLQDFYSQVFKYLHLYSPKGKSTRVYDPRCKLDG 127
           Q+  D++   D +   +S        KL+ FY +VF +L  +SP+GKS R+Y   C L G
Sbjct: 77  QQAVDQQHTQDHASTQSSTLGPDSTAKLKRFYEEVFTHLKNFSPEGKSQRIYKEDCPLHG 136

Query: 128 DIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLVLPKDSYKGNGI 187
           DIG R ++YD W  L  + L  CL +S  E  MLK+NHA +V+ L SL LPK+ YKG GI
Sbjct: 137 DIGFRPENYDEWPTLAHDSLENCLEISPEEVTMLKKNHAAYVDVLGSLRLPKNVYKGKGI 196

Query: 188 VTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKCIYISDV 247
           VTVGGGKFSLLA L+I+++R + TTLPVEV IPP D GE  FCD +LP+YNAKC+Y+SDV
Sbjct: 197 VTVGGGKFSLLALLVIRSMRELGTTLPVEVFIPPSDLGENQFCDEILPQYNAKCVYLSDV 256

Query: 248 LPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWP 307
           LP +++ N +F GYQFKSLS+IASSFE++L LDADNFP+K L+D+FD  PYK+TG VLWP
Sbjct: 257 LPPNVIANSQFTGYQFKSLSLIASSFEDVLFLDADNFPVKRLNDVFDLAPYKTTGFVLWP 316

Query: 308 DFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHDLDGTIPDV 367
           DFWRRTT P YYDIADI ++  KR+RNC D++TPPE+YT++ + + ++P HD +GTIPDV
Sbjct: 317 DFWRRTTQPIYYDIADITVNRRKRIRNCFDDLTPPEVYTKNTKSMDDIPFHDFEGTIPDV 376

Query: 368 STESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPF 427
           STESGQLMISKS+HLPT+LL+LYYNVNGPSWYYP+FSQ+AAGEGDKETF+A ANFYGLPF
Sbjct: 377 STESGQLMISKSTHLPTILLALYYNVNGPSWYYPMFSQRAAGEGDKETFLAAANFYGLPF 436

Query: 428 YQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTSNSIHLDK 487
           YQVK+AT V+GYH+ + +GFRGVAMLQHD  QDY RYQ A   I  +Y GKT+ SI  DK
Sbjct: 437 YQVKTATGVEGYHRANNEGFRGVAMLQHDLNQDYLRYQAAADAIEAKYGGKTAKSIKYDK 496

Query: 488 DYTPESFYRKYF--EGDDIKEVDIMFVHSNLPKFDPLTLWREKDLIVNGKHIRSYTNLKR 545
            Y+ ++FY+ +F  E   +KE D+MF HS+ PKFDP  LW + +L+ +GKH RSYT+L++
Sbjct: 497 LYSLDNFYKTFFGSENSALKECDVMFAHSHAPKFDPYGLWTQNELVQDGKHFRSYTSLEK 556

Query: 546 LNGYDLELESFKVFQDYLCVQRSHFKYLDEHLQEEAQWQSMCDYIHNRLKFLDSTHKDAV 605
           +N YDLEL +      ++C+ + +FKYL E +Q + + Q MCDYI  R +FL STH+ A+
Sbjct: 557 INNYDLELSAIDSIHKFVCLDKVNFKYLSEKIQSKQEHQEMCDYISKRREFLLSTHQQAI 616

Query: 606 S 606
           S
Sbjct: 617 S 617

>NCAS0E01590 Chr5 (302992..304818) [1827 bp, 608 aa] {ON} Anc_3.188
          Length = 608

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/614 (54%), Positives = 444/614 (72%), Gaps = 13/614 (2%)

Query: 1   MVLLTKRFAKVFKLAAXXXXXXXXXXXXNK-YISQDLPVDEYKSYLQNYIDKYTSGS-GN 58
           MVLL +RF++VFKLA             N    S+ + V +YK YLQNYI+  +  +  +
Sbjct: 1   MVLLRRRFSRVFKLALLLSIVGAGLFFFNSGQYSESISVKDYKEYLQNYINSNSDPTPSS 60

Query: 59  PPAVVPSPPQKGRDREPMTDVSRQPASKKELQRR-QKLQDFYSQVFKYLHLYSPKGKSTR 117
            P     P    +D     +  +   S    +   +K++ F++ VF+++  YSPKGK+ +
Sbjct: 61  SPNAAKQPAANLKDESNKNNNKKNGGSVGSPKTHDEKMKAFFNTVFQHIIDYSPKGKTKK 120

Query: 118 VYDP-RCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLV 176
           +Y+  +C LDGD+G+R ++Y +W+KL+ + LG CL +S  E   LK +HA F ENL+ LV
Sbjct: 121 IYNKEKCLLDGDVGSRPENYKDWYKLSYKNLGNCLEVSDTEFTNLKTSHASFTENLNKLV 180

Query: 177 LPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKD-EGETDFCDVLLP 235
           LPK +YKG+GIV VGGGKFSLL++L+IKT+RN+ TTLP+EV IPP + EGE++FC   + 
Sbjct: 181 LPKGTYKGDGIVLVGGGKFSLLSYLVIKTIRNLGTTLPIEVFIPPNEVEGESEFCSQTIS 240

Query: 236 KYNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDE 295
             +AKCIYISD+LP+ +V  FEFKGYQFKSL+IIASSFENLLLLDADN PIK L+ IF +
Sbjct: 241 DLDAKCIYISDILPKDMVSKFEFKGYQFKSLAIIASSFENLLLLDADNTPIKNLNTIFKQ 300

Query: 296 EPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNV 355
           EPY S G+VLWPDFWRRTT P YY IA IP++  KRVRN ID++TP  +YT+   D+ ++
Sbjct: 301 EPYASRGLVLWPDFWRRTTQPIYYKIAGIPVNLQKRVRNDIDDLTPVGVYTK--PDMVDI 358

Query: 356 PLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKET 415
           P HD +GT+PDVSTESGQLM++KS HL TVLL+LYYNVNGP+WYYPIFSQKAAGEGDKET
Sbjct: 359 PFHDFEGTMPDVSTESGQLMVNKSKHLATVLLALYYNVNGPNWYYPIFSQKAAGEGDKET 418

Query: 416 FIAGANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQY 475
           FIAGANFY LP+YQVKS   VDGYH+ +  GFRGVAMLQHDFVQDY RY+ A  DI  +Y
Sbjct: 419 FIAGANFYDLPYYQVKSKVGVDGYHRKE--GFRGVAMLQHDFVQDYNRYKLASADIAREY 476

Query: 476 SGKTSNSIHLDKDYTPESFYRKYFEGDDIKEVDIMFVHSNLPKFDPLTLWREKDLIVNGK 535
           S  +  S+  DK YT + FY KYF+  D +++D+MF+HSNLPKFDPL LW++ DLI +GK
Sbjct: 477 SNPS--SVVFDKSYTVQKFYDKYFDNTD-EDIDVMFIHSNLPKFDPLPLWKDNDLIEDGK 533

Query: 536 HIRSYTNLKRLNGYDLELESFKVFQDYLCVQRSHFKYLDEHLQEEAQWQ-SMCDYIHNRL 594
            +RSYTNL++L  +D+E E+FK  ++ LC +   FKYL +  +   Q + S C YI +R 
Sbjct: 534 PVRSYTNLRKLGYHDIEYENFKTLKELLCEKNVDFKYLADEFKSNPQARMSFCKYITDRY 593

Query: 595 KFLDSTHKDAVSVA 608
           K+L+ TH++A+S +
Sbjct: 594 KYLEETHQEALSAS 607

>TPHA0A04380 Chr1 (982546..984474) [1929 bp, 642 aa] {ON} Anc_3.188
           YBR015C
          Length = 642

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/586 (56%), Positives = 423/586 (72%), Gaps = 29/586 (4%)

Query: 38  VDEYKSYLQNYIDKYTSGSGNPPAVVPSPPQKG---RDREPMTDVSRQPASK-------- 86
           ++EY +YL+ ++ +   GS N  A   S   KG   + +  +   S+ PA+         
Sbjct: 57  LNEYSNYLKGFLKQDNEGSVNYGA--NSHSGKGNSDKSKGSLAQGSKPPATSFSENAKTV 114

Query: 87  ----KELQRRQKLQDFYSQVFKYLHLYSPKGKSTRVYDPRCKLDGDIGARLDDYDNWFKL 142
                   R + L++FYSQVF  +  YSP GK  R Y   C L  +I  R ++ ++WFKL
Sbjct: 115 EKNVNSSDRTKLLKEFYSQVFDSIRKYSPVGKCARKYKESCILTDNIPDRPENSEHWFKL 174

Query: 143 TSEELGQCLMLSTREKAMLKENHAKFVENLSSLVLPKDSYKGNGIVTVGGGKFSLLAFLI 202
           T + L  CL  +  E  MLK  H  FV ++S L LPK  Y   GIV VGGGKFS+LAFLI
Sbjct: 175 TKKALENCLEFTPDEFKMLKSTHDNFVNSISKLTLPKQGYSKQGIVMVGGGKFSMLAFLI 234

Query: 203 IKTLRNMHTTLPVEVLIPPKDEGETD-FCDVLLPKYNAKCIYISDVLPQSLVDNFEFKGY 261
           IKTLRN+ TTLPVEV IPP DE E D FC  +LP +NAKCI+ISDVLP+  +  F+FKGY
Sbjct: 235 IKTLRNLGTTLPVEVFIPPVDEAEKDDFCKDVLPNFNAKCIFISDVLPEEQIKTFDFKGY 294

Query: 262 QFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDI 321
           QFKSL++I+SSFE+LLLLDADNFP+K LD+IFD+EPYKS G++LWPDFWRRTT P YY I
Sbjct: 295 QFKSLALISSSFEDLLLLDADNFPVKNLDNIFDQEPYKSKGLILWPDFWRRTTTPVYYQI 354

Query: 322 ADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHDLDGTIPDVSTESGQLMISKSSH 381
           AD+P+ Y KRVRN ID++TPPE+YT   E+L  VPLHDL GTIPD STESGQL+I+K  H
Sbjct: 355 ADVPVDYTKRVRNSIDDLTPPEIYT---ENLDTVPLHDLQGTIPDPSTESGQLLINKKQH 411

Query: 382 LPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDGYHQ 441
           +PT+LLSLYYN+NGP+WYYP+F+QKAAGEGDKETFIA A +Y LPFYQVK+ T VDGYHQ
Sbjct: 412 VPTLLLSLYYNINGPNWYYPMFTQKAAGEGDKETFIAAAVYYDLPFYQVKTKTGVDGYHQ 471

Query: 442 PDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTSNSIHLDKDYTPESFYRKY--- 498
            D KGFRGVAMLQHDFVQDY+R+  A   I++ Y  KT  S   DK+Y+ E +Y+ Y   
Sbjct: 472 ADNKGFRGVAMLQHDFVQDYKRFLKAKDKIQSIY--KTVESRIFDKNYSLEDYYKNYILK 529

Query: 499 ---FEGDDIKEVDIMFVHSNLPKFDPLTLWREKDLIVNGKHIRSYTNLKRLNGYDLELES 555
              F+ +D  EVDIMFVHSNLPKFDP++LW++ +LIVNG+HIR Y  +++LN YD+ELE+
Sbjct: 530 TNSFDKNDEGEVDIMFVHSNLPKFDPISLWKQNELIVNGEHIRGYRAIEKLNNYDIELEN 589

Query: 556 FKVFQDYLCVQRSHFKYLDEHLQEEAQWQSMCDYIHNRLKFLDSTH 601
           FK F  YLCV+++ F ++++HL+ E   +SMCDYI +RL++L+ TH
Sbjct: 590 FKTFNQYLCVEKTKFVHVEKHLENEQDRKSMCDYIKSRLEYLEKTH 635

>Ecym_5314 Chr5 complement(634571..636418) [1848 bp, 615 aa] {ON}
           similar to Ashbya gossypii AER018C
          Length = 615

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/622 (53%), Positives = 436/622 (70%), Gaps = 27/622 (4%)

Query: 3   LLTKRFAKVFKLAAXXXXXXXXXXXXNKYISQDLPVDEYKSYLQNYIDKYTSGSGNPPAV 62
           +LT+RF+K  +L              N+ I+ +L      +YL+++I     G G    +
Sbjct: 1   MLTRRFSKTLRLTVLTLIVCSLFLISNRTITGELS-QSIHAYLEDWI-VLNGGDGKDRQI 58

Query: 63  VPS--PPQKGRDREPMTDVSRQPASKK---------------ELQRRQKLQDFYSQVFKY 105
           +        G D       SR   ++K               E  R+ KL+ FY +VF  
Sbjct: 59  LQEVIDAINGEDETHRESASRSDNAEKSIPDKLLSHSTPTAEEESRQAKLRGFYEKVFNM 118

Query: 106 LHLYSPKGKSTRVYDPRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENH 165
           L  ++P G S+++    C+L  DIG RL+D   W+KL+ E L +CL +S +++ MLK+ H
Sbjct: 119 LSKHAPSGSSSKIRGENCQLTKDIGGRLEDQKWWYKLSYEHLSKCLQVSRKDRKMLKKKH 178

Query: 166 AKFVENLSSLVLPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEG 225
           + +V +L+SLVLP DSY GNGIVTVGGGKFS+LAFL+I TLRN+ TTLPVEVLIPP +E 
Sbjct: 179 SDYVADLASLVLPLDSYTGNGIVTVGGGKFSVLAFLMITTLRNVGTTLPVEVLIPPNEES 238

Query: 226 ETDFCDVLLPKYNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFP 285
           E +FC+ +LP++NAKCIY+SDVLP+S++ +FE KGYQ KS +IIASSF+NLLLLDADN P
Sbjct: 239 EHEFCNNVLPEFNAKCIYLSDVLPKSVLTSFEVKGYQLKSFAIIASSFQNLLLLDADNLP 298

Query: 286 IKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELY 345
           IK LDDIF+ +PYKSTG+VLWPDFWRRTT+P YY++A IPI+YNKRVRN ID++TP  +Y
Sbjct: 299 IKNLDDIFESKPYKSTGLVLWPDFWRRTTSPIYYEVAGIPINYNKRVRNSIDDVTPASVY 358

Query: 346 TEDMEDLSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQ 405
           T +   LS VP+HDL+G IPD+STESGQLMISK +HL T LLSLYYNVNGP+WYYP+FSQ
Sbjct: 359 TSNPYSLSTVPMHDLEGAIPDMSTESGQLMISKRTHLGTALLSLYYNVNGPTWYYPLFSQ 418

Query: 406 KAAGEGDKETFIAGANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQ 465
            A+GEGDKETFIA A+FY LPFYQV++ T VDGYH+    G+RGVAMLQHDF QDY+RY 
Sbjct: 419 GASGEGDKETFIAAASFYQLPFYQVRTVTGVDGYHR--SSGYRGVAMLQHDFRQDYERYT 476

Query: 466 WAFKDIRTQYSGKTSNSIHLDKDYTPESFYRKYFEGDDIKE-VDIMFVHSNLPKFDPLTL 524
            + +D   +Y+   + S   +  Y    FY  YF   + +E +D+MFVHSNLPK +PL+L
Sbjct: 477 HSKEDTEAKYA---AGSAAYESSYNVNDFYNTYFGTYNSQEPLDVMFVHSNLPKLEPLSL 533

Query: 525 WREKDLIVNGKHIRSYTNLKRLNGYDLELESFKVFQDYLCVQRSHFKYLDEHLQEEAQWQ 584
               DL+ +G+HIRSY+NLKRL+GYD+EL SF+ F +YLC +R  FKY ++ L +E  W 
Sbjct: 534 --STDLMEDGQHIRSYSNLKRLHGYDIELRSFQTFNEYLCDKRVKFKYYEKTLIDEESWT 591

Query: 585 SMCDYIHNRLKFLDSTHKDAVS 606
           SMCDYI  RL FL+ TH +A++
Sbjct: 592 SMCDYIKGRLSFLERTHDEALN 613

>KNAG0K01290 Chr11 (254881..256716) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/523 (58%), Positives = 398/523 (76%), Gaps = 15/523 (2%)

Query: 94  KLQDFYSQVFKYLHLYSPKGKSTRVYDPRCKLDGDIGARLDDYDNWFKLTSEELGQCLML 153
           KL+ FYS+VF+ +  +SP G + + Y P C+L+GDIG+R DDY N+ +L  + L  CL L
Sbjct: 91  KLKKFYSRVFQNIIDFSPSGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLNL 150

Query: 154 STREKAMLKENHAKFVENLSSLVLPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTL 213
           S  + + L+ +H  FV++L  + LP +SYKG+GIVTVGGGKFSL+AFLI++ +R M TTL
Sbjct: 151 SGADISNLRHSHKSFVDSLD-VTLPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTL 209

Query: 214 PVEVLIPPKDEGETDFCDVLLPKYNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSF 273
           PVEV IPP +  ET+FC  LLPKYNAKCI+I  +LP  ++  F+F+GYQFKSL+++ASSF
Sbjct: 210 PVEVFIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASSF 269

Query: 274 ENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVR 333
           EN LLLDADNFP+KPL+ IF+EEP+KS G+VLWPDFWRRTT P YYDIA +P++   RVR
Sbjct: 270 ENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVR 329

Query: 334 NCIDNITPPELYTEDMEDLSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNV 393
           N  D++TPPE+YTE+M DLS VP HDL+GT+PDVSTESGQLM++K+ HL T+LL+LYYNV
Sbjct: 330 NSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNV 389

Query: 394 NGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAML 453
           NGP+WYYPIFSQKAAGEGDKETFIA ANFYGLPFYQVKS+T+VDGY + +G+ F GVAML
Sbjct: 390 NGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGYFE-NGE-FHGVAML 447

Query: 454 QHDFVQDYQRYQWAFKDIRTQYS-GKTSNS-----IHLDKDYTPESFYRKYFEGDDIKEV 507
           Q+D VQDY+ YQ A  DI  +Y   +  NS     I  DK Y+ E F  KYF  D     
Sbjct: 448 QYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSLEDFKNKYFRED--SHN 505

Query: 508 DIMFVHSNLPKFDPLTLWREKDLI-VNGKHIRSYTNLKRLNGYDLELESFKVFQDYLCVQ 566
           D+MF+HSN PKFDPL+LW+ + L+  +G H RSYTNL++   +D+ELE+FK+F+++ C  
Sbjct: 506 DVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIELENFKIFKNFFCGD 565

Query: 567 R--SHFKYLDEHLQEE-AQWQSMCDYIHNRLKFLDSTHKDAVS 606
           +  S+F YL + L++    W  MC+YI+ RL FL+ TH +AV+
Sbjct: 566 QKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHLEAVN 608

>NCAS0A03650 Chr1 complement(729502..731325) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/612 (50%), Positives = 423/612 (69%), Gaps = 32/612 (5%)

Query: 1   MVLLTKRFAKVFKLAAXXXXXXXXXXXXNKYISQDLPVDEYKSYLQNYIDKYTSGSGNPP 60
           M +L +RF+KVFKL              +     D    +YK YL++YI      + N  
Sbjct: 23  MAVLRRRFSKVFKLTLLFCLIAVGLIFFHLGQYSDAVPTQYKDYLKSYI------TSNST 76

Query: 61  AVVPSPPQKGRDREPMTDVSRQPASKKELQRRQKLQDFYSQVFKYLHLYSPKGKSTRVYD 120
           + V +            D+ ++ +S         ++ F+  VF+++  YSP GKS R+Y+
Sbjct: 77  SSVSAEH----------DIEQENSSS---YNDNNIKSFFDTVFQHILDYSPTGKSERIYN 123

Query: 121 -PRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLVLPK 179
             +C L+  +G   D+Y +W+KL+ E LG CL +S  E   L+ NHA F+E +  L LP 
Sbjct: 124 KEKCLLNSVVGYSPDNYKDWYKLSYENLGNCLEISDDEYTNLQSNHASFIEEMDKLTLPN 183

Query: 180 DSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKD-EGETDFCDVLLPKYN 238
           D Y+G+GIV V GGKFSLL++L++KT+R   TTLPVEV IPP + E E +FC  +L +++
Sbjct: 184 DIYQGDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLNEFD 243

Query: 239 AKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPY 298
           AKC+YISD+LP+S++ +F+FKGYQFKSL+IIASSFENLLLLDADNFP+K LD+IF +EPY
Sbjct: 244 AKCVYISDILPESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPY 303

Query: 299 KSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLH 358
            +TG++LWPDFWRRTT P +Y+IA I ++  KRVRN IDN+TP ++Y +  +++ +VP H
Sbjct: 304 TTTGLILWPDFWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYDKSDQEM-DVPYH 362

Query: 359 DLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIA 418
           D +G +PDVSTESG+LM++K  HL TVLL+LYYNVNGP+WYYPIFSQ  AGEGDKETFIA
Sbjct: 363 DFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGDKETFIA 422

Query: 419 GANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGK 478
           GA FY LPFYQVK+   VDGYH+ D  GFRGVAMLQHDFVQDY RY+ A   I  +Y   
Sbjct: 423 GATFYNLPFYQVKTKVGVDGYHKED--GFRGVAMLQHDFVQDYDRYKLAQLKIDKKY--L 478

Query: 479 TSNSIHLDKDYTPESFYRKYF--EGDDIKEVDIMFVHSNLPKFDPLTLWREKDLIVNGKH 536
            SN +  DKDYT + FY +YF  EG+   E D++FVHS+LPKFDP++LW++ DLI +GKH
Sbjct: 479 PSNEVLYDKDYTVQKFYDEYFNIEGN---ETDVLFVHSHLPKFDPVSLWKDNDLIKDGKH 535

Query: 537 IRSYTNLKRLNGYDLELESFKVFQDYLCVQRSHFKYLDEHLQEEAQWQS-MCDYIHNRLK 595
           +RSYTNL +   YD+E E+FK  ++ LC   +HF Y+DE  +++ + ++  C YI +R +
Sbjct: 536 LRSYTNLNKFGYYDIEYENFKTMKELLCESDTHFYYIDEAFKDKPEEKADFCKYIVDRYE 595

Query: 596 FLDSTHKDAVSV 607
           FL+ TH    SV
Sbjct: 596 FLNETHDAVTSV 607

>CAGL0I04532g Chr9 (404659..406497) [1839 bp, 612 aa] {ON} similar
           to uniprot|P38069 Saccharomyces cerevisiae YBR015c TTP1
           type II membrane protein
          Length = 612

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/615 (50%), Positives = 408/615 (66%), Gaps = 19/615 (3%)

Query: 3   LLTKRFAKVFKLAAXXXXXXXXXXXXNKYISQDLPVDEYKSYLQNYIDKYTSGSGNPPAV 62
           +  +RFAK+ KL              + +I  D          Q Y+D +     +  + 
Sbjct: 1   MFNRRFAKLVKLVLITVSIVGGLYYLSGFIDGDTSTALGNRLSQEYMDSFWKTYDSSKSS 60

Query: 63  VPSPPQKGRDREPMTDVSRQPASKKELQRRQKLQDFYSQVFKYLHLYSPKGKSTRVYDPR 122
             S    G   +  TD  R P +K       K++DFY  VF+++  YSP GK+ R +D  
Sbjct: 61  YGSSLLGGSGEKGETDF-RSPEAK------LKIKDFYKTVFEHILDYSPAGKTAREFDDS 113

Query: 123 CKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLVLPKDSY 182
           C   GDI  R D Y NW KL+  +L  C+ +S  E   L+ NH  +V+ ++ LVLPK SY
Sbjct: 114 CFDSGDISTRPDSYKNWKKLSYHQLSHCMKISPSEINHLRGNHKSYVDKINELVLPKGSY 173

Query: 183 KGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKCI 242
           KG GIVTVGGGKF+L+A  +IK LR + TTLPVEV IPP DEGE+ FC+ +LP+YNAKCI
Sbjct: 174 KGEGIVTVGGGKFTLMALTMIKALRTLGTTLPVEVFIPP-DEGESTFCESVLPQYNAKCI 232

Query: 243 YISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTG 302
           YISD+LP  ++  F FKGYQFKSL++I SSFENLLLLDADN P+K +D IF+ + ++S G
Sbjct: 233 YISDILPDDMIQKFTFKGYQFKSLAMITSSFENLLLLDADNIPVKKIDHIFESQIFRSAG 292

Query: 303 MVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHDLDG 362
           ++LWPDFWRRTT PAYY+IA++P + NKRVRN  D+ITPPE+YT+   DLS VP HD++G
Sbjct: 293 LILWPDFWRRTTMPAYYEIANLPYNQNKRVRNAFDDITPPEVYTKPDGDLSEVPFHDMEG 352

Query: 363 TIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANF 422
           T+PD STESGQL+ISK+ HLPT+LLSLYYNVNGP+WYYPIFSQ+ AGEGDKETFI+ A+F
Sbjct: 353 TLPDPSTESGQLLISKAKHLPTLLLSLYYNVNGPNWYYPIFSQRTAGEGDKETFISAASF 412

Query: 423 YGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTS-- 480
           Y L +YQVK++  VDGY + DG G+RGV MLQHDF+QD ++Y  AF+   T+Y+   S  
Sbjct: 413 YSLSYYQVKTSVGVDGYFRHDGSGYRGVGMLQHDFIQDSKQYMEAFEYSNTKYNNLRSEK 472

Query: 481 NSIHLDKDYTPESFYRKYF-----EGDDIKEVDIMFVHSNLPKFDPLTLWREKDLIVNGK 535
            SI  D  Y P  F+ K+F     +G D  + D+MFVH NLPKFDP   W   DL+   K
Sbjct: 473 GSISYDPSYDPNEFFDKFFSRKKPDGGDESKADVMFVHCNLPKFDPYVSWDTNDLVYQTK 532

Query: 536 HIRSYTNLKRLNGYDLELESFKVFQDYLCV---QRSHFKYLDEHLQEEAQWQSMCDYIHN 592
           H RS+ N K +  +D+ELE+FK F + LC     +  FKYLD  L EE +W  MCDYI  
Sbjct: 533 HFRSFNNKKVIAQFDIELENFKFFNETLCPYENGKGKFKYLDNKLSEE-RWPQMCDYISK 591

Query: 593 RLKFLDSTHKDAVSV 607
           RL++L  +H +A+ +
Sbjct: 592 RLQYLKESHNEALGL 606

>NDAI0G01790 Chr7 (392941..394764) [1824 bp, 607 aa] {ON} Anc_3.188
          Length = 607

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/613 (51%), Positives = 410/613 (66%), Gaps = 19/613 (3%)

Query: 2   VLLTKRFAKVFKLAAXXXXXXXXXXXXNKYISQD--LPVDEYKSYLQNYIDKYTSGSGNP 59
           +  T++FA++ K+                  S +  + V EYK YLQ YI+K        
Sbjct: 1   MFFTRKFARLLKITTILCLLCFFCIWIPSEYSTNSSISVQEYKEYLQGYINKL------- 53

Query: 60  PAVVPSPPQKGRDREPMTDVSRQPASKKELQRRQKLQDFYSQVFKYLHLYSPKGKSTRVY 119
           P    S       +E    VS +        ++  ++DFY+ VF+ +  YSP GK+ R Y
Sbjct: 54  PIQSNSNVNDDTQKEFQHLVSGENKEDIPSIKKNTVEDFYNVVFQNIIDYSPSGKTARNY 113

Query: 120 DPRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLVLPK 179
             +CKLD  I +R D Y +W KL+ + L  CL +S  E   L  +H  FVE+++ LVLPK
Sbjct: 114 SSKCKLDQGIASRPDSYKDWEKLSMQNLLNCLEVSPEEFTNLSTSHHNFVEHVNKLVLPK 173

Query: 180 DSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDE-GETDFCDV-LLPKY 237
            +Y  +GIV VGGGKF+ +A+L++KTLRN  TTLPVE+ IPP D   E  FC   +L + 
Sbjct: 174 GTYNNDGIVMVGGGKFTFMAYLVLKTLRNQGTTLPVEIFIPPIDTVKEETFCKSEMLSEL 233

Query: 238 NAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEP 297
           +AKCIY+S++LPQ +++ F+FKGYQFKSL+IIASSFENLLLLDADNFPIK LD IF  EP
Sbjct: 234 SAKCIYMSNILPQEMIEKFDFKGYQFKSLAIIASSFENLLLLDADNFPIKSLDKIFKHEP 293

Query: 298 YKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPL 357
           Y STG+V+WPDFWRRTT P YY +ADI ++  KRVRN ID+ITP ++Y++D  D + +P 
Sbjct: 294 YNSTGLVMWPDFWRRTTQPIYYKLADIYVNVLKRVRNDIDDITPTKVYSDDNFDFTKIPF 353

Query: 358 HDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFI 417
           HD +GT+PD STESGQLMI+KS HLPTVLL+LYYNVNGP+WYYPIFSQ A GEGDKETFI
Sbjct: 354 HDFEGTMPDDSTESGQLMINKSKHLPTVLLALYYNVNGPNWYYPIFSQNAHGEGDKETFI 413

Query: 418 AGANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSG 477
           A A FY LPFYQV++    DGYH  D   F+GVAM QHDF+QDY+ YQ A ++I+ +YS 
Sbjct: 414 AAATFYRLPFYQVRTKVGADGYHTKD--RFQGVAMAQHDFIQDYEHYQIAQREIKKRYSN 471

Query: 478 KTSNSIHLDKDYTPESFYRKYFEGDDIK--EVDIMFVHSNLPKFDPLTLWREKDLI-VNG 534
                I  D +Y  + FY ++F  D  K  E+DIMF+HSNLPKFDPL LW +  LI   G
Sbjct: 472 --VKDIKYDAEYAVQKFYDEFFNKDTTKYGEIDIMFLHSNLPKFDPLKLWEDSALIDETG 529

Query: 535 KHIRSYTNLKRLNGYDLELESFKVFQDYLCVQRSHFKYLDEHLQEEAQ-WQSMCDYIHNR 593
           KH RS+++ K +  YD+E E+FK+ +D +C +  HF YLDE LQE+ Q W SMC YI +R
Sbjct: 530 KHFRSFSDPKIVKKYDIEYENFKIIKDVICDKGIHFSYLDEELQEKPQDWVSMCQYIKDR 589

Query: 594 LKFLDSTHKDAVS 606
             FL  TH+DA S
Sbjct: 590 YIFLKDTHQDATS 602

>AER018C Chr5 complement(661035..662855) [1821 bp, 606 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR015C
           (MNN2)
          Length = 606

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/611 (48%), Positives = 422/611 (69%), Gaps = 16/611 (2%)

Query: 3   LLTKRFAKVFKLAAXXXXXXXXXXXXNKYISQDLPVDEYKSYLQNYIDKYTSGSGNPPAV 62
           +L ++++K  KL+             N+++  + P   Y  YLQN +    S  G    +
Sbjct: 1   MLRRKYSKTLKLSLITVALGALFLVTNRWLPGEFP-SVYTEYLQNRLPNLGS-FGKQQHM 58

Query: 63  VPSPPQ------KGRDREPMTDVSRQPASKKE-LQRRQKLQDFYSQVFKYLHLYSPKGKS 115
                Q      +G  R   +++  + A++ E  +R+ ++  FY +VF+ L  +SP G+ 
Sbjct: 59  EEQESQTRQMIEEGEMRSKPSELLEEEAARTEQAERKSQIFAFYQKVFELLAEHSPSGQI 118

Query: 116 TRVYDPRCKLDGDI-GARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSS 174
           +     +C++   +    LDD  +W  LT E L +CL ++ ++K M+ + H  +V+ LS+
Sbjct: 119 SHKSGRQCQVSQVVLQGHLDDTSHWPLLTREHLSKCLKMTQKDKQMVSDKHMHYVDALSN 178

Query: 175 LVLPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLL 234
           L L K +Y G GIVTVGGGKFS+LA L+IK+LR + T+LPVEVLIPP +E E D+C  LL
Sbjct: 179 LKLSKRAYSGAGIVTVGGGKFSMLALLLIKSLRKVGTSLPVEVLIPPGEEEEYDYCSKLL 238

Query: 235 PKYNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFD 294
           P+  AKCIY+ DVLP ++++N  F+GYQ KS +IIASSF++LLLLDADN PI  LDDIF 
Sbjct: 239 PEVGAKCIYLKDVLPPAVINNHYFEGYQLKSAAIIASSFKDLLLLDADNIPILNLDDIFQ 298

Query: 295 EEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSN 354
            +PY   G+VLWPDFWRR+T+P YY+IA + + YN+RVRN IDN+TP  +YT++M+DLS+
Sbjct: 299 SKPYVEHGLVLWPDFWRRSTSPDYYEIARVQVDYNRRVRNHIDNLTPASVYTQNMKDLSS 358

Query: 355 VPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKE 414
           +P+HD++GT+PD STESGQL+I K  HL TVLLSLYYNVNG +WYYP+FSQ A GEGDKE
Sbjct: 359 IPMHDMEGTLPDPSTESGQLLIDKERHLSTVLLSLYYNVNGETWYYPLFSQGAPGEGDKE 418

Query: 415 TFIAGANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQ 474
           TFIA ANFY  P+YQV+++T  +GYH    KGF GVAMLQHDF +DY+RY+ A +D++T+
Sbjct: 419 TFIAAANFYRKPYYQVRTSTGAEGYH--TKKGFSGVAMLQHDFREDYRRYEAAREDVKTK 476

Query: 475 YSGKTSNSIHLDKDYTPESFYRKYFEGDDIKEVDIMFVHSNLPKFDPLTLWREKDLIVNG 534
           Y    + S   D +YT E FY+KYFE  +   VD+MFVH+NLPKF+PL +  ++ L+ NG
Sbjct: 477 Y----AKSQQYDPEYTVEGFYKKYFEDPNQPPVDVMFVHANLPKFEPLKMSEKQLLMENG 532

Query: 535 KHIRSYTNLKRLNGYDLELESFKVFQDYLCVQRSHFKYLDEHLQEEAQWQSMCDYIHNRL 594
            H RSY++L +L+ YD+ELESF+V  +YLCV++   K+  + L   A+W SMC Y+ +RL
Sbjct: 533 SHFRSYSHLDKLHNYDIELESFRVLNEYLCVRKVQLKFYKDKLSRPAKWNSMCKYVEDRL 592

Query: 595 KFLDSTHKDAV 605
           KFL+STH++A+
Sbjct: 593 KFLESTHEEAL 603

>Kpol_1036.50 s1036 complement(135897..137927) [2031 bp, 676 aa]
           {ON} complement(135897..137927) [2031 nt, 677 aa]
          Length = 676

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/524 (60%), Positives = 400/524 (76%), Gaps = 11/524 (2%)

Query: 90  QRRQKLQDFYSQVFKYLHLYSPKGKSTRVYDPRCKLDGDIGARLDDYDNWFKLTSEELGQ 149
           +  + L+ FY +VF+ +  +SP GKS R Y   C L+GDIG R + Y+ W+KL+ +ELG 
Sbjct: 153 ENTKSLKQFYGRVFELIQAHSPLGKSKRNYKEACLLNGDIGDRPEFYEVWYKLSMKELGN 212

Query: 150 CLMLSTREKAMLKENHAKFVENLSSLVLPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNM 209
           CL +S  E + LK  HAK++ ++SSL LP++S++G GIV VGGGKFSLL+FLII  +RN 
Sbjct: 213 CLEISKAEMSKLKAKHAKYIADISSLSLPRNSFRGKGIVIVGGGKFSLLSFLIINAIRNQ 272

Query: 210 HTTLPVEVLIPPKDEGE-TDFCDVLLPKYNAKCIYISDVLPQSLVDNFEFKGYQFKSLSI 268
            TTLPVEV +P  D+GE  +FC  LLP+ NAKCIY+SDVLP+  +D F+F GYQFKS+++
Sbjct: 273 GTTLPVEVFMP-NDKGEDAEFCK-LLPELNAKCIYLSDVLPEETIDQFKFGGYQFKSIAL 330

Query: 269 IASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISY 328
           + SSF++LLLLDADN+PIK LD+IF +EPYKSTG+VLWPDFWRRTT P YY IA I ++ 
Sbjct: 331 LLSSFDDLLLLDADNYPIKNLDEIFTKEPYKSTGLVLWPDFWRRTTTPFYYKIAGITVNS 390

Query: 329 NKRVRNCIDNITPPELYTEDMEDLSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLS 388
            KRVRN ID+ITPPE+YTE+M +L NVPLHDL+G+IPD STESGQLMI+KS HL T+LLS
Sbjct: 391 KKRVRNSIDDITPPEVYTENMGNLVNVPLHDLEGSIPDGSTESGQLMINKSKHLATILLS 450

Query: 389 LYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDGYHQPDGKGFR 448
           LYYNVNGP+WYYP+FSQKAAGEGDKETF+A A F  LPFYQVK+ T VDGYHQ D KGFR
Sbjct: 451 LYYNVNGPNWYYPMFSQKAAGEGDKETFVAAAVFNKLPFYQVKTNTGVDGYHQADNKGFR 510

Query: 449 GVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTSNSIHLDKDYTPESFYRKYFEGDD----- 503
           GVAMLQ DF QDY RY+ A + I  QY  K  N    DK Y+   FYRKY   +D     
Sbjct: 511 GVAMLQFDFHQDYLRYKRAKEAIEYQYQDK--NLRTYDKRYSLNDFYRKYIMINDDRNGG 568

Query: 504 IKEVDIMFVHSNLPKFDPLTLWREKDLIVNGKHIRSYTNLKRLNGYDLELESFKVFQDYL 563
             E D+MFVHSNLPKFDP+ LWR +DLI +GKHIRS+ NL+RLN YD+ELE+F +F  +L
Sbjct: 569 TSEADVMFVHSNLPKFDPVGLWRGQDLIEHGKHIRSFRNLQRLNNYDIELENFTIFYKHL 628

Query: 564 CVQRSHFKYLDEHLQE-EAQWQSMCDYIHNRLKFLDSTHKDAVS 606
           C++R  FKYL++ L + E  W+ MC YI +R+ FL+ +H+ A++
Sbjct: 629 CLKRRSFKYLEDELGDNEEDWKDMCKYIKDRVTFLNMSHQRAIT 672

>NDAI0A06500 Chr1 complement(1475305..1477218) [1914 bp, 637 aa]
           {ON} Anc_3.188
          Length = 637

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/548 (50%), Positives = 380/548 (69%), Gaps = 11/548 (2%)

Query: 59  PPAVVPSPPQKGRDREPMTDVSRQPASKKELQRRQKLQDFYSQVFKYLHLYSPKGKSTRV 118
           P   + SP   G         S   AS +E    + +  F+ QVF Y++ +SP+ K    
Sbjct: 98  PKTTILSPETIG--------TSGTVASTEEKPSTETIHKFFDQVFNYINEFSPETKLDIK 149

Query: 119 YDPRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLVLP 178
           Y+P   +   IG+R +D  N+FKL+   L  CL +S +E  MLK  H  F  +++ L LP
Sbjct: 150 YNPSRLVTDAIGSRRNDVKNFFKLSRNSLYDCLQISDQEIDMLKNYHQGFTNSIAPLELP 209

Query: 179 KDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYN 238
           K++Y+ +GIV VGGGK+SLL+ L IKTLR  +TTLPVEV I   +EG+ +FCD +LP+YN
Sbjct: 210 KNTYQNDGIVIVGGGKYSLLSLLAIKTLRKFNTTLPVEVYISQDEEGDLEFCDEILPQYN 269

Query: 239 AKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPY 298
           AKCI I ++L   L++ F+F GYQ+KSL++++SSFENLLLLDADNFPIKPLDDIF +EPY
Sbjct: 270 AKCISIKNILSNDLINTFKFAGYQYKSLAVLSSSFENLLLLDADNFPIKPLDDIFKQEPY 329

Query: 299 KSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLH 358
            S  MV+WPDFWRRTT+P+YYDIA I ++ + R+RN  D++TP  +YT+  + L  +P H
Sbjct: 330 LSKRMVMWPDFWRRTTHPSYYDIAHIFVNKSSRIRNSYDDVTPSNVYTDYSKSLDEIPFH 389

Query: 359 DLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIA 418
           D +GT+PD+STESGQL+++K  HL  +LL+LYYNVNGP+WYYPIFSQ  AGEGDKETF+A
Sbjct: 390 DFEGTLPDLSTESGQLLLNKKEHLKAILLALYYNVNGPNWYYPIFSQGVAGEGDKETFLA 449

Query: 419 GANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGK 478
           GANFY L +YQVK+   V G+   +   +RGVA+LQ DFV DY+RY  A  DI ++Y   
Sbjct: 450 GANFYNLTYYQVKTYPRVSGHFNKEDGSYRGVAILQSDFVDDYKRYSHAMDDINSKYKDL 509

Query: 479 TSNSIHLDKDYTPESFYRKYFEGDDIKEVDIMFVHSNLPKFDPLTLWREKDLIVNGKHIR 538
           + N I LD+DY  ++F  KYFE +  K+ D+MF+H+N PKFDP+ L      I  GKH R
Sbjct: 510 SPNEIKLDEDYDLQNFLDKYFELEG-KQADVMFIHANFPKFDPVDLESGSSFIHEGKHFR 568

Query: 539 SYTNLKRLNGYDLELESFKVFQDYLCVQRSHFKYLDEHLQEEAQWQSMCDYIHNRLKFLD 598
           S+ NLK +  YDLELE+FK+  + +CV+R HFKY+D+   EE     +C YI +RLKFL+
Sbjct: 569 SFDNLKDIKYYDLELETFKILNNIICVERKHFKYIDDKGVEER--GKVCKYIEDRLKFLE 626

Query: 599 STHKDAVS 606
            TH++A++
Sbjct: 627 ETHEEAIT 634

>TPHA0C04560 Chr3 (983249..984970) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/517 (52%), Positives = 363/517 (70%), Gaps = 10/517 (1%)

Query: 99  YSQVFKYLHLYSPKGKSTRVYDPRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREK 158
           +S +F  +  +SP  +  R  +  C LDG +G   +D  NW +L+ + +  CL LS  E 
Sbjct: 60  FSSIFDAIKKHSPDKEVVRKKNDNCLLDGTVGTGNNDVKNWHRLSQKSMEGCLELSDSEI 119

Query: 159 AMLKENHAKFVENLSSLVLPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVL 218
             LK  H  ++++L  + + K  YKG GI  VGGGKFSLLAFL++KT+R   TTLP+E+ 
Sbjct: 120 NTLKSKHDAYIQSLEEIAVEKIHYKGKGIAIVGGGKFSLLAFLVVKTIRKFETTLPIEIF 179

Query: 219 IPPKD-EGETDFCDVLLPKYNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLL 277
           IPP+D E E +FC  LLP+ NAKCIY+SD+LP   +  +EFK YQ+KSL+I+ASSF++LL
Sbjct: 180 IPPQDVEDELEFCQQLLPEDNAKCIYLSDILPSQDIKKYEFKRYQYKSLAILASSFDDLL 239

Query: 278 LLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCID 337
           L+DADNFPIK LD IFD EPY STG++LWPDFWRR+ NP +Y+I  I +   KRVRN ID
Sbjct: 240 LIDADNFPIKNLDGIFDNEPYTSTGLILWPDFWRRSANPKFYEITGIELDTKKRVRNAID 299

Query: 338 NITPPELYTEDMEDLSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPS 397
           ++TPPE+YTED   L++VP HD  GT+PD STESGQ+MI+K  H+ T+LL+LYYNVNGPS
Sbjct: 300 DLTPPEVYTEDFSKLADVPFHDFSGTLPDPSTESGQMMINKGKHMKTLLLALYYNVNGPS 359

Query: 398 WYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDF 457
           WYYPI SQ AAGEGDKET IA A      FYQVK  T V+GYHQ +G+GFRGVAMLQHDF
Sbjct: 360 WYYPILSQGAAGEGDKETVIAAALHNKAKFYQVKFKTGVEGYHQSNGRGFRGVAMLQHDF 419

Query: 458 VQDYQRYQWAFKDIRTQYSGKTSNSIHLDKDYTPESFYRKYFE--GDDIKE----VDIMF 511
           VQD+ RY+ A   I+  YS  T +    D  Y+ ++FY KY      DI E    +D++F
Sbjct: 420 VQDFARYEDATARIKELYS--TESFKQFDSGYSIDAFYEKYISQVNTDIPEEKRKIDVLF 477

Query: 512 VHSNLPKFDPLTLWREKDLIVNGKHIRSYTNLKRLNGYDLELESFKVFQDYLCVQRSHFK 571
           VHS+LPKFDP+ LW+ +DLI +GKH RSYT+LK++N +D+EL++F++F  Y+C     F 
Sbjct: 478 VHSHLPKFDPVPLWQSQDLIEDGKHFRSYTSLKKINYFDIELQNFEIFDKYICQDTIAFP 537

Query: 572 YLDEHLQEEAQWQSMCDYIHNRLKFLDSTHKDAVSVA 608
           Y+   ++ +A    +C+YI NRL +L  TH+   SVA
Sbjct: 538 YIKNEVK-DADMPDLCNYIKNRLSYLQETHESVTSVA 573

>Kpol_1045.70 s1045 complement(162608..164461) [1854 bp, 617 aa]
           {ON} complement(162610..164463) [1854 nt, 618 aa]
          Length = 617

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/524 (51%), Positives = 373/524 (71%), Gaps = 8/524 (1%)

Query: 87  KELQRRQKLQDFYSQVFKYLHLYSPKGKSTRVYDPRCKLDGDIGARLDDYDNWFKLTSEE 146
           +E + R+ ++ FYS+V+  L    P+G S R Y   C LD DIG R +D   W  LT + 
Sbjct: 98  EEKRLRENMKTFYSKVYDLLRSAGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDN 157

Query: 147 LGQCLMLSTREKAMLKENHAKFVENLSSLVLPKDSYKGNGIVTVGGGKFSLLAFLIIKTL 206
           L +CL +     AMLK +H K+++ L  L    D Y G+GIV V GGKFSLL+ L+IKT+
Sbjct: 158 LSKCLQIDEESLAMLKNSHRKYIDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTI 217

Query: 207 RNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKCIYISDVLPQSLV-DNFEFKGYQFKS 265
           RN+   LP+EV IPP DEG+ + C+ LLPKYNAKCI++SD LP+  + ++ +  GYQ K 
Sbjct: 218 RNLKINLPIEVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKV 277

Query: 266 LSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIP 325
           ++I ASSF+N+LLLDADN+PIK +DDIF  EPY S G++ WPD+WRR+T+P+YYDI D  
Sbjct: 278 VAIAASSFKNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRD 337

Query: 326 ISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTV 385
           IS N+RVRN +D+ITPP +YTED+++  ++P+HD +GT+PDVSTESGQLMI+K  HL ++
Sbjct: 338 ISQNERVRNNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSL 397

Query: 386 LLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDGYHQPDGK 445
           LL++YYN+ GP+WYYPI +QKA+GEGDKETFIAGANF+ LPFYQVK     DGY +P   
Sbjct: 398 LLAMYYNMYGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRP--G 455

Query: 446 GFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTSNSIHLDKDYTPESFYRKYFEGDDIK 505
           G+RGVAM QHDF+QDY  Y+ A   I  +Y     + I  DK+Y+P  F  K+FE +   
Sbjct: 456 GYRGVAMFQHDFIQDYTAYENAKTFIEKKYPNTKQDKI--DKEYSPFDFTDKFFEDEHAD 513

Query: 506 EV-DIMFVHSNLPKFDPLTLWREKDLIVNGKHIRSYTNLKRLNGYDLELESFKVFQDYLC 564
            V D+MFVH++LPKF+P+ LW E DL+ +G H+RSYT   +LN YDLE+E+FK  ++ LC
Sbjct: 514 PVIDVMFVHAHLPKFEPVALWEENDLMQDGSHVRSYTKYDKLNHYDLEMENFKALEELLC 573

Query: 565 VQRS-HFKYLDEHLQEEAQ-WQSMCDYIHNRLKFLDSTHKDAVS 606
           +++   FKYL + L ++ + WQ +C YI +R  F++ TH++  S
Sbjct: 574 LEKPFEFKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHEEHFS 617

>KAFR0E01030 Chr5 (212679..214601) [1923 bp, 640 aa] {ON} 
          Length = 640

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/625 (46%), Positives = 405/625 (64%), Gaps = 34/625 (5%)

Query: 1   MVLLTKRFAKVFKLAAXXXXXXXXXXXXNKYISQDLPVDEYKSYLQNYIDKYTSGSGNPP 60
           M+ ++++F++V KL                   QD  +D YKS +++Y++ YT+G  N P
Sbjct: 1   MLRISRKFSRVAKLTVLFLCLLTIFIVTTSNYQQD-TLDSYKSKVKSYLNYYTNG--NMP 57

Query: 61  A--------------VVPSPPQKGRDREPMTDVSRQPASKKE-LQRRQKLQDFYSQVFKY 105
                          V PS  +         D + +    +E +++   +Q+FY ++F  
Sbjct: 58  TTHVAEEEEEEEEEEVAPSSQEAPLFDNDDDDNNDELVEVQEQVEKFDTIQEFYDEIFNA 117

Query: 106 LHLYSPKGKSTRVYDPRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENH 165
           +   SP  +S +VY   C +D  IG R  D+ +W KLT + L +CL LS  E  ML   H
Sbjct: 118 IISNSPTEESKKVYGKECIVDTSIGGRPGDHKDWHKLTYDNLSKCLQLSDEEVDMLHTKH 177

Query: 166 AKFVENLSSLV------LPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLI 219
             +V  ++ +V      L     K NGIV VGGGK+SLL+ L + T+R   TTLPVEV I
Sbjct: 178 KSYVSAINQIVEDSKELLNGQRTKKNGIVMVGGGKYSLLSLLSVMTIRKFGTTLPVEVFI 237

Query: 220 PPKDEGETDF---CDVLLPKYNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENL 276
           P  DE + DF   C+ LLP+YNAKCI+ S+VL + L++NF F GYQ KSL+++ASSF+N+
Sbjct: 238 PRDDELKGDFQSFCNELLPQYNAKCIFTSNVLSEKLIENFHFNGYQHKSLALLASSFDNI 297

Query: 277 LLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCI 336
           LLLD+DN PIK LD IF  EP+   GMVLWPDFWRRTT+P +Y IA IPI+ N RVRNCI
Sbjct: 298 LLLDSDNHPIKNLDSIFKAEPFVKNGMVLWPDFWRRTTSPKFYQIAGIPINKNTRVRNCI 357

Query: 337 DNITPPELYTEDMEDLSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGP 396
           D++TP E+Y  +  ++ +VP HD +GT PD+S+ESGQL+I+++ HL ++LL+LYYN NGP
Sbjct: 358 DDLTPLEVYNNEEINIYDVPFHDTEGTFPDMSSESGQLLINRNRHLKSILLALYYNYNGP 417

Query: 397 SWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHD 456
           +WYY IFSQ AAGEGDKETFIAGA+FYGLP+YQVK+  +V GYHQP    FRGVA+LQHD
Sbjct: 418 AWYYSIFSQGAAGEGDKETFIAGAHFYGLPYYQVKTFPSVSGYHQPGNSEFRGVAILQHD 477

Query: 457 FVQDYQRYQWAFKDIRTQYSGKTSNSIHLDKDYTPESFYRKYFEGD----DIKEVDIMFV 512
            VQDYQRYQ A   +   Y  +   ++  D++Y+  +FY KYF+G     D+KEVD  FV
Sbjct: 478 LVQDYQRYQEASIGLGKTY--EFPENVTYDENYSLGTFYNKYFDGGNNEPDVKEVDFAFV 535

Query: 513 HSNLPKFDPLTLWREKDLIVNGKHIRSYTNLKRLNGYDLELESFKVFQDYLCVQRSHFKY 572
           H+N PKFDP++L      I  G+H RS+T+L +LNGYD+E E+F    D++CV R +F Y
Sbjct: 536 HANFPKFDPVSLAEGSSFIFEGQHFRSFTDLTKLNGYDIEYENFVTLHDFVCVNRKYFPY 595

Query: 573 LDEHLQEEAQWQSMCDYIHNRLKFL 597
           +++ + +E +++ MC YI +RL+FL
Sbjct: 596 IEKSISKE-EYEKMCRYISDRLQFL 619

>KNAG0K01300 Chr11 (257271..259064) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/617 (45%), Positives = 391/617 (63%), Gaps = 48/617 (7%)

Query: 3   LLTKRFAKVFKLAAXXXXXXXXXXXXNKYISQDLP--VDEYKSYLQNYIDKYTSGSGNPP 60
           +L +R AK+FK                 +   D P  VDEYK +LQ Y+     G+ N  
Sbjct: 9   MLNRRLAKLFKAVFFLVIVCLVCAGLTHHF-HDGPKTVDEYKEFLQGYL----GGNANTT 63

Query: 61  AVVPSPPQKGRDREPMTDVSRQPASKKELQRRQKLQDFYSQVFKYLHLYSPKGKSTRVYD 120
             V                         +    K++ +Y+ VF+ L L+SPKG++ R Y 
Sbjct: 64  VTV-------------------------VNDADKIKSYYNTVFENLLLFSPKGETARAYG 98

Query: 121 PRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLVLPKD 180
            +C L+  IG   D+   + +L+ E L  CL LS  E + LK +H  FV++L  +  PK 
Sbjct: 99  DKCILNEAIGTTSDNIPKFERLSYENLLDCLKLSNEELSALKLSHNFFVQSLD-VKYPKG 157

Query: 181 SYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAK 240
            Y+G+GIV VGGGK+SL+A+L+IK LR+  T+LPVEV IPP +E ET+FC+  LP+ NA+
Sbjct: 158 MYQGDGIVMVGGGKYSLMAYLVIKHLRSSGTSLPVEVFIPPNEEDETEFCETALPELNAQ 217

Query: 241 CIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKS 300
           CI+I  +LP +++  F FKGYQFKSL++++SSFEN+LLLDADN+P++ LDDIF +EP+KS
Sbjct: 218 CIFIDRILPSAMIKTFHFKGYQFKSLALVSSSFENVLLLDADNYPVRRLDDIFKQEPFKS 277

Query: 301 TGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHDL 360
           TG++LWPDFWRRTT P +Y+I+ + I     VR   D++TPPE+Y     D S +P++D 
Sbjct: 278 TGLILWPDFWRRTTTPLFYNISGVAIDLTSPVRYSFDDLTPPEVYFNSTMDRSKIPVNDF 337

Query: 361 DGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGA 420
            G +PDVSTESGQL+I+K +HL T+LLSLYYNVNGP+WYYPI +Q+A GEGDK+TFIA A
Sbjct: 338 AGAMPDVSTESGQLLINKRTHLKTILLSLYYNVNGPAWYYPIIAQRAPGEGDKDTFIAAA 397

Query: 421 NFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQY----- 475
           NFYGLP+YQVK+   +DGY + DG+ + GV MLQ+DFVQDY+ YQ A +DI  +Y     
Sbjct: 398 NFYGLPWYQVKTRVGIDGYSE-DGQ-YHGVGMLQYDFVQDYELYQSARRDITAKYGVAGP 455

Query: 476 --SGKTSNSIHLDKDYTPESFYRKYFEGDDIKEVDIMFVHSNLPKFDPLTLWREKDLI-V 532
             +G+  + I  D++Y+ ++F  KYF  +      +MF+H+N PKFDPL+LW++K  I  
Sbjct: 456 SKTGQLRSEIAYDENYSLDTFEEKYFNKEKSGH-KVMFIHANFPKFDPLSLWQDKKFINK 514

Query: 533 NGKHIRSYTNLKRLNGYDLELESFKVFQDYLCV---QRSHFKYLDEHLQEEAQ-WQSMCD 588
            G   R+Y NL + N +D+EL +F  F+   C      + F Y++  LQ      +SMC 
Sbjct: 515 QGSTYRTYNNLGKFNYWDIELYNFNSFETLFCSGADSVTWFPYMNRALQGNTNDRESMCS 574

Query: 589 YIHNRLKFLDSTHKDAV 605
           YI  RL  L+ TH +A 
Sbjct: 575 YIRMRLDHLEQTHHEAT 591

>SAKL0C04598g Chr3 (447448..449283) [1836 bp, 611 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186W MNN5
           Alpha-1 2-mannosyltransferase responsible for addition
           of the second alpha-1 2-linked mannose of the branches
           on the mannan backbone of oligosaccharides localizes to
           an early Golgi compartment
          Length = 611

 Score =  422 bits (1086), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 241/532 (45%), Positives = 328/532 (61%), Gaps = 32/532 (6%)

Query: 97  DFYSQVFKYLHLYSP----KGKSTRVYDPRCKLDGDIGARLDDYDNWFKLTSEELGQCLM 152
           + YS++F YL  Y P    K K+  +    C +  D+G  L D   +  L    L +C  
Sbjct: 88  ELYSKLFGYLQRYKPVAPPKDKAA-LRQSGCVMR-DVG--LADDSRFSNLAYNNLDRCYN 143

Query: 153 LSTREKAMLKENHAKFVENLS--------SLVLPKDSYKGNGIVTVGGGKFSLLAFLIIK 204
           LS  +   L  NHAK+V  L         S +L K      GIVTVGGG+FSLL+  +I+
Sbjct: 144 LSPEQFDSLHSNHAKYVSKLKKEFELGPDSPLLDKLFPNEKGIVTVGGGRFSLLSLTMIR 203

Query: 205 TLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKCIYISDVLPQSLVDNFEFKGYQFK 264
            LR   TTLPVEV+IPP DEGE DFC+ +LP  N  C+Y SDVL +S ++   F+ YQ K
Sbjct: 204 VLRERGTTLPVEVVIPPADEGEDDFCNNVLPALNGTCVYFSDVLSKSTLNQVTFERYQIK 263

Query: 265 SLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADI 324
            ++++ SSF+N + LDADNF IKPLD+IF+ E Y   G+VLWPD WRR T P +Y+++D+
Sbjct: 264 GVALLLSSFKNTIFLDADNFAIKPLDNIFESEAYLEHGLVLWPDLWRRVTAPVFYNVSDV 323

Query: 325 PISYNKRVRNCIDNITPPELYTEDMEDL----SNVPLHDLDGTIPDVSTESGQLMISKSS 380
            +   KR R   D++TP   Y +   DL    + VPLHDLDG IPD S+ESGQ+++ K  
Sbjct: 324 ELDLTKRARFIGDDVTPASKYHKPDADLAYNKAEVPLHDLDGAIPDPSSESGQMIVDKRE 383

Query: 381 HLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDGY- 439
           H  T+LL+LYYN  GP WYY +FSQ  +GEGDKETF+A A+    P+YQVKS     GY 
Sbjct: 384 HFQTLLLALYYNYYGPDWYYRMFSQGTSGEGDKETFVAAAHVLSKPYYQVKSKLGFAGYW 443

Query: 440 -HQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTSNSIHLDKDYTPES-FYRK 497
               DG GF+G A+LQHDFVQDY +++ A + +R+ Y   T      D +Y  E  FY+K
Sbjct: 444 DEYTDG-GFKGAALLQHDFVQDYGQHKKALEVVRSNYDEYT----RFDPNYNSEKDFYKK 498

Query: 498 YFEGDDIKEVDIMFVHSNLPKFDPLTLWREKD-LIVNGK-HIRSYTNLKRLNGYDLELES 555
               D  +E D+MFVH++  KFDP  L+R K  L  +GK   RSY +LKRL G+DLEL +
Sbjct: 499 LMVPDGKEETDVMFVHASFHKFDPWDLYRRKTYLKPDGKSQFRSYRDLKRLGGFDLELFN 558

Query: 556 FKVFQDYLCVQRS-HFKYLDEHLQEEAQWQSMCDYIHNRLKFLDSTHKDAVS 606
           F+V +D LC  +   FKYL + +  + +W  MC+Y+H+R++FL  TH +A+ 
Sbjct: 559 FEVLEDALCAGKQIGFKYLQDKVTSQ-EWPGMCEYVHDRVQFLKETHAEALG 609

>KAFR0G00280 Chr7 (92838..94577) [1740 bp, 579 aa] {ON} Anc_1.150
           YJL186W
          Length = 579

 Score =  412 bits (1058), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 222/538 (41%), Positives = 331/538 (61%), Gaps = 36/538 (6%)

Query: 98  FYSQVFKYLHLYSPKGKSTRVYDPR---CKLDGDIGARLDDYDNWFKLTSEELGQCLMLS 154
           FYS+V++ L    P    +     R   C L  D+G  ++D D + KL+ + L +C  LS
Sbjct: 48  FYSEVYELLISSKPMDPPSDKNSFRLTSCDLPKDVG--INDLDRFEKLSFDNLQRCYHLS 105

Query: 155 TREKAMLKENHAKFVENLSSLV------LPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRN 208
             +   L++ H+ +V+++  L+      + KD  K  GI+TVGGG++S+L F +I+ LR 
Sbjct: 106 NEQAQDLQKAHSSYVKSIKDLIDNHSNIISKDDEKKKGILTVGGGRYSVLLFTMIQKLRE 165

Query: 209 MHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKCIYISDVLPQSLVDNFEFKGYQFKSLSI 268
             TTLPVEVLIPP+DEG+ +FC+V+LP++NAKCIY  D LP +L+D    K YQ K+L +
Sbjct: 166 TGTTLPVEVLIPPQDEGDDEFCNVILPQFNAKCIYFKDYLPPNLLDKLVLKSYQIKALGL 225

Query: 269 IASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISY 328
           + +SF  +L LDADN+P+K L+ IF+ E ++  G++ WPD WRR T PAYY+IADI  + 
Sbjct: 226 LMTSFNQILFLDADNYPMKNLNYIFETESFQKYGLITWPDIWRRYTPPAYYNIADIDFNL 285

Query: 329 NKRVRNCIDNITPPELYTEDMEDL------------SNVPLHDLDGTIPDVSTESGQLMI 376
            KRVR   D+I+P   Y +    L            S VP HDL+GTI D++TESGQ++I
Sbjct: 286 EKRVRFETDDISPVSRYDDIFPTLLNDERKLTEYTSSKVPFHDLEGTISDLTTESGQMLI 345

Query: 377 SKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAV 436
            K  HL T+LL+ YYN  GPSWYY +FS  ++GEGDKETFI+ A+  G P+YQVKS    
Sbjct: 346 DKKKHLDTLLLAFYYNFYGPSWYYNMFSLGSSGEGDKETFISAAHALGKPYYQVKSKVEF 405

Query: 437 DGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTSNSIHLDKDYTPES--- 493
           DG+   D  GF+G+ ++QHDF QDYQ ++ A  ++    +G        + DY  E+   
Sbjct: 406 DGFFH-DKDGFQGLGLMQHDFEQDYQVHKNAMLEV----AGNPDKYSKYESDYKLETSFT 460

Query: 494 --FYRKYFEGDDIKEVDIMFVHSNLPKFDPLTLW-REKDLIVNGKHIRSYTNLKRLNGYD 550
             F RKY    D+  VDIMFVH++  KF+PL L  + +  + +   +R +  + R+N +D
Sbjct: 461 DQFLRKYNNKKDL--VDIMFVHASFFKFEPLELHSKNRYYMSDNSPLRGFKRMDRMNNFD 518

Query: 551 LELESFKVFQDYLCVQRSHFKYLDEHLQEEAQWQSMCDYIHNRLKFLDSTHKDAVSVA 608
           LEL +F++ +D LC  +     + E   +  +W+S+C+Y+  R+ FL  TH++A++ A
Sbjct: 519 LELFNFQILRDNLCSTKPVAFKVYEDKYDTDEWKSVCEYLDKRVTFLKKTHEEAINAA 576

>NDAI0A00780 Chr1 (156271..158034) [1764 bp, 587 aa] {ON} Anc_1.150
          Length = 587

 Score =  411 bits (1056), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 221/530 (41%), Positives = 322/530 (60%), Gaps = 26/530 (4%)

Query: 95  LQDFYSQVFKYLHLYSPKGKSTRVYDPR----CKLDGDIGARLDDYDNWFK-LTSEELGQ 149
           ++ FY  +F  ++ Y P    +   D R    CK  GDI     D+D + + L+   L +
Sbjct: 62  VERFYIDLFNSINQYRPLNPPSNPDDLRDTEKCKWHGDISVH--DFDKFNEYLSYNNLNE 119

Query: 150 CLMLSTREKAMLKENHAKFVENLSSLVLPKDSY-------KGNGIVTVGGGKFSLLAFLI 202
           C  LS  +   LK +H+ FVE++ S    KD            GIVTVGGGK+++L   +
Sbjct: 120 CYKLSNIQLNNLKRSHSGFVESILSEFSTKDDKLTSGLFPNNEGIVTVGGGKYTVLLMTM 179

Query: 203 IKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKCIYISDVLPQSLVDNFEFKGYQ 262
           I+ LR   TTLP+EV+IPP+DEG+ +FC+ +LP YN KCIY  DVLP  L D    KG+Q
Sbjct: 180 IEKLRQSGTTLPLEVIIPPQDEGDDEFCNNVLPNYNGKCIYFKDVLPDQLSDKLVIKGFQ 239

Query: 263 FKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIA 322
            K L+I+ SSF+  L LDADN  +K LD+IF+ + +K   +++WPD WRR T PAYY IA
Sbjct: 240 LKPLAILLSSFKKALFLDADNLAMKDLDNIFNTQAFKQKRLIVWPDVWRRFTAPAYYKIA 299

Query: 323 DIPISYNKRVRNCIDNITPPELYTEDMED----LSNVPLHDLDGTIPDVSTESGQLMISK 378
           +I +   KR+RN  D+++PP  Y ++ E+    L NVP HDL GTIPD ++ESGQ++I K
Sbjct: 300 NIKLDLGKRIRNLNDDVSPPSRYDDNSENSAQYLENVPFHDLKGTIPDPTSESGQMVIDK 359

Query: 379 SSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDG 438
             H  T++LSLYYN+ GP WYY +FSQ  +G+GDKETFIA A+  G P+YQV +     G
Sbjct: 360 IEHFHTLILSLYYNLYGPPWYYRMFSQGTSGQGDKETFIAAAHALGKPYYQVHTKMGFKG 419

Query: 439 YHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTSNSIHLDKDYTPESFYRKY 498
           Y+  +  GF+GV +LQHDF QD+++ Q A K I    S  +       +DY     +   
Sbjct: 420 YND-EKLGFQGVGLLQHDFEQDFKQLQLASKTINENESEYSK----FKQDYKATVDFDDS 474

Query: 499 FEGDDIKEVDIMFVHSNLPKFDPLTLWREKDLIV-NGKHIRSYTNLKRLNGYDLELESFK 557
                   +DIMF+H++  K++PL L RE   +  +G H R ++ L+RLN +DLEL +FK
Sbjct: 475 LMKPIDGPIDIMFLHASFFKYEPLDLIREHRYVKEDGSHFRVFSGLERLNYFDLELFNFK 534

Query: 558 VFQDYLCVQRS-HFKYLDEHLQEEAQWQSMCDYIHNRLKFLDSTHKDAVS 606
           +   +LC +   HFKY  ++++ + +W  MC ++    ++L+STHK+A +
Sbjct: 535 ILNKFLCTEEMIHFKYY-KNVESKPEWSDMCKFLKEHTEYLESTHKEATA 583

>KLTH0F03938g Chr6 (351536..353224) [1689 bp, 562 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186W MNN5
           Alpha-1 2-mannosyltransferase responsible for addition
           of the second alpha-1 2-linked mannose of the branches
           on the mannan backbone of oligosaccharides localizes to
           an early Golgi compartment
          Length = 562

 Score =  405 bits (1041), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 218/534 (40%), Positives = 315/534 (58%), Gaps = 24/534 (4%)

Query: 91  RRQKLQDFYSQVFKYLHLYSPKGKSTRVYDPRCKLDGDIGARLDDYDNWFKLTSEELGQC 150
           R +   D +  + +Y  +  PK +   V    C++ G    R D  D    +  E L +C
Sbjct: 37  RERVYSDVFDALLQYRPVRPPKDRQAAVRQAGCEMKGVGVNRGDAVD---AMLYENLDRC 93

Query: 151 LMLSTREKAMLKENHAKFVENLS--------SLVLPKDSYKGNGIVTVGGGKFSLLAFLI 202
              +  +   L+  H+ F+  L         S V  +   +  G VTVGGG+FSLLA+ +
Sbjct: 94  YRPTKAQFEGLQAPHSAFLTQLRTTFAYEADSPVFERLFPRERGFVTVGGGRFSLLAYSM 153

Query: 203 IKTLRNMHTTLPVEVLIPPKDE-GETDFCDVLLPKYNAKCIYISDVLPQSLVDNFEFKGY 261
           ++ LR   + LP EV+IPP+D  GE  FC+ +LP+ NA+C++  D LP++LV+ ++F+ Y
Sbjct: 154 LRALRARGSKLPAEVVIPPQDAAGEEHFCNEVLPELNARCVFFEDALPRALVETWDFERY 213

Query: 262 QFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDI 321
           Q K+++++ SSF+ ++ +DAD+FPI+ LD +FD E  +  G+VLWPD WRR T P +Y +
Sbjct: 214 QIKAVALLLSSFKKIVFIDADDFPIQNLDSLFDSEVLREHGLVLWPDLWRRATAPVFYRL 273

Query: 322 ADIPISYNKRVRNCIDNITPPELYT---EDMEDLSNV-PLHDLDGTIPDVSTESGQLMIS 377
           A+I +   +RVRN  DN++P   YT   +D E L  + P HD  GT+PD +TESGQ++I 
Sbjct: 274 ANIDVDLRRRVRNMGDNLSPASRYTDPDQDPEQLQKIAPFHDFAGTVPDPTTESGQMVID 333

Query: 378 KSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVD 437
           K  H  T+LL+LYYNV GP WYY +FSQ  AGEGDKETF   A+  GLPFYQVK+  A D
Sbjct: 334 KVRHFQTLLLALYYNVYGPEWYYSLFSQGTAGEGDKETFATAAHVLGLPFYQVKNKLAFD 393

Query: 438 GYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTSNSIHLDKDYTPE-SFYR 496
           GY  P+G GFRGVA+ QHD V+DY  Y  A +DI  +     S       DY PE  FY+
Sbjct: 394 GYFHPNGDGFRGVALYQHDCVEDYLLYCRA-RDIIKENQDSFSA---YKPDYDPEPDFYK 449

Query: 497 KYFEGDDIKEVDIMFVHSNLPKFDPLTLWREKDLIVN-GKHIRSYTNLKRLNGYDLELES 555
                +   E+ +MF H++  KFDP  L+ EK  + N G H RS+ N+KR+  +D+EL  
Sbjct: 450 SLMAPEGHPEIPVMFAHASFHKFDPWQLYHEKVYLDNDGAHFRSFHNIKRIGNFDIELFV 509

Query: 556 FKVFQDYLCVQRS-HFKYLDEHLQEEAQWQSMCDYIHNRLKFLDSTHKDAVSVA 608
           F+  Q  +C      FKYL++     A W  +C Y+ +R+K+L  TH  AV + 
Sbjct: 510 FEGLQKAICSDNPIRFKYLEDKFI-HADWPKVCQYVEDRVKYLQDTHDPAVGLV 562

>Kwal_33.13693 s33 (354321..355997) [1677 bp, 558 aa] {ON} YJL186W
           (MNN5) - putative Golgi alpha-1,2-mannosyltransferase
           [contig 114] FULL
          Length = 558

 Score =  396 bits (1017), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 206/526 (39%), Positives = 319/526 (60%), Gaps = 29/526 (5%)

Query: 97  DFYSQVFKYLHLYSPKGKSTRVYDPRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTR 156
           D +S + K+  + +PK     V    C + G +G  ++  D+      E L  C   S  
Sbjct: 42  DLFSALEKHKPIDAPKNMREAVKQQGCNMKG-VG--VNKGDDVSPTVYENLDACFRPSKA 98

Query: 157 EKAMLKENHAKFVENLSSL------------VLPKDSYKGNGIVTVGGGKFSLLAFLIIK 204
           +   L+  H  ++  L S             + P D     G VTVGGG+FSLL++ +I+
Sbjct: 99  QFEGLQAPHTAYLAALRSTFNYQNEPGVFNELFPND----KGFVTVGGGRFSLLSYTMIR 154

Query: 205 TLRNMHTTLPVEVLIPPKDE-GETDFCDVLLPKYNAKCIYISDVLPQSLVDNFEFKGYQF 263
           T+R   +TLP+EV+IPP+DE GE  FC  +LPK N +C++  D LP S+V++++FK YQ 
Sbjct: 155 TMRERGSTLPIEVVIPPQDEKGEEHFCQEILPKLNGRCVFFGDTLPPSIVEDWKFKSYQI 214

Query: 264 KSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIAD 323
           K ++++ SSF+ ++ +DAD+ P+K LDD+F+ + +K  G+VLWPD WRR T P +Y +A+
Sbjct: 215 KVMALLLSSFKKIVFIDADDLPLKNLDDVFESKVFKKNGLVLWPDLWRRMTAPVFYRLAN 274

Query: 324 IPISYNKRVRNCIDNITPPELY-TEDMEDLSNVPLHDLDGTIPDVSTESGQLMISKSSHL 382
           I     KRVRN  D+I+P   Y   + ++   +P HD  GTIPD +TESGQ++I K  H 
Sbjct: 275 IDTDLTKRVRNLGDDISPVSRYLNPNAKEQKPIPFHDFAGTIPDPTTESGQMVIDKVRHF 334

Query: 383 PTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDGYHQP 442
            T+LL+LYYNV GP WYY +FSQ  AGEGDKETF + A+   LP+YQV++  + DGY  P
Sbjct: 335 QTLLLALYYNVYGPDWYYALFSQGTAGEGDKETFASAAHVLELPYYQVRTKLSFDGYSDP 394

Query: 443 DGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTSNSIHLDKDYTPE-SFYRKYFEG 501
              GFRGVA+ QHD  QDY+ Y+ A + +++Q    ++      +DY  E  FY+   + 
Sbjct: 395 KDGGFRGVALYQHDCTQDYETYEQARELVKSQPDKYSA----FKEDYDSEPDFYQSLMKP 450

Query: 502 DDIKEVDIMFVHSNLPKFDPLTLWREKD-LIVNGKHIRSYTNLKRLNGYDLELESFKVFQ 560
           +   EV++MF H++  KFDP  L++EK  L  +G   RS+  L R+  +D+EL +F+V +
Sbjct: 451 EGKPEVEVMFAHASFHKFDPWQLFKEKVYLNEDGTQFRSFRRLHRIKHFDIELFNFEVLE 510

Query: 561 DYLCVQRS-HFKYLDEHLQEEAQWQSMCDYIHNRLKFLDSTHKDAV 605
           + +C ++   F+Y ++  + E +W  +C Y+ +R+++L  TH +AV
Sbjct: 511 EAMCSEQPIRFRYFEDKFKRE-EWPKVCQYVKDRVEYLKKTHDEAV 555

>NCAS0B08450 Chr2 complement(1614300..1616060) [1761 bp, 586 aa]
           {ON} Anc_1.150
          Length = 586

 Score =  395 bits (1015), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 215/532 (40%), Positives = 326/532 (61%), Gaps = 26/532 (4%)

Query: 94  KLQDFYSQVFKYLHLYSPKGKSTRVYDPR----CKLDGDIGARLDDYDNWFKLTSEELGQ 149
           +++ FY  +F  ++ Y P        D R    CK  GDI    D  D   +L+ E L +
Sbjct: 56  QVEAFYLDLFNSINQYRPLNPPGNWEDLRDKDKCKWSGDISVNDDGRDANERLSMENLDE 115

Query: 150 CLMLSTREKAMLKENHAKFVENLSSLVLPKDSYKGN-------GIVTVGGGKFSLLAFLI 202
           C  LS+ +   LK  H+ +V+N+      K+    N       GIVT+GGG++++L   +
Sbjct: 116 CFKLSSIQLNNLKRAHSGYVKNIRDKFDDKNERLTNSLFPNNVGIVTIGGGRYTVLLMTM 175

Query: 203 IKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKCIYISDVLPQSLVDNFEFKGYQ 262
           I  LR+  T+LP+EV+IPP+DEG+ DFC+V+LPK+N KC++  DVLP  L      + YQ
Sbjct: 176 IAKLRDTGTSLPIEVIIPPEDEGDDDFCNVILPKWNGKCVFFKDVLPDELNKKLMLQSYQ 235

Query: 263 FKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIA 322
            K L+++ SSF+ +L LDADN+ +K LD IF+ EP+   G+++WPD+WRR T PAYY IA
Sbjct: 236 IKPLAVLLSSFKKILFLDADNYAMKDLDHIFESEPFIENGLIVWPDYWRRVTPPAYYKIA 295

Query: 323 DIPISYNKRVRNCIDNITPPELYTEDMED----LSNVPLHDLDGTIPDVSTESGQLMISK 378
           DI IS  KR+RN  D+ITPP  Y   ++D    L  VP+HDL+GTIPD ++ESGQ++I K
Sbjct: 296 DINISKKKRIRNINDDITPPSYYDNKLKDRDHLLKEVPMHDLEGTIPDPTSESGQMVIDK 355

Query: 379 SSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDG 438
             H  T+LLSLYYN+ GPSWYY IFSQ  +G+GDKETFIA A+    P+YQV ++  + G
Sbjct: 356 VKHFHTLLLSLYYNLYGPSWYYQIFSQGTSGQGDKETFIAAAHALNKPYYQVTTSLGLKG 415

Query: 439 YHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTSNSIHLDKDY-TPESFYRK 497
           +   +   FRG+ +LQ DF QDY ++Q   + I+      +       +DY   + F +K
Sbjct: 416 FFYEN--EFRGIGLLQRDFQQDYAQHQLVKQTIQDHLEEYSE----FKEDYKVADEFNKK 469

Query: 498 YFEGDDIKEVDIMFVHSNLPKFDPLTLWREKDLI-VNGKHIRSYTNLKRLNGYDLELESF 556
                + + +D+MFVH++  K++P  L+ E+  +  +G H R +++LK  N +D+EL +F
Sbjct: 470 LMIPPNGQPLDVMFVHASFYKYEPWDLYNERRYVNSDGTHFRGFSDLKEFNYFDMELFNF 529

Query: 557 KVFQDYLCV--QRSHFKYLDEHLQEEAQWQSMCDYIHNRLKFLDSTHKDAVS 606
           K+ +D LC   ++  FK+ ++ +    +W +MC Y+ + + FL  TH +AV+
Sbjct: 530 KILRDTLCSPNKKVEFKFYNDKVF-SPEWDNMCTYLKDHVNFLQETHSEAVA 580

>Kpol_2002.57 s2002 (129140..130957) [1818 bp, 605 aa] {ON}
           (129140..130957) [1818 nt, 606 aa]
          Length = 605

 Score =  392 bits (1007), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 218/531 (41%), Positives = 316/531 (59%), Gaps = 32/531 (6%)

Query: 96  QDFYSQVFKYLH----LYSPKGKSTRVYDPRCKLDGDIGARLDDYDNWFKLTS-EELGQC 150
           +DFY ++F  L     +  PK  + R  D +C L  DI +     D+   LTS E L  C
Sbjct: 78  KDFYYKLFDALAASKPVRPPKDANFRDED-KCNLK-DIASYSSKEDHL--LTSYESLSNC 133

Query: 151 LMLSTREKAMLKENHAKFVENLS-SLVLPKDSYKG-----NGIVTVGGGKFSLLAFLIIK 204
             L+  +   L  +H  F E++  S  L   + K       GIV +GGGKFS+    +IK
Sbjct: 134 YNLTQSQYDDLHNSHELFTEHVEKSFQLSNSAAKSMWPNDKGIVAIGGGKFSVYILSMIK 193

Query: 205 TLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKCIYISDVLPQSLVDNFEFK--GYQ 262
           TLR   T LPVE+L+P     + +FCD  LP  NAKC+Y  DVLP+     +  K   +Q
Sbjct: 194 TLRAKGTHLPVEILMPLASPEDKEFCDKFLPPLNAKCVYFKDVLPKEFTGKYPIKISRFQ 253

Query: 263 FKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIA 322
           +K  SI+ SSF N++ +D+DN  +K LD +FD   Y+  G++LWPD WRR T P YY +A
Sbjct: 254 YKVFSILFSSFRNVMYIDSDNLALKSLDKVFDTVAYRENGLILWPDIWRRVTAPIYYSVA 313

Query: 323 DIPISYNKRVRNCIDNITPPELYTEDMEDLSN------VPLHDLDGTIPDVSTESGQLMI 376
            +P +  KRVRN +D+++P   Y +++E+  N      VP HD +GT+PD++TESGQL++
Sbjct: 314 GVPYNLEKRVRNMVDDLSPVSRY-DNVENPGNDYRTRKVPFHDFEGTLPDLTTESGQLVV 372

Query: 377 SKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAV 436
            K  H  T+LL+ YYN  GP WYY IFSQ  AGEGDKETFIA A+ +GLP+YQVK+    
Sbjct: 373 DKVRHFKTLLLATYYNFYGPDWYYRIFSQGGAGEGDKETFIAAAHKFGLPYYQVKTNLKF 432

Query: 437 DGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTSNSIHLDKDYTPE-SFY 495
           DGY+    +GFRG+ + QHDF QDY++YQ A   +   Y+  +      D +Y+ E SF 
Sbjct: 433 DGYNDAK-EGFRGIGLYQHDFDQDYKQYQAAKSYVSRNYAKLS----QYDPEYSSEKSFE 487

Query: 496 RKYFEGDDIKEVDIMFVHSNLPKFDPLTLWREKDLIVNGKHIRSYTNLKRLNGYDLELES 555
           ++  +  + K++D MFVH +  KFDP  L +EK  + +GKH R +   + L G+DLEL++
Sbjct: 488 KELMKPSNGKDIDAMFVHVSFYKFDPFVLAKEKRYMRDGKHFRGFGRFELLKGWDLELDT 547

Query: 556 FKVFQDYLCVQRS-HFKYLDEHLQEEAQWQSMCDYIHNRLKFLDSTHKDAV 605
           F +F+D  C      F Y    +  + +W+ MC+Y+ +R+ FL+ TH++AV
Sbjct: 548 FTLFRDTFCSDNVIEFSYYKPKMS-QPEWKDMCNYLSSRVAFLEETHEEAV 597

>TBLA0D03030 Chr4 complement(734007..735824) [1818 bp, 605 aa] {ON}
           Anc_1.150 YJL186W
          Length = 605

 Score =  389 bits (998), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 209/502 (41%), Positives = 301/502 (59%), Gaps = 36/502 (7%)

Query: 123 CKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLV--LPKD 180
           CKL+ DI    +   +  +++   L  CL +S  +   LK  H+ F++ L + +  L K 
Sbjct: 105 CKLESDISMTDNSPGSLSRVSFNSLLNCLSISRPQLDNLKYVHSNFIQLLEAKMSELTKP 164

Query: 181 SY------KGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDE-GETDFCDVL 233
            +       G GIVT+GGGKFS+LA  +IK LR   +TLPVEV+IPP+DE  E DFC+  
Sbjct: 165 EFLDQIFPNGRGIVTIGGGKFSVLAMNVIKVLRKTGSTLPVEVVIPPQDEKNEVDFCNNF 224

Query: 234 LPKYNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIF 293
           LP YNAKC++  DVLP+   +N   KGYQ K ++++ SSF+ ++ LD+DN+P+K LD +F
Sbjct: 225 LPNYNAKCVFFKDVLPKHYAENLRLKGYQIKVMALLISSFKEIIFLDSDNYPLKSLDHVF 284

Query: 294 DEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYT------- 346
           D + YK  G++LWPD WRR TNP YYDIA++ +  N+RVR   D+I+PP  YT       
Sbjct: 285 DADIYKEAGLILWPDIWRRVTNPMYYDIANVSVDINQRVRYGTDDISPPNRYTIPRVHKN 344

Query: 347 --EDMEDLSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFS 404
             +++E+ + +P HDL GT+PD STESGQ++++K+ HL T+LL+ YYN  GP+WYY +FS
Sbjct: 345 NEKEIENKNTIPFHDLLGTVPDASTESGQMIVNKAKHLDTLLLAAYYNFYGPAWYYRLFS 404

Query: 405 QKAAGEGDKETFIAGANFYGLPFYQVKSATAVDGYHQPDGK-GFRGVAMLQHDFVQDYQR 463
           Q  AGEGDKETFI+ A+    P+YQVKS    DG+   D K GF+G+ +LQHDF+QDY+ 
Sbjct: 405 QGTAGEGDKETFISAAHTLNKPYYQVKSKVGFDGFW--DSKLGFQGIMLLQHDFIQDYEH 462

Query: 464 YQWAFKDIRTQYSGKTSNSIHLDKDYTPE-SFYRKYFEGDDIKEVDIMFVHSNLPKFDPL 522
           Y  A   +   Y     +  H   DY  +  FY       DI    IMF H++  K++P 
Sbjct: 463 YSKAKNQVIDHY----DDYYHFKSDYNLDRDFYDNLIHEKDIS---IMFGHTSFFKYEPW 515

Query: 523 TLWREKDLI--VNGKHIRSYTNLKRLNGYDLELESFKVFQDYLCVQRSHFK-----YLDE 575
            L+ E+  I     +H+R   ++ R   +DLEL  F      LC   ++ K        +
Sbjct: 516 VLYHERRYIDHETQQHVRGLRSIGRALDFDLELFCFDNLLQTLCKGNANDKSSIRFAFYK 575

Query: 576 HLQEEAQWQSMCDYIHNRLKFL 597
            +Q    W SMC+Y+ NR+ +L
Sbjct: 576 DIQGTPLWDSMCEYLDNRVSYL 597

>YJL186W Chr10 (80155..81915) [1761 bp, 586 aa] {ON}
           MNN5Alpha-1,2-mannosyltransferase, responsible for
           addition of the second alpha-1,2-linked mannose of the
           branches on the mannan backbone of oligosaccharides,
           localizes to an early Golgi compartment
          Length = 586

 Score =  385 bits (989), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 209/510 (40%), Positives = 311/510 (60%), Gaps = 36/510 (7%)

Query: 123 CKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLS---SLVLPK 179
           C    ++ A    +D+   L+ E L +C  L+   +  L+E H+KF + LS   +  +P+
Sbjct: 84  CSFANNVAAHDSGHDS--DLSYESLSKCYNLNKTVQESLREVHSKFTDTLSGKLNFSIPQ 141

Query: 180 DS--YKGN-GIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPK 236
               + G+ GIVT+GGGK+S+LA+ +IK LR+  TTLP+EV+IPP+DEGE DFC   LPK
Sbjct: 142 REALFSGSEGIVTIGGGKYSVLAYTMIKKLRDTGTTLPIEVIIPPQDEGEDDFCKNWLPK 201

Query: 237 YNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEE 296
           +N KCIY SD++P   + + +   +Q K   +I SSF+ ++ LDADN+ +K LD  F+  
Sbjct: 202 FNGKCIYFSDIVPSKPLSDLKLTHFQLKVFGLIISSFKRIIFLDADNYAVKNLDLAFNTT 261

Query: 297 PYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMED----- 351
            +  TG++LWPDFWRR T PA+Y+I    I+  KRVR   D+I+P   Y   + +     
Sbjct: 262 SFNDTGLILWPDFWRRVTPPAFYNIIGSSINIGKRVRFVSDDISPVSRYDPFVSNSNDYT 321

Query: 352 --------LSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIF 403
                   L +VPLHDLDGT+PD+S+ESGQ++I K  H  T+LL+LYYNV GP+WYY + 
Sbjct: 322 PKERQEHFLKHVPLHDLDGTMPDLSSESGQMVIDKIRHFNTLLLALYYNVYGPTWYYKMI 381

Query: 404 SQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDG-YHQPDGKGFRGVAMLQHDFVQDYQ 462
           SQ  AGEGDK+TF+A A+   +P+YQV++    DG ++Q D   ++G+A+LQHDF QDY+
Sbjct: 382 SQGTAGEGDKDTFVAAAHALNMPYYQVRTNFEFDGFFYQKD--DYKGLALLQHDFEQDYK 439

Query: 463 RYQWAFKDIRTQYSGKTSNSIHLDKDYTPES-FYRKYFEGDDIKEVDIMFVHSNLPKFDP 521
           +YQ A + ++      +     LD DYT ++ F +     DD  ++DIMF+H++  K DP
Sbjct: 440 QYQKAQQKVKANIEEFSK----LDPDYTLDNGFLKTLMVNDDGSDLDIMFIHASFYKADP 495

Query: 522 LTLWREKDLIV-NGKHIRSYTNLKRLNGYDLELESFKVFQDYLCV----QRSHFKYLDEH 576
            TL+ E   I  NG+ +R +    R  G D EL  F   +   C     Q   FKY  + 
Sbjct: 496 WTLYHENRFIGPNGEQVRGFRKPHRY-GMDFELFLFNDMRGSFCTTPKSQVIKFKYFTDK 554

Query: 577 LQEEAQWQSMCDYIHNRLKFLDSTHKDAVS 606
           +    +W +MC+Y+ N + +L+STHK+A+ 
Sbjct: 555 VN-TPEWDAMCEYLTNHVNYLESTHKEAMG 583

>ZYRO0D17160g Chr4 complement(1417469..1419208) [1740 bp, 579 aa]
           {ON} similar to uniprot|P46982 Saccharomyces cerevisiae
           YJL186W MNN5 Alpha-1 2-mannosyltransferase responsible
           for addition of the second alpha-1 2-linked mannose of
           the branches on the mannan backbone of oligosaccharides
           localizes to an early Golgi compartment
          Length = 579

 Score =  380 bits (977), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 205/526 (38%), Positives = 321/526 (61%), Gaps = 27/526 (5%)

Query: 96  QDFYSQVFKYLHLYSPKGK--STRVYDPRCKLDGDIGARLDDYDNWFKLTSEELGQCLML 153
           ++FYS +F+ +   +P+G+     V D     DGDI A   D++   K + E L  C  L
Sbjct: 65  RNFYSALFQAIQDGTPEGQLIMDSVRDKEKCRDGDISAFSTDFE---KSSYENLDACFHL 121

Query: 154 STREKAMLKENHAKFVENLSSLVLPKDSY-----KGNGIVTVGGGKFSLLAFLIIKTLRN 208
           S     ML   H KFVE ++S    K          +GIVT+GG K+S+++  +++TLR+
Sbjct: 122 SDDRLGMLASKHEKFVEAINSWKFSKSDIDKLFPNESGIVTIGGSKYSVISLTMLETLRD 181

Query: 209 MHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKCIYISDVLPQSLVDNFEFKGYQFKSLSI 268
             + LPVEV+IPP DEG+ D+C+V+LPK  AKC+Y+++ LP  +V N + + YQ K + +
Sbjct: 182 RGSKLPVEVMIPPGDEGDEDYCNVVLPKLGAKCVYMAEKLPPDVVKNVKIERYQNKIVGL 241

Query: 269 IASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISY 328
           + SSF+N++ +DAD  P+KPLDD+F+   YK  G++LWPD W+R T PA+Y +A+IP+  
Sbjct: 242 LLSSFKNVVYIDADCLPLKPLDDVFNSPAYKKHGLILWPDIWKRVTAPAFYKLANIPLDL 301

Query: 329 NKRVRNCIDNITP-----PELYTEDMEDLSNVPLHDLDGTIPDVSTESGQLMISKSSHLP 383
            KRVR   D+++P     P     ++  L  VP HDL+GT+ D +TESGQ++I+K  HL 
Sbjct: 302 KKRVRFGADDVSPLSRYEPSSEASEVRMLKKVPFHDLEGTMSDPTTESGQMLINKVDHLR 361

Query: 384 TVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDGYHQPD 443
           ++LLS YYN++G  WYY + SQ  +GEGDKET IA A+   LP+YQVK+    DG+   D
Sbjct: 362 SLLLSAYYNIHG-KWYYKMLSQGTSGEGDKETLIAAAHALKLPYYQVKTDVRFDGF--SD 418

Query: 444 GKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTSNSIHLDKDYTPESFYRKYFEGDD 503
            +GF G+++ Q DF QDY+ Y+ A + +R   S  ++   + D     + FY K  +  D
Sbjct: 419 HEGFHGISLYQQDFQQDYEAYKKAIRWVRRHKSELSAYEQNYD---VKKQFYEKLLKPGD 475

Query: 504 IKEVDIMFVHSNLPKFDPLTLWREKDLIVN--GKHIRSYTNLKRLNGYDLELESFKVFQD 561
            KEV+ +F H +  KF+P+ L  EK + ++  GKH R +   + +  +DLE+ +F+V + 
Sbjct: 476 -KEVESLFGHISYHKFEPIEL-AEKSIYIDEKGKHFRGFRRKEVIRHFDLEMFNFEVLEK 533

Query: 562 YLCVQR-SHFKYLDEHLQEEAQWQSMCDYIHNRLKFLDSTHKDAVS 606
           YLC +    F Y  + + +  +W+ MC+Y+ + + +L  TH++  S
Sbjct: 534 YLCKENPVKFVYYKDRM-DTPEWERMCNYLKSHVSYLQDTHEELFS 578

>Skud_10.31 Chr10 (54975..56735) [1761 bp, 586 aa] {ON} YJL186W
           (REAL)
          Length = 586

 Score =  380 bits (975), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 209/513 (40%), Positives = 306/513 (59%), Gaps = 44/513 (8%)

Query: 123 CKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSS-------- 174
           C   G++ A   + D+  +L+ E L +C  L+T  +  L   H KF + LS         
Sbjct: 84  CTFAGNVAAHTSERDS--ELSYESLNKCYRLNTTVQEGLTAMHNKFTDILSGKLNFSFAQ 141

Query: 175 --LVLPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDV 232
              + P+      GIVT+GGGK+S+LA+ +IK LR   TTLP+EV+IPP+DEG+ DFC  
Sbjct: 142 REALFPE----SEGIVTIGGGKYSVLAYTMIKKLRETGTTLPIEVIIPPQDEGDDDFCKN 197

Query: 233 LLPKYNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDI 292
            LPK+N KCIY SD++P   + + E   +Q K   +I S+F+ ++ +DADN+ +K LD  
Sbjct: 198 WLPKHNGKCIYFSDIVPAKSLRDLELTHFQLKVFGLIISNFKRIIFIDADNYAVKNLDLA 257

Query: 293 FDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMED- 351
           F+   ++ TG++LWPDFWRR T P +Y+I    I+  KRVR   D+++P   Y   + D 
Sbjct: 258 FNTTSFEDTGLILWPDFWRRVTPPVFYNIIGSTINTGKRVRFVSDDVSPVSRYDPFVSDS 317

Query: 352 ------------LSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWY 399
                       L +VPLHD+DGT+PD++TESGQ++I K  H  T+LL+LYYNV GP+WY
Sbjct: 318 KDYNPEEIQNHFLRHVPLHDMDGTMPDLTTESGQMVIDKIRHFHTLLLALYYNVYGPTWY 377

Query: 400 YPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDG-YHQPDGKGFRGVAMLQHDFV 458
           Y + SQ  AGEGDKETFIA A+   +P+YQVK+    DG Y++ D   F+G+A+LQHDF 
Sbjct: 378 YKMLSQGTAGEGDKETFIAAAHALNVPYYQVKTKFEFDGFYYKKD--DFKGLALLQHDFE 435

Query: 459 QDYQRYQWAFKDIRTQYSGKTSNSIHLDKDYT-PESFYRKYFEGDDIKEVDIMFVHSNLP 517
           QDY+ YQ A + ++    G+ S    L+ +YT  + F +     DD  ++DIMF+H++  
Sbjct: 436 QDYRHYQTAQQKVKANI-GEFSK---LNPEYTLDKGFLKNLMLNDDGSDLDIMFIHASFY 491

Query: 518 KFDPLTLWREKDLIV-NGKHIRSYTNLKRLNGYDLELESFKVFQDYLCV----QRSHFKY 572
           K DP  L+ EK  I  +GK +R +  L R  G D EL  F   +   C     Q   FKY
Sbjct: 492 KADPWNLYHEKRFIGPDGKQLRGFKKLGRY-GMDFELFLFDDMKKSFCTTPKNQVLRFKY 550

Query: 573 LDEHLQEEAQWQSMCDYIHNRLKFLDSTHKDAV 605
            ++ +    +W +MC Y+ + + +L+ THKDA+
Sbjct: 551 FEDKIT-TPEWDAMCKYLADHVDYLERTHKDAM 582

>TPHA0E03480 Chr5 complement(735664..737793) [2130 bp, 709 aa] {ON}
           Anc_1.150 YJL186W
          Length = 709

 Score =  376 bits (965), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 203/531 (38%), Positives = 299/531 (56%), Gaps = 26/531 (4%)

Query: 93  QKLQDFYSQVFKYLH----LYSPKGKSTRVYDPRCKLDGDIGARLDDYDNWFKLTSEELG 148
           + + DFY ++F  +     +  PK K        CK+  D+ A  D  +N+  L+   L 
Sbjct: 94  KNVHDFYYKLFNAISKARPVTPPKDKMAAYRKEGCKIK-DV-ASYDKKENFSLLSYSNLD 151

Query: 149 QCLMLSTREKAMLKENHAKFVENLSSLVLPKDSY-------KGNGIVTVGGGKFSLLAFL 201
           +C  LS  +   L+ NH +FV  + + +   D            GIV VGGGKFS+++  
Sbjct: 152 ECFKLSDSQTKDLQVNHERFVNFIDTDIAEMDPAIKEQLWPNEKGIVIVGGGKFSIISIN 211

Query: 202 IIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKCIYISDVLPQSLVDNFEFKGY 261
            IK +R   +TLP+EV+IP     E ++C+  LP +NAKC+Y+ D LP    +    K Y
Sbjct: 212 TIKAIRERGSTLPIEVIIPRSSVPEEEYCNRFLPSFNAKCVYLDDTLPNEFKERLTLKKY 271

Query: 262 QFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDI 321
           Q+KS +++ SSF+N+L +DADN P+  LD+IFD + YK  G++ WPD WRR T PAYY I
Sbjct: 272 QYKSFALLVSSFKNVLYIDADNIPLVNLDNIFDSKAYKDNGLITWPDIWRRVTAPAYYKI 331

Query: 322 ADIPISYNKRVRNCIDNITPPELYTEDME-----DLSNVPLHDLDGTIPDVSTESGQLMI 376
           A+I  + + RVR   D++TP   Y   +       L   P HD +GT+PD+++ESGQLM+
Sbjct: 332 ANINYNLDNRVRYMADDVTPTSYYDNIVNPGNNYKLRRTPFHDFEGTLPDLTSESGQLMV 391

Query: 377 SKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAV 436
           +K +H  T+LL+ YYN  GP WYY IFSQ  +GEGDKETF+A A+  G P+YQVKS    
Sbjct: 392 NKETHFRTLLLAFYYNYYGPRWYYTIFSQGTSGEGDKETFLAAAHALGEPYYQVKSTIEF 451

Query: 437 DGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDI-RTQYSGKTSNSIHLDKDYTPESFY 495
           DGY      GF+G+ + Q DF +DY+ Y  A   + + +  G+ + +   D D      +
Sbjct: 452 DGYFD-HKDGFQGIGLYQKDFNKDYENYLAAKAKVEKDKKYGEYNPNYDFDAD------F 504

Query: 496 RKYFEGDDIKEVDIMFVHSNLPKFDPLTLWREKDLIVNGKHIRSYTNLKRLNGYDLELES 555
            K        EV+ MF+H +  KFDP  L + K  I+ GK  R ++  K L  +DLELE+
Sbjct: 505 EKALMNPPGNEVEAMFIHVSFHKFDPHNLAKNKRYILQGKQYRVFSKFKNLRNWDLELEA 564

Query: 556 FKVFQDYLCVQRSHFKYLDEHLQEEAQWQSMCDYIHNRLKFLDSTHKDAVS 606
            +    YLC   +      + LQ +  W+ MC+Y+  R+++L STH  A+S
Sbjct: 565 NRNMHFYLCTDNAVEFIFYKDLQGKDSWKDMCNYLSERVEYLASTHDAALS 615

>Ecym_8128 Chr8 complement(266920..268698) [1779 bp, 592 aa] {ON}
           similar to Ashbya gossypii AEL148W
          Length = 592

 Score =  367 bits (942), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 220/550 (40%), Positives = 329/550 (59%), Gaps = 43/550 (7%)

Query: 83  PASKKELQRRQKLQDFYSQVFKYLHLYSP-KGKSTR--VYDPRCKLDGDIGARLDDYDNW 139
           P  KK L +    + FY  +F  L  + P KG   +  + D  C L        D  D  
Sbjct: 56  PFGKKHLTK----ESFYKDLFLALEKFKPPKGPEDKNSLKDKTCDLHDVSFGSTDPTDGE 111

Query: 140 FKLTSEELGQCLMLSTREKAMLKENHAKFVENL---------SSL---VLPKDSYKGNGI 187
           + L+     +C   S    A LK++H  F++++         S+L   + PK++    GI
Sbjct: 112 Y-LSYAARRKCFRPSEVSTAELKKSHLGFIKHINRHLTVDTKSALFNELFPKEA----GI 166

Query: 188 VTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKCIYISDV 247
           VTVGGGK+S+LA  +++ LR   T LPVEVLIP  D G+  FC  +  K+NA+CI +   
Sbjct: 167 VTVGGGKYSILALTMLRALREHGTKLPVEVLIPEGDIGDIHFCRAI-RKWNAECILLPKA 225

Query: 248 LPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWP 307
           LP ++    +FK Y+ K  +++ SSF++++L+DADN PIKPLDD+F+ EPYK TG++LWP
Sbjct: 226 LPNTVSKLHDFKSYETKLAALLLSSFKDVILIDADNIPIKPLDDVFESEPYKETGLILWP 285

Query: 308 DFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELY------TEDMEDLSNVPLHDLD 361
           D WRR T P +Y+IADI I +  R+RN  D+++PP  Y       +   ++++VPLHDL 
Sbjct: 286 DIWRRQTAPVFYEIADIDIDFRNRIRNSYDDLSPPSRYKNPDVPNDAKYNMAHVPLHDLA 345

Query: 362 GTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGAN 421
           G IPD+S+ESGQL+++K  HL T+LL+LYYN  G  W+Y + S   +G+GDKETFI  A+
Sbjct: 346 GAIPDLSSESGQLLVNKGKHLSTLLLALYYNYYGEQWFYQMSSLGTSGQGDKETFIFAAH 405

Query: 422 FYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQ---YSGK 478
               P+YQVK+    DGY   DG  F+GV +LQHDF QDY  ++ A K+  T+   + G 
Sbjct: 406 ALKKPYYQVKNPLLFDGYFGDDG-SFKGVGLLQHDFTQDYANWKKA-KEYMTENIAHLGT 463

Query: 479 TSNSIHLDKDYTPESFYRKYFEGDDIKEVDIMFVHSNLPKFDPLTLWREKD-LIVNGKHI 537
            ++  ++++D+  E  + K F+G     VDIMF+H++  K  P  L+REK  L  +GK  
Sbjct: 464 YNSDYNVNQDFKDEMLHHKDFDG-----VDIMFIHASFHKLIPWDLYREKIYLDKSGKQF 518

Query: 538 RSYTNLKRLNGYDLELESFKVFQDYLCVQRS-HFKYLDEHLQEEAQWQSMCDYIHNRLKF 596
           RS+ NLK +N +D+EL +F+  Q Y+C   +  F+Y    +     + +MC YI +R+K 
Sbjct: 519 RSFKNLKNINYFDVELFAFEGLQKYICSDDAIKFEYHTLQVTSTESFNAMCAYIDDRVKM 578

Query: 597 LDSTHKDAVS 606
           L  TH++A+S
Sbjct: 579 LRETHEEAIS 588

>CAGL0M02871g Chr13 (324009..325811) [1803 bp, 600 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186w MNN5
           or uniprot|P38069 Saccharomyces cerevisiae YBR015c TTP1
          Length = 600

 Score =  362 bits (928), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 202/508 (39%), Positives = 289/508 (56%), Gaps = 40/508 (7%)

Query: 123 CKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENL----SSLVLP 178
           C   GD+ +   D  +W   +++ L  CL L       L E H+++++ L        + 
Sbjct: 96  CPKKGDVSSGGIDQFHW--TSAKNLKACLNLDDYAIKTLSEAHSRYMKTLFNDKGEFAIS 153

Query: 179 KDSYKG-----NGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVL 233
           K  +K       GIVT+GGG++++LA L+I+T+R   +TLPVEV+ PP+DEGE DFC+  
Sbjct: 154 KSDFKKLYPNEKGIVTLGGGRYTILAMLMIETVRRHGSTLPVEVMFPPEDEGEFDFCNNW 213

Query: 234 LPKYNAKCIYISDVLPQSLVDN---FEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLD 290
           LPK+N +C+ +S  +P  ++       FK YQ KSL+++ +SF+  + +DADN  +K +D
Sbjct: 214 LPKHNGRCVMMSQEVPFEILQKDKEVRFKSYQIKSLALLLTSFKQFVFIDADNNAMKNID 273

Query: 291 DIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELY----- 345
            IFD E +K+ G++LWPD W+R TNP +YDIA +     KRVRN  D+ +PPE Y     
Sbjct: 274 HIFDTEAFKTHGLILWPDLWKRFTNPGFYDIAGVKYDLGKRVRNVNDDASPPETYDPNHS 333

Query: 346 ---TEDM---EDLS-----NVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVN 394
              T D+   E+++     +V L DLDGTI D +TESGQ+M+    HL T+LL+LYYN+ 
Sbjct: 334 IYTTHDLKQREEIAKHLYEDVSLADLDGTIADTTTESGQMMVDNKKHLSTLLLALYYNIY 393

Query: 395 GPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQ 454
           GP  YY + S   AGEGDKETFI+ A+   LP+YQVK+    DGY       F+GV ++Q
Sbjct: 394 GPDLYYYMMSMGTAGEGDKETFISAAHVLHLPYYQVKTNIGFDGYVNDVDNQFKGVGLMQ 453

Query: 455 HDFVQDYQRYQWAFKDIRTQYSGKTSNSIHLDKDYTPESFYRKYFEGDDIKEVDIMFVHS 514
            DF QDYQR++   K++ T+        +   K   P  F  K  +  D   +DIMF+H+
Sbjct: 454 TDFEQDYQRHKQVLKELATE------KPLEPVKYQLPNHFQDK-MKNPDGTSLDIMFLHA 506

Query: 515 NLPKFDPLTLWREKDLI-VNGKHIRSYTNLKRLNGYDLELESFKVFQDYLCVQ-RSHFKY 572
           +  KFDP  L + K     NG+ +R Y  +     +D EL SFK   D LC      FK 
Sbjct: 507 SFHKFDPADLAKSKQYFKQNGEQVRGYNRIDAYKNFDFELFSFKKLYDNLCTSDHISFKS 566

Query: 573 LDEHLQEEAQWQSMCDYIHNRLKFLDST 600
           L +H   E  W SMC Y   R+ FL  T
Sbjct: 567 LKKHEGTEF-WTSMCSYFKQRVDFLTKT 593

>Smik_10.46 Chr10 (78173..79933) [1761 bp, 586 aa] {ON} YJL186W
           (REAL)
          Length = 586

 Score =  361 bits (926), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 201/544 (36%), Positives = 315/544 (57%), Gaps = 38/544 (6%)

Query: 89  LQRRQKLQDFYSQVFKYLHLYSPKGKS---TRVYDPR-CKLDGDIGARLDDYDNWFKLTS 144
           L R    ++FY+ + + +    P G      ++++   C    ++ A     D    L+ 
Sbjct: 46  LTRSSHRKNFYTALIQAIVQAKPAGSPPDLNKLHNAEGCTFADNVAAHDSGRDG--DLSY 103

Query: 145 EELGQCLMLSTREKAMLKENHAKFVENLS---SLVLPKDSY---KGNGIVTVGGGKFSLL 198
           E L +C  L +  +  L E H +F + LS   +  +P+      +  GIVT+GGGK+S+L
Sbjct: 104 ESLSKCYRLDSTVQENLVEMHNQFTDVLSGRLNFSIPQREALFPESEGIVTIGGGKYSVL 163

Query: 199 AFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKCIYISDVLPQSLVDNFEF 258
           A+ +IK LR   TTLP+EV+IPP+DEG+ +FC+  LP +N +C+Y SD++P   + + + 
Sbjct: 164 AYTMIKNLRKTGTTLPIEVIIPPQDEGDDEFCNNWLPNFNGRCLYFSDIVPPKPLGDLKL 223

Query: 259 KGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAY 318
             +Q K   ++ S+F+ ++ +DADN+ +K LD  F+   ++ TG++LWPD+WRR T PA+
Sbjct: 224 THFQLKVFGLLISNFKRIIFMDADNYAVKNLDLAFNATSFQDTGLILWPDYWRRVTPPAF 283

Query: 319 YDIADIPISYNKRVRNCIDNITPPELY-----------TEDMED--LSNVPLHDLDGTIP 365
           Y+I    I+  KRVR   D+I+P   Y           +E+M+D  L +VPLHDLDGT+ 
Sbjct: 284 YNIIGSSINTGKRVRFISDDISPVSRYDSFISNSEDYTSEEMQDHFLRHVPLHDLDGTMS 343

Query: 366 DVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGL 425
           D+++ESGQ++I K  H  T+LL+LYYNV GP+WYY I SQ  AGEGDK+TFIA A+    
Sbjct: 344 DLTSESGQMVIDKIRHFHTLLLALYYNVYGPTWYYNIISQGTAGEGDKDTFIAAAHALNA 403

Query: 426 PFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTSNSIHL 485
            +YQVK+    DG+       ++G+A+LQHDF QDY++YQ A + ++      +     L
Sbjct: 404 SYYQVKTKFEFDGFFYKKND-YKGIALLQHDFEQDYKQYQKAQQKVKADVEKFSK----L 458

Query: 486 DKDYT-PESFYRKYFEGDDIKEVDIMFVHSNLPKFDPLTLWREKDLI-VNGKHIRSYTNL 543
           D DYT  + F +     +D  ++DIMF+H++  K DP TL+RE      +GK +R +   
Sbjct: 459 DPDYTLDKGFLKSLMLNEDGTDLDIMFIHASFYKADPWTLYRENRFTDPDGKQLRGFRKP 518

Query: 544 KRLNGYDLELESFKVFQDYLCV----QRSHFKYLDEHLQEEAQWQSMCDYIHNRLKFLDS 599
            R    D E+  F+  ++  C     Q   FKY ++ L    +W  MC Y+ N L +L++
Sbjct: 519 YRY-AMDFEMFLFRDMKESFCTPPKNQVIKFKYFNDKLN-TPEWDKMCQYLTNHLDYLEA 576

Query: 600 THKD 603
           TH +
Sbjct: 577 THNE 580

>AEL148W Chr5 (351089..352810) [1722 bp, 573 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL186W (MNN5)
          Length = 573

 Score =  352 bits (904), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 194/552 (35%), Positives = 324/552 (58%), Gaps = 33/552 (5%)

Query: 71  RDREPMTDVSRQPASKKELQRRQKLQD---FYSQVFKYLHLYSPKGKSTRVY---DPRCK 124
           R + P+   +  PA +   +  Q + D   FY  +F+ L   + + K+   Y   D  C+
Sbjct: 26  RQKSPIASAAHSPAQEWFTRGSQDINDPLEFYKMLFERLRKDAAQIKTVGSYVTQDADCQ 85

Query: 125 LDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENL-SSLVLPKDS-- 181
           +  D+  +L +  +    + + L +C  L       L++ H++F+  +   L +   S  
Sbjct: 86  IR-DLEDKLPESSHLG--SYDGLAKCFRLERDHLEGLRQGHSEFLRTIHGELAISAKSAL 142

Query: 182 YKG-----NGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPK 236
           +K       GIVTVGGG++S+LA ++I+ LR   TTLPVEV +   D  +  FC  +   
Sbjct: 143 FKTLYPLPAGIVTVGGGRYSILAMVMIRALRKRGTTLPVEVFLTDDDADDEAFCSYI-EH 201

Query: 237 YNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEE 296
           +NAKC+  SD LP+S++ + +  G++ K+++++ SS++ ++ +DADN P+KPLDD+F  +
Sbjct: 202 FNAKCVLFSDRLPKSVLASQKLSGFELKAVALLLSSYQQVIFIDADNVPLKPLDDVFKSK 261

Query: 297 PYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDME-----D 351
           P    G+VLWPD W+R T PA+YDIA IP+ + +RVR   D+++PP  YT+  E     +
Sbjct: 262 PLAEYGLVLWPDIWKRVTAPAFYDIAGIPVDFKRRVRFSADDVSPPSRYTKPGEVDESFN 321

Query: 352 LSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEG 411
            ++VPLHD  GT+P++S+ESGQL+I K+ H+ T+LL LYYNV+G   +Y + +Q  +GEG
Sbjct: 322 RAHVPLHDFAGTMPELSSESGQLLIDKARHMDTLLLILYYNVHGKHLFYRLSTQGTSGEG 381

Query: 412 DKETFIAGANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDI 471
           DKETF   A   G P+YQVK+     GYH P    + G A+LQHDFVQD++++  A +++
Sbjct: 382 DKETFAMAAQALGKPYYQVKTKLRFQGYHTP--SQYVGAALLQHDFVQDHEQWLRAREEV 439

Query: 472 RTQYSGKTSNSIHLDKDYTPESFYRKYFEGDDIKEVDIMFVHSNLPKFDPLTLWREKDLI 531
             + S   + +   + D   E FY      +  K +D+MFVH++  K  P+ L+REK  I
Sbjct: 440 ARRPSELAAYNPAYNVD---EHFYNTLMRPE--KPLDVMFVHASYHKLVPIDLFREKVYI 494

Query: 532 -VNGKHIRSYTNLKRLNGYDLELESFKVFQDYLC--VQRSHFKYLDEHLQEEAQWQSMCD 588
             +GK  RS+ +L  ++ +D+EL + ++  + +C    +  FKY  + ++   +++ MC 
Sbjct: 495 GEDGKQFRSFPDLAAMDNFDIELFAIQILNEAICSATTKIEFKYNRDKIKSPEEFEDMCT 554

Query: 589 YIHNRLKFLDST 600
           Y+ +R++ L  T
Sbjct: 555 YVRDRMRMLLDT 566

>KLLA0C16467g Chr3 (1442002..1443825) [1824 bp, 607 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186W MNN5
           Alpha-1 2-mannosyltransferase responsible for addition
           of the second alpha-1 2-linked mannose of the branches
           on the mannan backbone of oligosaccharides localizes to
           an early Golgi compartment
          Length = 607

 Score =  352 bits (902), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 202/541 (37%), Positives = 319/541 (58%), Gaps = 28/541 (5%)

Query: 85  SKKELQRRQKLQDFYSQVFKYLHLYSPKGKSTRVYDPRCKLD--GDIGARLDDYDNWFKL 142
           S  +L R     +F+  +F  L   +P  +     D + K    GD+G   +  D   +L
Sbjct: 58  SAPKLDRTDASDEFFKTLFAQLEGAAPMKREFGWGDIKAKECDMGDVGFDSNGRDE--RL 115

Query: 143 TSEELGQCLMLSTREKAMLKENHAKFVENLSSL-----VLPKDSYKGNGIVTVGGGKFSL 197
           + + L +CL L       LK  H KFV+ LS++      L +      GIVTVGG ++SL
Sbjct: 116 SYDNLAKCLQLPESNYNSLKNGHEKFVKYLSTVDTSASQLEQIYATKRGIVTVGGRRYSL 175

Query: 198 LAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKCIYISDVLPQSLVDNFE 257
           L++L+I  +R   + LP+EV+IPP DE ET+FC+ +L ++NA+CIY  D LP SL+ N  
Sbjct: 176 LSYLMINMVRRSGSKLPIEVVIPPDDEPETEFCESIL-QFNARCIYFKDRLPTSLLANLS 234

Query: 258 FKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPA 317
            K YQ K ++++ SSF+  +L+D+DN P+K +D++FD   ++  GMV+WPD WRR T+P 
Sbjct: 235 VKSYQVKGIALLLSSFQEFVLIDSDNMPLKNIDEVFDYNVFRDHGMVIWPDIWRRMTSPQ 294

Query: 318 YYDIADIPISYNKRVRNCIDNITPPELYTE----DMEDLSNVPLHDLDGTIPDVSTESGQ 373
           +Y +A++PI + KRVRN  D ++P   Y +      E+ + VP+HD  GT+PD +TESGQ
Sbjct: 295 FYQLAEVPIDFTKRVRNAGDELSPVSRYDKLENTVSENKAKVPMHDFLGTLPDPTTESGQ 354

Query: 374 LMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSA 433
           ++++K +HL  +LL+LYYN  GP +YY +FSQ  +G+GDKETF   A+    PFYQVK  
Sbjct: 355 MIVNKKTHLKMLLLALYYNQYGPEYYYQLFSQGTSGQGDKETFAMAAHILKEPFYQVKKT 414

Query: 434 TAVDGYHQP-DGKG-FRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTSNSIHLDKDY-T 490
                Y  P +GK  F+G  +LQHD  QDY RY W    ++T+  G+       D+DY  
Sbjct: 415 FGFAAYMDPREGKSEFQGAGLLQHDPEQDY-RY-WNI--LKTEIEGQQEKYGTFDEDYHI 470

Query: 491 PESFYRKYFE--GDDIKEVDIMFVHSNLPKFDPLTLWREKDLI-VNGKHIRSY-TNLKRL 546
            ++FY K     GD  +E   +F+H++  K+DP  L+ EK+L+  +GK  R+Y  +    
Sbjct: 471 KKTFYDKMLGKVGDQPREH--LFLHASYHKYDPWNLYNEKNLMHSDGKQFRAYPCSSTAF 528

Query: 547 NGYDLELESFKVFQDYLCVQRS-HFKYLDEHLQEEAQWQSMCDYIHNRLKFLDSTHKDAV 605
            G+D+EL  +++    +C +      Y+D+  ++  +++++C +  +R+  L+ TH + V
Sbjct: 529 KGFDVELFLWEIVNKIVCSENPVKMAYIDKLKEDTDKFKAVCQFTKDRVNHLNETHDEYV 588

Query: 606 S 606
           S
Sbjct: 589 S 589

>Suva_6.266 Chr6 complement(467727..469487) [1761 bp, 586 aa] {ON}
           YJL186W (REAL)
          Length = 586

 Score =  345 bits (884), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/515 (38%), Positives = 305/515 (59%), Gaps = 48/515 (9%)

Query: 123 CKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLVLPKDSY 182
           C+   ++ A    +D+   L+ E L +C  L+    A L E H +F +    ++L K +Y
Sbjct: 84  CEFADNVAAHDTTHDD--NLSYESLSRCYKLNRTLLANLAEMHNEFTD----ILLGKLNY 137

Query: 183 ----------KGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDV 232
                     +  GIVT+GGGK+S+LA  +IK LR   TTLP+EV+IPP+DEG+ DFC  
Sbjct: 138 SIPQREALFPESEGIVTIGGGKYSVLAHTMIKKLRETGTTLPIEVIIPPQDEGDDDFCKN 197

Query: 233 LLPKYNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDI 292
            LP+ N KC+Y SD++P   + + E   +Q K   +I S+F+ ++ +DADN+P+  LD +
Sbjct: 198 WLPRQNGKCLYFSDIVPSKPLRDLELTHFQLKVFGLIISNFKRIIFIDADNYPVTNLDLV 257

Query: 293 FDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELY------- 345
           F+   ++ TG+++WPD WRR T PA+Y+I    I+ +KRVR   D+++P   Y       
Sbjct: 258 FNTTSFQDTGLIMWPDLWRRVTPPAFYNIIGSTINTSKRVRFVSDDVSPVSRYDPFVSKS 317

Query: 346 ----TEDMED--LSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWY 399
               +E+M+D  L +VPLHD+DG +PD+++ESGQ++I K  H  T+LL+LYYNV GP+WY
Sbjct: 318 KEYTSEEMQDHFLRHVPLHDMDGAMPDLTSESGQMVIDKVRHFHTLLLALYYNVYGPTWY 377

Query: 400 YPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQ 459
           Y + SQ  AGEGDKETFIA A+    P+YQVK+    DG+   +G  ++G+A+LQH+F Q
Sbjct: 378 YKMLSQGTAGEGDKETFIAAAHALNAPYYQVKTKFEFDGFFYKEGD-YKGLALLQHNFEQ 436

Query: 460 DYQRYQWAFKDIRT---QYSGKTSNSIHLDKDYTPE-SFYRKYFEGDDIKEVDIMFVHSN 515
           DY++YQ A K ++    Q+S        LD DY+ +  F +     DD  ++DIMF+H++
Sbjct: 437 DYKQYQKAKKKVKANIDQFS-------QLDVDYSLDGGFLKSLMLNDDGSDLDIMFIHAS 489

Query: 516 LPKFDPLTLWREKDLIV-NGKHIRSYTNLKRLNGYDLELESFKVFQDYLCV----QRSHF 570
             K DP  L+ E   I  +G+ +R +   +R    D EL  F   ++  C     +   F
Sbjct: 490 YYKADPWNLYHENRFIGPDGEQLRGFRKPQRY-AMDFELFLFDDMKESFCTPAKDKVIKF 548

Query: 571 KYLDEHLQEEAQWQSMCDYIHNRLKFLDSTHKDAV 605
           KY ++ +     W  MC Y+ + + +L STHK+ +
Sbjct: 549 KYFEDKIN-TPDWDKMCKYLADHVDYLQSTHKEIM 582

>KNAG0C00900 Chr3 (167471..169342) [1872 bp, 623 aa] {ON} Anc_1.150
           YJL186W
          Length = 623

 Score =  343 bits (879), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 198/566 (34%), Positives = 309/566 (54%), Gaps = 52/566 (9%)

Query: 58  NPPAVVPSP----PQKGRDREPMTDVSRQPASKKELQRRQKLQDFYSQVFKYLHLYSPKG 113
           N   V+ +P    PQK   + P+   +  P  ++          F+  +F  L    P+ 
Sbjct: 80  NQETVITNPSVWVPQKDELQRPLESRTATPNERRV---------FFRNIFTTLKNAKPRD 130

Query: 114 KSTRVY----DPRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFV 169
                     + RCKL   + A   + +    ++ + L  C+ +  +    L + H KFV
Sbjct: 131 PPEDFTAFKDEARCKLRDPMFASDGEREKLEAVSYDSLDGCMHVPDQYLESLTKMHTKFV 190

Query: 170 ENLSSL-------VLPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPK 222
             + S+       + P+DS    GIV VGGG++S+L   ++  LR   T+LPVE+ IP +
Sbjct: 191 GTIKSISSSTVRQLYPEDS----GIVAVGGGRYSVLLATMLPKLRKNCTSLPVEIFIPDE 246

Query: 223 DE-GETDFCDVLLPKYNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDA 281
           D  G+  FC V  P+YNAKCIY   ++ +    + + + +Q+K ++I+ SSF+N+L LDA
Sbjct: 247 DAAGDASFCQVFAPRYNAKCIYAKAIVGKI---DIKLERFQYKPVAILLSSFKNVLFLDA 303

Query: 282 DNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITP 341
           DN+ +K +D IF  E Y  TG+++WPD W+R T+P++Y IA I     KRVR   D I+P
Sbjct: 304 DNYVMKNIDKIFSAESYHDTGLIIWPDIWKRCTSPSFYKIAGINFDLTKRVRWGGDEISP 363

Query: 342 PELYTEDMEDL-----SNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGP 396
              YT   ++      + VP HDLDG +PD S+ESGQL+I+K  H+ T+LL+LYYNV G 
Sbjct: 364 VSRYTSAEQNSPEYLKTKVPFHDLDGPMPDSSSESGQLLINKVKHMDTLLLALYYNVYGK 423

Query: 397 SWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHD 456
            WY+P+ SQ+  GEGDKE++I+ A     P YQVK+     GY   +   F GV +LQHD
Sbjct: 424 QWYFPLASQRGPGEGDKESYISAAYALKKPVYQVKTPLEFSGYFTDE---FNGVGLLQHD 480

Query: 457 FVQDYQRYQWAFKDIRTQYSGKTSNSIH---LDKDYT-PESFYRKYFEGDDIKEVDIMFV 512
           F QDYQ Y+ A + +        +N I     D +YT   SF +++F   +    D+MF+
Sbjct: 481 FEQDYQLYKKAEELV-------AANQIRYGFYDPEYTYSSSFLKEFFHVGESAHSDVMFI 533

Query: 513 HSNLPKFDPLTLWREKDLIVNGKHIRSYTNLKRLNGYDLELESFKVFQDYLCVQRS-HFK 571
           H++  KFDP  L + +     GK +R ++   R+NG D ELE F++ ++  C+ ++  + 
Sbjct: 534 HASFFKFDPWELSQNERFTYRGKQVRGFSLRDRINGEDFELEVFELMKEAFCIDKTVKYG 593

Query: 572 YLDEHLQEEAQWQSMCDYIHNRLKFL 597
           YL++  + +  W+  C YI   + FL
Sbjct: 594 YLEKKFKSKEDWEKACSYIDKHIVFL 619

>SAKL0H22616g Chr8 complement(1966196..1968421) [2226 bp, 741 aa]
           {ON} similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 741

 Score =  342 bits (877), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 214/606 (35%), Positives = 338/606 (55%), Gaps = 87/606 (14%)

Query: 73  REPMTDVSRQPASKKELQR-RQKLQDFYSQVFKYLHLYSPKGKSTRVYDPRCKLDGDIGA 131
           RE   +      SK+E     Q L+ FY+ + K +  YSP+G   R     CK+ GDIGA
Sbjct: 138 REAEKETLEDDNSKEETHNDAQNLKAFYTSILKEIKDYSPEGTLDRTKGSDCKI-GDIGA 196

Query: 132 RLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLVLP-----KDSYKGNG 186
              +  ++ KL+  EL +C+ +      MLK+ H +F E + + +LP     +  YKG G
Sbjct: 197 T--NIKDFGKLSESELSKCIQIPKDTSDMLKDLHTRFYETVKTKILPSFNSIEAPYKGEG 254

Query: 187 IVTVGGGKFSLLAFLIIKTLR-----NMHTTLPVEVLIPPKDEGETDFCDVLLPKYN--- 238
           IV VGGGKFSL+    IK +R      + +++PVE++IPP D+ + +FC  +LPK +   
Sbjct: 255 IVIVGGGKFSLIGLPAIKAIRVNSGHRLQSSIPVEIMIPPSDDEDVEFCKNVLPKVDPTG 314

Query: 239 -AKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEP 297
             +C++ SD+  + ++   + KGYQ K+L+++ SSF  +L+LDADN+ +  +++ FD   
Sbjct: 315 LTRCVFFSDIFEEEILK--DIKGYQLKALALLVSSFRKVLMLDADNYVVNSIENFFDSPV 372

Query: 298 YKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPL 357
           +   G+VLWPDFWRR  +P +Y+I  I ++ N+ +R  IDN+TPPE+Y ++ +D  ++P 
Sbjct: 373 FNEKGLVLWPDFWRRLHHPKFYEIIGIDVNRNESIRYSIDNVTPPEVYRDNDDD--SIPF 430

Query: 358 HDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFI 417
           HDL  +IPD+STESGQL++ K  HL T+LLS YYN NGPS+YYP+  Q  AGEGDK+TFI
Sbjct: 431 HDLANSIPDISTESGQLLVDKQKHLDTLLLSCYYNYNGPSFYYPLLGQGYAGEGDKDTFI 490

Query: 418 AGANFY----GLPFYQVKSATAVDGY----------HQPD-------GKGFRGVAMLQHD 456
           A A+         ++Q+++   V G+            PD        K +RGVAMLQ +
Sbjct: 491 AAAHVTHPSESGSYHQIQTPVRVQGHWCDEFEISIDDNPDDIIAEVKNKKYRGVAMLQSN 550

Query: 457 FVQDYQRYQWAF----KDIRTQYSGKTSNSIHLDKDYTPESFYRKYFEG-------DDIK 505
           +++D++R + A     KDI+ +         H D+    +  Y+K++E        +D  
Sbjct: 551 YIEDHERLKEAQSAIPKDIKKRLDKFRQE--HKDEFNNEDDLYKKFYESLRGHYSLNDYL 608

Query: 506 E----VDIMFVHSNLPKFDPLTLWREKDLIVNGK------------------HIRSYTN- 542
           E     ++ F+HS+LPK+DP  + +++D   +GK                  H R Y + 
Sbjct: 609 EYFDSTEVSFIHSHLPKYDPWVISQDEDFKYDGKRAKKLRGDKDSPSSKLSGHYRIYNSA 668

Query: 543 LKRLNGYDLELESFKVFQDYLCV----QRSHFKYLDEHLQEE----AQWQSMCDYIHNRL 594
             ++  YDLEL ++ VFQ++LC        +FKYL   + +        ++MC YI  R+
Sbjct: 669 FPKVTNYDLELANWAVFQEFLCSGDKENYKNFKYLKTQVSKADNPTVAVENMCKYIDERV 728

Query: 595 KFLDST 600
           +FL  T
Sbjct: 729 EFLRKT 734

>TDEL0C03020 Chr3 (537820..539802) [1983 bp, 660 aa] {ON} 
          Length = 660

 Score =  335 bits (858), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 201/577 (34%), Positives = 314/577 (54%), Gaps = 76/577 (13%)

Query: 93  QKLQDFYSQVFKYLHLYSPKGKSTRVYDPRCKLDGDIGARLDDYDNWFKLTSEELGQCLM 152
           + L++    V   +   SP+G+  R     C L GD+   +   D   K++  EL +C+ 
Sbjct: 83  RTLREALGSVMNQIRELSPQGELDRSKGDDCSL-GDLNVGVPQNDE--KVSKSELLKCIQ 139

Query: 153 LSTREKAMLKENHAKFVENLSSLVLPK---DSYKGNGIVTVGGGKFSLLAFLIIKTLR-N 208
           ++   +  LK  H  F+  L   ++PK     Y+G+GIV VGGG+F++     I+ +R N
Sbjct: 140 ITPDAEDELKNLHKSFLSVLEKKIMPKYPISMYRGDGIVFVGGGRFTMFVMPAIQAIRAN 199

Query: 209 MHTTLPVEVLIPPKDEGETDFCDVLLPKYN----AKCIYISDVLPQSLVDNFEFKGYQFK 264
               +P+E++IPP +  E+ FC+ +LP  +     +C+++  +     + N   KGYQ K
Sbjct: 200 AGRDIPIEIMIPPGNNHESGFCENILPLVDPSGLTRCVFMETLFDSKTMKNV--KGYQLK 257

Query: 265 SLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADI 324
           +L+++ASSF   LLLDADN+ +  +D  FD E  +  GM LWPD+W+R  +PA YDI   
Sbjct: 258 ALALLASSFRKTLLLDADNYVVNSIDSFFDSEIIEDYGMALWPDYWKRLHHPAVYDIVGS 317

Query: 325 PISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHDLDGTIPDVSTESGQLMISKSSHLPT 384
            +  ++R R  +D ++P +LY  D  D+S VP HDLDGTIPD  TESGQL++ K  HL T
Sbjct: 318 HVDSSRRARFIMDTVSPSQLYQSD--DISKVPFHDLDGTIPDGGTESGQLLVDKYKHLDT 375

Query: 385 VLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGA---NFYGLP--FYQVKSATAVDGY 439
           ++LSLYYN NGPS+YYP+  Q  AGEGDK+TF   A   + +GL   FYQ+++     GY
Sbjct: 376 IILSLYYNYNGPSYYYPLLGQGLAGEGDKDTFALAARALSAHGLQRYFYQLRAPVGALGY 435

Query: 440 --------------HQP-DGKGFRGVAMLQHDFVQDYQRYQWAF--------KDIRTQYS 476
                         H P D + FRGVAMLQHD   D++ Y+ A+        +D++T   
Sbjct: 436 WAHPKDNVPILDDEHVPEDQRSFRGVAMLQHDLDLDFKAYKKAYTEIKSKLVQDLKTFRK 495

Query: 477 GKTSNSIHLDKDYTPESFYR-KYFEGDDIKE-------VDIMFVHSNLPKFDPLTLWREK 528
             T +    D     E F++ +  +G D+ E       V + F+HS+ PK++P    +++
Sbjct: 496 KATLSDASADLANVDELFWKERRKDGYDVNEFLSYFSDVPVTFIHSHFPKYNPWEFAQDQ 555

Query: 529 DLIVNGK------------------HIRSYTN-LKRLNGYDLELESFKVFQDYLCVQRSH 569
           + I +GK                  H R Y +  ++L+ YDLEL ++  F++++C +  H
Sbjct: 556 EFIFDGKKVMSDHKDDPNFKPTHHGHFRMYDHTFQKLSNYDLELANWLSFKEHICREDGH 615

Query: 570 --FKYLDEHLQEEA----QWQSMCDYIHNRLKFLDST 600
             F YL E +++      +++ MC YI  R+K L ST
Sbjct: 616 TNFSYLAEEIEKTEHGLQRYEEMCKYIDERVKMLKST 652

>TBLA0J01190 Chr10 complement(267291..269141) [1851 bp, 616 aa] {ON}
           Anc_1.150 YJL186W
          Length = 616

 Score =  330 bits (845), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 190/460 (41%), Positives = 275/460 (59%), Gaps = 28/460 (6%)

Query: 122 RCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVEN-LSSLVLPKD 180
           +C L  DI       +    ++   L  C  L   +   + ++  +++   ++ L   K 
Sbjct: 95  QCLLQNDITFDATSKEQLSTVSYNNLKNCYSLQEHDFKKISKSQLEYINKCVTKLSKKKK 154

Query: 181 SY------KGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDE---GETDFCD 231
           SY      KG GIVTVGGGK+SLLA+L+IK LR   TTLPVEV+IPP D+    +T  C+
Sbjct: 155 SYTDILFPKGRGIVTVGGGKYSLLAYLMIKLLREKGTTLPVEVVIPPSDKEMYDDTWLCN 214

Query: 232 VLLPKYNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDD 291
            +LP  NAKCIY +D LP  ++ + +  G+Q+KSL+I  SSF+  L LD+DNFP+K LD+
Sbjct: 215 DVLPTLNAKCIYFTDRLPAEILQDLDIHGFQYKSLAIWISSFKKTLFLDSDNFPLKDLDN 274

Query: 292 IFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTED--M 349
           +FD   ++  G++ WPD WRRT  P +YDI++I     KRVR   D+++   LY +D  +
Sbjct: 275 VFDTPAFEEVGLIFWPDLWRRTIPPDFYDISNIKYDLKKRVRYVQDDLSSVPLYDKDNSV 334

Query: 350 EDLS-NVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAA 408
           +D   N+P HDLDGTI D STE+GQ+++ K +H  T+LLS+++N  G + YY +FSQ  A
Sbjct: 335 KDYEYNIPFHDLDGTISDPSTETGQMLVDKETHFETLLLSIFFNYFGFAIYYDMFSQAGA 394

Query: 409 GEGDKETFIAGANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAF 468
           G GDK+TFIA A+  G P+YQVK+    DG+  P   GF+G+A+LQHDF QDY+ YQ A 
Sbjct: 395 GIGDKDTFIAAAHVLGQPYYQVKTPPEFDGFWHP-TMGFQGLALLQHDFNQDYKNYQVA- 452

Query: 469 KDIRTQYSGKTSNSIHLDKDYTPESFYRKYFEGD--DIKEVDIMFVHSNLPKFDPLTLWR 526
              R +  G  +   +   DY      +K+FE D  DI  +D+MF H +L K +P++L  
Sbjct: 453 ---RIEAKGDDAKYENYITDYN----LKKHFEEDMMDINNIDVMFAHYSLHKAEPMSLLE 505

Query: 527 EKDLI-VNGKHIRS-YTNLKRLNGYDLELESFKVFQDYLC 564
            +     NGK ++  Y N K   G +LE   F    ++LC
Sbjct: 506 GQLYFDQNGKPLKGLYKNDKY--GMNLEYYIFNTLHEFLC 543

>ZYRO0F13244g Chr6 (1084412..1086406) [1995 bp, 664 aa] {ON} similar
           to uniprot|P38069 Saccharomyces cerevisiae YBR015C MNN2
           Alpha-1 2-mannosyltransferase responsible for addition
           of the first alpha-1 2-linked mannose to form the
           branches on the mannan backbone of oligosaccharides
           localizes to an early Golgi compartment
          Length = 664

 Score =  320 bits (820), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 219/589 (37%), Positives = 324/589 (55%), Gaps = 92/589 (15%)

Query: 96  QDFYSQVFKYLHLYSPKGKSTRVYD----PRCKLDGDIGARLDDYDNWFKLTSEELGQCL 151
           QD  +++ KY         ST V D      C+L GD+GA  +  D + K+T E+L +C+
Sbjct: 77  QDKLTEMMKYTMERVRSHSSTAVVDRTKNKGCQL-GDVGA--NAVDKFSKVTKEQLLKCI 133

Query: 152 MLSTREKAMLKENHAKFVENLSSLVL---PKDSYKGNGIVTVGGGKFSLLAFLIIKTLR- 207
                    LK++H  F++ L++ +L   P D Y G GIV VGGGK++L A   IK +R 
Sbjct: 134 DFPQETFEQLKDSHTTFLDTLTNDILDEYPTDLYGGKGIVIVGGGKYTLYAMPAIKAVRT 193

Query: 208 NMHTTLPVEVLIPPKDEGETDFCDVLLPKYN----AKCIYISDVL-PQSLVDNFEFKGYQ 262
           N   T+P+E++IPP+++GE  FC+ +LP+ +     +CIY++ V   Q+L D    KGYQ
Sbjct: 194 NGDPTIPIELMIPPENDGEDAFCENVLPELDPSGLTRCIYMNQVFDEQTLKD---VKGYQ 250

Query: 263 FKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIA 322
            K+L+++ASSFE +LLLDADN+ +  + DIF+ + +K  G++LWPD+WRR  +P  YDI 
Sbjct: 251 LKALALLASSFEKVLLLDADNYVVNSIRDIFELDVFKEFGLILWPDYWRRLHHPRLYDIV 310

Query: 323 DIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHDLDGTIPDVSTESGQLMISKSSHL 382
            I ++ NKRVR  +D+++P ELY E  +D S +P HD +G IPD  TESGQL++ KS HL
Sbjct: 311 GISVNENKRVRYSMDDVSPTELYEE--KDQSKIPFHDFEGAIPDGGTESGQLLVDKSKHL 368

Query: 383 PTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFY---GL--PFYQVKSATAVD 437
            T++LSLYYN NGPS YYP+  Q  AGEGDK+TF   A      G+   ++QVK+     
Sbjct: 369 GTIILSLYYNYNGPSQYYPLLGQGFAGEGDKDTFALAATALTQRGIVSAYHQVKTPVGTS 428

Query: 438 GYHQ------------PDG-KGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTSNSIH 484
           GY              PD  + +RGVAMLQHD + D++ Y  A  D+   Y        H
Sbjct: 429 GYWANSKDETPFEKGLPDAQRSYRGVAMLQHDLLGDFEAYMNAIHDLSDSYDEDFKIYYH 488

Query: 485 -------LDKDYTP-------------ESFYRKYFEGDDI-------KEVDIMFVHSNLP 517
                  L++D +              E F++ +    D+       K+V ++FVHS+LP
Sbjct: 489 RRLGQRPLEEDNSESREKVANWEKKIREDFWKSHKVDYDLKSFLQHFKDVPVLFVHSHLP 548

Query: 518 KFDPLTLWREKDLIVNGK------------------HIRSYTN-LKRLNGYDLELESFKV 558
           K++P  L +  DL  +GK                  H R Y +  K    YDLEL +F  
Sbjct: 549 KYNPWLLSQFGDLKYDGKRVLEKHADDPNFKPSRHGHYRMYGDEFKEKINYDLELANFIT 608

Query: 559 FQDYLCVQR---SHFKYLDEHLQEE----AQWQSMCDYIHNRLKFLDST 600
            +D++C       +F YL + + +E     ++++MCDYI  R+  L  T
Sbjct: 609 MRDHICAVEDGYKNFSYLSKEVNQEDKGFEKYRAMCDYIAERVDMLSDT 657

>TBLA0A00270 Chr1 complement(39183..42056) [2874 bp, 957 aa] {ON}
           Anc_3.188 YBR015C
          Length = 957

 Score =  318 bits (815), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 192/517 (37%), Positives = 288/517 (55%), Gaps = 23/517 (4%)

Query: 110 SPKGKSTRVYDPRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFV 169
           S  G++     P C +   + ++    D W  LT   L QCL++       LK +H  F+
Sbjct: 119 SSSGQNNIQLSPNCPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFL 178

Query: 170 ENLSSLV-LPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPP---KD-- 223
           E+L+ L  LP + Y G GIV +GGGK +L A ++ K +R+    +PVE+ IPP   KD  
Sbjct: 179 ESLNILQDLPINMYYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSL 238

Query: 224 ------EGETDFCDVLLPKYNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLL 277
                 + E+DFC+ +  + N  CI+ISD++ +      E        L+++ SSF++ L
Sbjct: 239 SNFDFKQSESDFCNKISKELNTNCIFISDIIDEEDFHLPELTESTTLLLALLTSSFDDTL 298

Query: 278 LLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCID 337
           +L   NFP+KPLD IF  +PY  TG + WP FWRR  +P+ YDI    I+++KR+R  +D
Sbjct: 299 VLSPKNFPLKPLDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLD 358

Query: 338 NITPPELYTEDMED----LSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNV 393
           +ITPP++YT + +      +++PLHDL+GT+PD  T   Q +I KS ++ T+LL+LYY+V
Sbjct: 359 DITPPKVYTSEEQKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSV 418

Query: 394 NGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAML 453
           NGPSWYY ++ QK +    K+     A+    PFYQVK+   +DG  +   +     + L
Sbjct: 419 NGPSWYYILWYQKISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFS-STL 477

Query: 454 QHDFVQDYQRYQWAFKDIRTQYSGKTSNSIHLDKDYTPESFYRKYFE--GDDIKEVD-IM 510
            HDF QD+  Y +A  +I++ Y  K SN I  D  YT E F   Y +   + I+  + +M
Sbjct: 478 YHDFQQDFAFYTFAKMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNHLM 537

Query: 511 FVHSNLPKFDPLTLWREKDLI--VNGKHIRSYTNLKRLNGYDLELESFKVFQDYLCVQRS 568
           F HSNL   DP  L   K LI  ++ + +    N+      ++ELESFK   +YLC +  
Sbjct: 538 FAHSNLFDGDPKLLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAY 597

Query: 569 HFKYL-DEHLQEEAQWQSMCDYIHNRLKFLDSTHKDA 604
           +F YL DE++ E      MC +I  RL FL S+  DA
Sbjct: 598 YFDYLEDEYVDETNALPGMCLFIKQRLDFLQSSADDA 634

>KLLA0F24574g Chr6 complement(2285387..2287522) [2136 bp, 711 aa]
           {ON} similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 711

 Score =  299 bits (766), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 204/595 (34%), Positives = 308/595 (51%), Gaps = 100/595 (16%)

Query: 95  LQDFYSQVFKYLHLYSPKGKSTRVYDPRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLS 154
           L+DFY ++   L   + KGK        CKL  D G    D +    LT + L +CL +S
Sbjct: 115 LKDFYQEIMTTLKETALKGKLEVKKPEGCKL-SDTGVENTDSEKLSTLTKDNLLKCLPIS 173

Query: 155 TREKAMLKENHAKFVENLSSLVLP--------KDS-YKGNGIVTVGGGKFSLLAFLIIKT 205
             +   +KE H  F + L   ++P        KD  YKG GI  VGGGK++L+A  +IK+
Sbjct: 174 DEDVKEVKEAHNNFKKLLQDKLMPNFKKLNTEKDPVYKGEGISIVGGGKYTLMALPVIKS 233

Query: 206 LR-----NMHTTLPVEVLIPPKDEGETDFCDVLLPKYN----AKCIYISDVLPQSLVDNF 256
           +R      + +++P+E++IPP D  +   C+ ++P  +     KC+Y+S+     ++   
Sbjct: 234 IRMNSGLTLKSSVPIEIVIPPSDNADRKVCENIIPTIDPSGLTKCVYLSEFFDSEILK-- 291

Query: 257 EFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNP 316
           +  GYQ KSLS++ SSFE +LLLDADN+ I  L + FD + ++ TG++LWPD+WRR  +P
Sbjct: 292 DITGYQLKSLSLLISSFEKVLLLDADNYVINSLGNFFDGDIFRETGLILWPDYWRRVHSP 351

Query: 317 AYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHDLDGTIPDVSTESGQLMI 376
             YDI DI +  +K  R   D IT   L+ E   D + +P HDL+G IPD STESGQL++
Sbjct: 352 KLYDIVDIKVQ-DKLARYSTDYITNSRLFPE--SDPAKIPFHDLEGAIPDGSTESGQLLV 408

Query: 377 SKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAV 436
           +K+SHL  ++LSLYYN NGPS+YY +  Q  +GEGDK+TFI  A      +YQV++    
Sbjct: 409 NKASHLDALILSLYYNYNGPSYYYRLLGQGISGEGDKDTFILAATVLKHRYYQVRTPVRP 468

Query: 437 DGY-----------------HQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGK- 478
            GY                    + K +RG+AM+QHD+ +D      A   IR   + K 
Sbjct: 469 QGYWGKIENEVRIQDDLVDDTPSNEKKYRGIAMIQHDYNEDRTFDSIARDAIRGSVNNKL 528

Query: 479 TSNSIHLDKDYTPESFYRKYFEGDDIKEVDIM---------------------------- 510
            ++ +   K++  E  ++   E D +++V  M                            
Sbjct: 529 KAHRLEYIKNHKSE--FKDMNEKDALEKVSKMSEVSDKFWDSMKGKYTIKDFFTIFQFTT 586

Query: 511 --FVHSNLPKFDPLTLWREKDLIVNGK------------------HIRSYT-NLKRLNGY 549
             F+HSNLPK++P  L    DL+ +GK                  H R Y+   K L  Y
Sbjct: 587 PVFLHSNLPKYNPWELSISGDLLYDGKKATKKMDDPSKYVPNGKGHHRMYSPTFKDLTNY 646

Query: 550 DLELESFKVFQDYLCVQRS---HFKYLDEHL----QEEAQWQSMCDYIHNRLKFL 597
           DLEL ++K+F D LC       +F YL E +    + E + ++MC YI +R+++L
Sbjct: 647 DLELANWKLFDDVLCKNPDDYLNFSYLSEVIGATEKPEQEVKNMCKYIKDRVEYL 701

>SAKL0C08888g Chr3 (814687..816726) [2040 bp, 679 aa] {ON} weakly
           similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 679

 Score =  266 bits (680), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 189/596 (31%), Positives = 294/596 (49%), Gaps = 93/596 (15%)

Query: 94  KLQDFYSQVFKYLHLYSPKGKSTRVYDPRCKLDGDIGARLDDYDNWFKLTSEELGQCLML 153
           +L+ FY  + + +   SP G+        C L G+IG  L +   + KLT  EL +C+ +
Sbjct: 89  ELKKFYRNITQLVKQNSPTGELDAKKQKWCDL-GNIG--LTETTKFDKLTKLELSKCINV 145

Query: 154 STREKAMLKENHAKFVENLSSLVLP------KDSYKGNGIVTVGGGKFSLLAFLIIKTLR 207
                + LK+ H KF + +   +LP      K +Y+G GIV +GGG+ +LLA   I  +R
Sbjct: 146 PADTVSHLKDLHLKFQKLIKDEILPAASRLSKPAYEGEGIVILGGGQKTLLALPAINAIR 205

Query: 208 N-----MHTTLPVEVLIPPKDEGETDFCDVLLPKYN----AKCIYISDVLPQSLVDNFEF 258
                 +  T PVE++IPP+ + ET FC  LLP+ +     +C+ +SD+     +++ E 
Sbjct: 206 TSGGVTIRNTTPVELVIPPRYKNETAFCQHLLPQLDPTGLTRCVLLSDLYDGEALEHLED 265

Query: 259 KGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAY 318
           +  Q K L+++ SSF+  LLLD D++ +  LD  FD E ++  G+VLWPD WRR  +PA 
Sbjct: 266 Q--QLKPLALLVSSFQKALLLDCDSYVVNSLDGYFDGEIFRDKGLVLWPDAWRRLHHPAL 323

Query: 319 YDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHDLDGTIPDVSTESGQLMISK 378
           Y++ +I +  N + RN ID +TP E++   +E+  +VP HDL+ TIPD ST++GQL+I K
Sbjct: 324 YEVLNIKVDENNQPRNSIDIVTPREVF--QVENKLSVPYHDLEHTIPDGSTDTGQLLIDK 381

Query: 379 SSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFY---GLPFYQVKSATA 435
             HL T+++S+YYN NGPS+YY +  Q     GDK T+ A A+        +Y V++   
Sbjct: 382 DKHLDTLIMSVYYNFNGPSYYYLLLEQGCNVNGDKNTYTAAAHAMHPNDGSYYHVRTPIG 441

Query: 436 VDGYHQPDGKGFR------------GVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTSN-- 481
           + G H  D  G R             VA LQHD+ +DY+ Y+W+ + I   +  K +   
Sbjct: 442 MQG-HWVDEDGARLADPNQKSQTRRVVAGLQHDYNEDYKYYKWSREVIGNNFREKLAQFR 500

Query: 482 --SIHLDKDYTPESFYRKYFEGDDIKEVD------------------------IMFVHSN 515
                  K    E   ++  E ++ KE++                        + FVHS 
Sbjct: 501 KKWYQAHKSDFSEDEKKRQKELENNKELNAKFWSQFTGSYKLEDYLSFFDFTPVTFVHSR 560

Query: 516 LPKFDPLTLWREKDLIVNGKHIR-----------SYTNLKRLNG--------YDLELESF 556
            P +DP  L +  DL  +G  I            S +   R+ G        +DLEL S+
Sbjct: 561 QPSYDPWQLSQIGDLKFDGARITDQHADDEEYKPSSSGHYRMYGPEFTDQTNFDLELSSW 620

Query: 557 KVFQDYLCVQR----SHFKYLDEHLQE----EAQWQSMCDYIHNRLKFLDSTHKDA 604
            +FQ   C       +   YL E +      +   Q MC Y+  R ++L  T  D 
Sbjct: 621 LLFQRLFCSSDREAYTQLAYLQEQISNTPDPDKSVQEMCKYVGARAQYLRDTTWDG 676

>KLTH0C08976g Chr3 (751731..753839) [2109 bp, 702 aa] {ON} weakly
           similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 702

 Score =  265 bits (676), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 185/616 (30%), Positives = 299/616 (48%), Gaps = 102/616 (16%)

Query: 78  DVSRQPASKKELQRR-------QKLQDFYSQVFKYLHLYSPKGKSTRVYDPRCKLDGDIG 130
           D S +P + +E+ R+       +  +  + +V   +   SP+G+        C L  DIG
Sbjct: 89  DASYEPPADEEVGRKPDDPQVSEATKKAFKEVLDAIQANSPEGQLQVSKGSECNL-MDIG 147

Query: 131 ARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLVLP------KDSYKG 184
             + D   + +LT E L +CL +       L E H KF   +   ++P        ++ G
Sbjct: 148 --VTDTSKFDRLTKESLEKCLQIPEEMTKTLHEAHKKFRAAIGEKLMPMFRKLDTPAFSG 205

Query: 185 NGIVTVGGGKFSLLAFLIIKTLRN-----MHTTLPVEVLIPPKDEGETDFCDVLLPKYN- 238
           +GI+ VGGGK+S+ A   IK +R      + +++P+E++IPP D+ +  FCD +LPK + 
Sbjct: 206 DGILIVGGGKYSVFALPAIKAIRENSGFKLKSSIPIEIIIPPSDKADRGFCDNVLPKVDP 265

Query: 239 ---AKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDE 295
               KC+++ ++     + + E  GYQ K+L+++ S FE +L+LDADN+ +  ++D F  
Sbjct: 266 LGLTKCVFLDEMFDADTLSHIE--GYQIKALALLVSRFERVLMLDADNYVVNSINDYFTS 323

Query: 296 EPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNV 355
                 G++LWPD+WRR  +P  Y I D+ +S +   R  +D+++P  +Y + + D    
Sbjct: 324 SALNDKGLILWPDYWRRLHHPKLYGIVDLGVSPDHISRYSVDDVSPDYMYKKSVTD---T 380

Query: 356 PLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKET 415
           P HD    +PD  TESGQL++ K  HL ++++SLYYN NG S+YYPI  Q  AGEGDK+T
Sbjct: 381 PFHDFRDALPDGGTESGQLLVDKKKHLDSIIMSLYYNYNGKSYYYPILGQGFAGEGDKDT 440

Query: 416 FIAGANFYGLP--FYQVKSATAVDGYHQPDGKG---------------FRGVAMLQHDFV 458
           F   +     P  FYQVK+     G H  D K                FRG AMLQHD++
Sbjct: 441 FALASRVMHGPGSFYQVKTPVDTLG-HWADAKDEIRLLEEEYENVEKKFRGCAMLQHDYI 499

Query: 459 QDYQRYQWAFK----DIRT-------QYSGKTSNSIHLDKDYTPESFYRKYFEGDDIKE- 506
           +D +    A +     IR        +++ K       ++    E   +     D + E 
Sbjct: 500 EDSKFSSLAREVLGNTIRNNEEKFCDEWAAKNKGKFSAEEKARREECKKSKEVQDALHEK 559

Query: 507 ----------------VDIMFVHSNLPKFDPLTLWREKDLIVNGK--------------- 535
                             + FVHS+LPK+DP   +   D++ +GK               
Sbjct: 560 MRASYKLDDYLAFFSFTGVSFVHSHLPKYDPWEWYENGDMMFDGKKAKKNHKNDPDYVPA 619

Query: 536 HIRSY----TNLKRLNGYDLELESFKVFQDYLCVQRS---HFKYLDEHLQE----EAQWQ 584
           H  +Y    +   +++ YDLEL ++  F+ YLC       +F YL   +      +   +
Sbjct: 620 HSGNYRMYDSKFNQISSYDLELANWSAFKSYLCDLEGGYKNFGYLSNKIDSTKSPKQSNK 679

Query: 585 SMCDYIHNRLKFLDST 600
            MC YI  R+++L ST
Sbjct: 680 DMCKYIEERVEYLKST 695

>Kwal_56.22779 s56 complement(277096..279183) [2088 bp, 695 aa] {ON}
           YBR015C (MNN2) - putative Golgi
           alpha-1,2-mannosyltransferase [contig 184] FULL
          Length = 695

 Score =  257 bits (657), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 195/590 (33%), Positives = 296/590 (50%), Gaps = 98/590 (16%)

Query: 99  YSQVFKYLHLYSPKGKSTRVYDPRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREK 158
           ++   + +  YSP GK        C++ GDI  R+ D   + KLT E L +CL +     
Sbjct: 107 FNDALELVKKYSPDGKLDTTKGDDCEI-GDI--RITDTSQFHKLTKESLEKCLNVPDETV 163

Query: 159 AMLKENHAKFVENLSSLVLP---------KDSYKGNGIVTVGGGKFSLLAFLIIKTLRN- 208
             L + H  F   +   +LP           ++KG+GIV VGGG+FS+ A   IK +R  
Sbjct: 164 KKLNKLHEDFKGAIRKSILPSFDVLEAQGNPAFKGDGIVIVGGGRFSVFALPAIKAIREN 223

Query: 209 ----MHTTLPVEVLIPPKDEGETDFCDVLLPKYN----AKCIYISDVLPQSLVDNFEFKG 260
                  T+P+E++IPP D+G+  FC+ +LPK +     KC+++ ++L    + + E  G
Sbjct: 224 SGVKTKNTIPIEIIIPPHDKGDRGFCENVLPKVDPSGLTKCVFLDEILSPETLSHIE--G 281

Query: 261 YQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYD 320
           YQ K++++  S FE +L+LDADN+ +  LD+ F  +  K  G++LWPD+WRR  +P  YD
Sbjct: 282 YQIKAVALFVSQFERVLMLDADNYVVNSLDEYFTHQKLKEKGLILWPDYWRRLHHPKTYD 341

Query: 321 IADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHDLDGTIPDVSTESGQLMISKSS 380
           I ++ +S  K  R  IDN TP  +Y +D ++    P HD    +PD STESGQ++I K  
Sbjct: 342 IVNLGVS-TKSQRYSIDNATPDFVYKKDAKE---TPFHDFFDALPDGSTESGQVLIDKKK 397

Query: 381 HLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLP--FYQVKSATAVDG 438
           HL ++L++LYYN NG S++YP+  Q  AGEGDK+TF  G      P  +YQVK+     G
Sbjct: 398 HLDSLLMTLYYNFNGKSYFYPLLGQGFAGEGDKDTFALGCRVMHGPEAYYQVKTPVDTLG 457

Query: 439 Y---------------HQPDGKGFRGVAMLQHDFVQDYQ---------------RYQWAF 468
           +                  DGK FRG AM+QHDF  D +               R+    
Sbjct: 458 HWADKDEIRIPDEDLEKSIDGKQFRGTAMIQHDFTDDVRFSSLAREVIGNAIRDRFHSFC 517

Query: 469 KDIRTQYSGKTSNSI-----HLDK-DYTPESFYRKYFEGDDIKE-------VDIMFVHSN 515
            +    + GK S          DK D   ++F  K      +K+         + F+HS+
Sbjct: 518 DEWARSHEGKLSKDQKERREQCDKSDEVKKAFNDKESPSYGLKDYLSFFHFTKVSFIHSH 577

Query: 516 LPKFDPLTLWREKDLIVNGK------------------HIRSY-TNLKRLNGYDLELESF 556
           LPK+DP       D++ NG                   H R Y + + +L  YDLEL ++
Sbjct: 578 LPKYDPWEWSHTGDMMFNGAKALKNHKDEPEYSPMHAGHYRMYDSKISQLTSYDLELANW 637

Query: 557 KVFQDYLCVQR---SHFKYLDEHLQE----EAQWQSMCDYIHNRLKFLDS 599
             F+DYLC  +    +F YL + L+E        ++MC+YI  R+++L S
Sbjct: 638 SAFKDYLCDIKDGYKNFGYLVQVLEETEFPHQSNENMCNYIRERVEYLQS 687

>Ecym_3545 Chr3 complement(1030762..1032774) [2013 bp, 670 aa] {ON}
           similar to Ashbya gossypii AEL082W
          Length = 670

 Score =  238 bits (606), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 172/627 (27%), Positives = 299/627 (47%), Gaps = 104/627 (16%)

Query: 71  RDREPMTDVSRQPASKKELQRRQKLQDFYSQVFKYLHLYSPKGKSTRVYDPRCKLDGDIG 130
           R R P   V   P   KE         F +QV   +   +P  +   + D  C+    + 
Sbjct: 57  RYRTPYVMVHSYPEHYKE---------FINQVVTAVQESAPVDELKLLQDDNCQ-HRRVS 106

Query: 131 ARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLVLPKDS------YKG 184
                ++   +LT  EL +CL +S   K+ +  +H +F E +   ++   +      YKG
Sbjct: 107 IDEGKHEVLLQLTEAELSKCLHVSDDIKSKMMASHLQFKEYVQGTLMKSLANLESYPYKG 166

Query: 185 NGIVTVGGGKFSLLAFLIIKTLRN-----MHTTLPVEVLIPPKDEGETDFCDVLLPKYN- 238
           +G++ + GG+ +L A   IK +R      M  ++P++++IP K + +  FC  +LP  + 
Sbjct: 167 DGVIIMAGGEHTLSAMASIKAIRQNGGIIMRRSVPIQIVIPSKKQDDEVFCTKVLPMLDP 226

Query: 239 ---AKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDE 295
              + C++  D+    +++  E    Q+KSL++I SSF  +LLLD+D F +  +D  F  
Sbjct: 227 TGLSTCLFFEDIFDSDVLNKIE--SSQYKSLALIVSSFRRVLLLDSDTFVVNSIDGYFHH 284

Query: 296 EPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNV 355
              K  GM+LWPD+WRR  +P  Y I  I +  + R+R  +D+ +P  LY     D S  
Sbjct: 285 SQLKENGMILWPDYWRRLHHPDLYKIVGINVHADTRLRFSVDDSSPKVLYESPKGD-SPF 343

Query: 356 PLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKET 415
           P HD +  IPD ST SG L+I K  HL T+++SLYY+ NGPS YYP+       E +K+T
Sbjct: 344 PFHDSENAIPDGSTASGPLLIDKQIHLDTIIMSLYYSFNGPSLYYPLLGCDQGSECEKDT 403

Query: 416 FIAGAN--FYGLP-FYQVKSATAVDGY------------------HQPDGKGFRGVAMLQ 454
           F   A+  +   P +YQVK+ +A +G+                  +  +GK FR VAML 
Sbjct: 404 FALAAHALYPDTPKYYQVKTPSAHEGHWENITTGVRILDEELASTNSDEGKTFRKVAMLL 463

Query: 455 HDFVQDYQRYQWAFKDIRTQYSG------KTSNSIHLDK--------------DYTPESF 494
           +D+++D +  + A + I+              N+ H ++              D     F
Sbjct: 464 YDYIEDTEFARLAREIIKENADTLLESFKNDGNAHHANRKTFKPRDINDLETNDELRADF 523

Query: 495 YRKYFEGDDIKE-------VDIMFVHSNLPKFDPLTLWREKDLIVNGK------------ 535
           ++K+ +   I++       + + F+ S  P ++P  L    D+  +              
Sbjct: 524 WKKHNDVYHIQDFLLFFDFIPMKFIRSLSPSYNPWKLLTTGDMQFDAARALKGHENDPKY 583

Query: 536 ------HIRSYTN-LKRLNGYDLELESFKVFQDYLCVQRSH----FKYLDEHLQEEA--- 581
                 H R Y++ +  +  YDLEL ++ +F++++C  ++     + YL + ++      
Sbjct: 584 KPAHSGHYRMYSSGISTVTNYDLELANWSLFENFVCNSKAFTYRDYGYLKQQIENTKDPA 643

Query: 582 -QWQSMCDYIHNRLKFL-DSTHKDAVS 606
            +++ MC YI NR+K+L ++T KD+ S
Sbjct: 644 LEYKKMCKYIRNRVKYLRNTTWKDSTS 670

>CAGL0L08096g Chr12 complement(886827..888521) [1695 bp, 564 aa]
           {ON} some similarities with uniprot|P46982 Saccharomyces
           cerevisiae YJL186w or uniprot|P38069 Saccharomyces
           cerevisiae YBR015c
          Length = 564

 Score =  226 bits (576), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 138/450 (30%), Positives = 228/450 (50%), Gaps = 27/450 (6%)

Query: 95  LQDFYSQVFKYLHLYSPKG----KSTRVYDPRCKLDGDIGARLDDYDNWFKLTSEELGQC 150
           ++ FY  +F+ ++ Y P      K   V+  +C L   I       D   +L+   L  C
Sbjct: 53  VEQFYLDLFRSINQYRPMNPPAKKQKLVFKDKCTLVAPISVEETSDDTLKQLSYMTLDYC 112

Query: 151 LMLSTREKAMLKENHAKFVENLSSLVLPKDSY-------KGNGIVTVGGGKFSLLAFLII 203
             LS  +   LK  H  +   + +L    D Y       +  GIVT+GG + +L     I
Sbjct: 113 FHLSPTQTNNLKTAHNGYCRRVETLFGSLDEYLRDSLMPRYKGIVTLGGNERTLSLLASI 172

Query: 204 KTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKCIYISDVLPQSLVDNFEFKGYQF 263
             LR M +TLP+EV+ PP    E  FCD  LP+YN KCIY+S  LP+ ++   +F     
Sbjct: 173 PRLRKMGSTLPIEVIFPPYVSNEDKFCDDFLPRYNGKCIYMSKALPEYVLKAHKFDEKMI 232

Query: 264 KSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIAD 323
           +  + + S+F+++L +++++F    +D  FD + +  TG+VLWP   RR+T+PA+Y I +
Sbjct: 233 RMFTPLVSTFKSILYMESNDFANTNVDKAFDSKSFTDTGLVLWPGRSRRSTSPAFYQIVN 292

Query: 324 IPISYNKRVRNCIDNITPPELYT-EDMED-----LSNVPLHDLDGTIPDVSTESGQLMIS 377
             I  N R RN  D+++ P  YT + +E+     L++ P+HDLDG IPD  T  G  MI 
Sbjct: 293 RKIDLNNRTRNLADDVSRPTRYTSQALENIQFNLLAHTPMHDLDGAIPDAVTHVGHYMID 352

Query: 378 KSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSA-TAV 436
           K  H  T++L++YY V+G  W+  +F+ +    G +E  +A A+   L +YQV     ++
Sbjct: 353 KQKHFKTLMLAMYYAVHGEMWFDMMFAPEKGSSGYRENIVAAAHALELSYYQVHLIPRSM 412

Query: 437 DGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTSNSIHLDKDYTP-ESFY 495
            G  +   +          DF  DY+++Q     ++++     S     D+ YT   +F 
Sbjct: 413 RGGSKDTLQSGETFMHFDPDF--DYRKHQALADKVKSKLIDVHS----FDRKYTAIRTFE 466

Query: 496 RKYFEGDDIKEVDIMFVHSNLPKFDPLTLW 525
           +    G+  ++V  +F+    P+FDPL L+
Sbjct: 467 KDLLAGN--QDVKSIFIEMPSPQFDPLALF 494

>AEL082W Chr5 (474072..476117) [2046 bp, 681 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YBR015C (MNN2)
          Length = 681

 Score =  198 bits (503), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 164/598 (27%), Positives = 272/598 (45%), Gaps = 106/598 (17%)

Query: 96  QDFYSQVFKYLHLYSPKGKSTRVYDPRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLST 155
           + F  ++ + +  Y P G + +V    C L+     R  D   +  LT+ +L  C+ LS 
Sbjct: 89  RTFVEEILRTVQAY-PPGAALQV-QADCLLER---VRATDERKFGSLTASKLQGCVDLSG 143

Query: 156 REKAMLKENHAKFV--------ENLSSLVLPKDSYKGNGIVTVGGGKFSLLAFLIIKTLR 207
              A  KE HA  +        E+LS L      Y  +GIV +GGG  ++ A   I+++R
Sbjct: 144 DAFAHAKEQHALMMKVIQKSLPEHLSDL--DHYPYISDGIVILGGGHKTIAAIPAIRSIR 201

Query: 208 -----NMHTTLPVEVLIPPKDEGETDFCDVLLPKYN----AKCIYISDVLPQSLVDNFEF 258
                 +  ++P+EV+IP   + E  FC  +LP  +     +C+++ D +  SL+   + 
Sbjct: 202 ENSGITVRNSMPIEVVIPGPADEEKVFCSKILPVLDPSGLTRCVHLGDTISSSLLS--KV 259

Query: 259 KGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAY 318
           K    ++L+++ASSF  +L LD+    I  +D  F  E +   G+VLWPD+WRR  +P  
Sbjct: 260 KPSDHRTLALLASSFSRVLYLDSSVQVINAIDGYFHHELFNERGLVLWPDYWRRLHHPKL 319

Query: 319 YDIADIPISYNKRVRNCIDNITPPELY-TEDMEDLSNVPLHDLDGTIPDVSTESGQLMIS 377
           Y++A   +   +R R  ID  +P ELY  +D E     P+HD   +IPD S+ SG L+I 
Sbjct: 320 YELAGSKVDTGRRERYSIDKGSPIELYGGKDGE----WPMHDCKDSIPDASSSSGVLLID 375

Query: 378 KSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFY---GLPFY-QVKSA 433
           K  H  T+ L+LYYNV+G  ++YP+   KA  E +K+T +  A+     G P Y QV + 
Sbjct: 376 KKKHFKTLALALYYNVHGEPFFYPLLDPKAPREAEKDTIVFAAHVLSRGGGPLYHQVTTP 435

Query: 434 TAVDGYHQPDGKG-----------------FRGVAMLQHDFVQDYQRYQWAFKDI----- 471
              +G+ +                      +R  A   HDF  D+     A + I     
Sbjct: 436 KRSEGHRKDKASSKPILEDTVDTSTIITSTYRHGAASYHDFFADHNFELLAGEIINSNFD 495

Query: 472 ----------RTQYSGKTSNSIHLDKDYTPES-----FYRKYFEGDDIKE-------VDI 509
                     R  +S  T+     D+D + ++     FY  +     + E         +
Sbjct: 496 SRRLAYVKWWRQNHSDDTTYKDKSDEDLSNDASVKADFYTSFHGNYTLAEYLNFFEFTPV 555

Query: 510 MFVHSNLPKFDPLTLWREKDLIVNGK--------------------HIRSYT-NLKRLNG 548
            FV +++   +P  + + +DL  +G                     H R ++ + ++L  
Sbjct: 556 SFVETDVLTCNPWIVAQSRDLTFDGASAVGAQPANQQTQYKAGPPTHHRLFSDHFQKLTT 615

Query: 549 YDLELESFKVFQDYLCVQRSH--FKYLDEHL----QEEAQWQSMCDYIHNRLKFLDST 600
           YDLEL ++  + ++LC + S+  + YL EHL         ++ MC YI  R+  L ST
Sbjct: 616 YDLELATWSAYAEFLCSKFSYKDYPYLKEHLGLTDSPTTAYKMMCKYISARVSHLQST 673

>TDEL0B00160 Chr2 (29809..31497) [1689 bp, 562 aa] {ON} 
          Length = 562

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 105/453 (23%), Positives = 181/453 (39%), Gaps = 69/453 (15%)

Query: 91  RRQKLQDFYSQVFKYLHLYSPKGKSTRVYDPRCKLDGDIGARLDDYDNWFKLTSEELGQC 150
           + Q++    +++F YL+L + +      + PR + +GD+           + +       
Sbjct: 95  KGQQINAIEAKLFPYLNLETLETNEKNFWPPRIRWNGDL----------LRGSVPRFA-- 142

Query: 151 LMLSTREKAMLKENHAKFVENLSSL-----VLPKDSYKGNGIVTVGGGKFSLLAFLIIKT 205
              ST +   L    +K+ +NLS       +L K S KG  +++VG G+ S  A  +IK 
Sbjct: 143 ---STGDYKYLGAAKSKYNKNLSFWGNWLDLLSKSSSKGI-VISVGAGQISD-ATKLIKV 197

Query: 206 LRNMHTTLPVEVLIPPKDEGETDFCDVLL-----------PKYNAKCIYISDVLPQSLVD 254
           LR     LP+E++   + +   D   +L+           P      + +S+VL     +
Sbjct: 198 LRYQMNALPIEII--HRGDLSEDQQQLLIQAARSAHSASYPAQELWFVNVSNVLNPRHAE 255

Query: 255 NFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTT 314
             +F  Y  K L+II SSFE+ +L+DAD  P   L+  +D + YK  G++ + D  R  T
Sbjct: 256 --QFATYSNKWLAIIFSSFESPILVDADTIPFISLEKYYDFQQYKEMGLLFFKD--RAIT 311

Query: 315 N-----PAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHDLDGTIPDVST 369
           +          +  I +S  K      D     EL  +D      V    ++G    +  
Sbjct: 312 SDLLNKEQLNTLKQIALSTIKLGSAAADLNNAIELGIKDNIAAETVMSMLVEGQKHHM-- 369

Query: 370 ESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFY- 428
           ESG +++ KS HL  +L S+    +  S Y+          GDKE F         PF  
Sbjct: 370 ESGLVLLDKSLHLVNLLTSVSLQFSSISSYF---------HGDKEWFWIAYLLRNRPFTF 420

Query: 429 ---QVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRT----QYSGKTSN 481
              Q  +   +      DGK F  +  +Q    +      W    ++T     ++   ++
Sbjct: 421 HPKQASNVGKLGRVQSEDGKEFYQICSVQVSHTELDGSLLWINGGLKTCKKNSWTSDYAS 480

Query: 482 SIHLDKDYTPESFYRKYF------EGDDIKEVD 508
           +  +   +  E   R Y+      EG  I  VD
Sbjct: 481 NKRISSMFNNEEEVRNYYQSPVSLEGAIIPSVD 513

>NDAI0H01270 Chr8 (306136..308106) [1971 bp, 656 aa] {ON} Anc_7.123
          Length = 656

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 126/290 (43%), Gaps = 51/290 (17%)

Query: 184 GNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLL------PKY 237
           G GIV       S +    +K L +++  LP+++ I   +E  T+F + L        K 
Sbjct: 270 GKGIVVTMSEGDSYMFKKQLKVLDHLNNELPIQI-ITKGNEFSTEFINDLSNFVQKETKQ 328

Query: 238 NAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEP 297
               + IS +L  +  D +    Y  K L++I ++F+ +++LDAD  P  P++D F+E+ 
Sbjct: 329 KVAILNISSMLDPAFADKYIVNFYN-KWLAVIFNTFQEIIILDADVVPFVPINDFFEEKK 387

Query: 298 YKSTGMVLWPDFWRRTTNPAYYDIADI----PISYNKRVRNC---IDNIT----PPELYT 346
           +K++GM+L+ D      +   Y I  +    P S   +  N    +D+ T    PP    
Sbjct: 388 FKNSGMLLYKDRLMVNEHTFSYCIDSMKFLEPSSLELKYLNTKLLVDSNTEIAIPPS--- 444

Query: 347 EDMEDLS-------NVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWY 399
              E+LS       N+ LH +D         SG ++I+K   L  +LLS   +++G    
Sbjct: 445 --SEELSVYYNFFKNLRLHHID---------SGLVVINKQEKLNGLLLSFALHLDG---- 489

Query: 400 YPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVD---GYHQPDGKG 446
                 +    GDKE F  G  F G  +        V    G   PDGK 
Sbjct: 490 ----KLRRCVYGDKEFFWLGQLFIGQDYSIYSMDGGVSGPLGETNPDGKN 535

>KNAG0G01070 Chr7 complement(232251..234149) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 88/389 (22%), Positives = 165/389 (42%), Gaps = 67/389 (17%)

Query: 151 LMLSTRE-KAMLKENHAKFVENLSSLVLPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNM 209
           L+LS  E   ++ +N+  F  N S       +  G G+V   G     +   +++ L N+
Sbjct: 206 LLLSVPELDGVIIQNNFNFWINWSQ------AASGRGVVITMGDNDVDMFGRLVRVLENL 259

Query: 210 HTTLPVEVLIPPKDEGETDFCDVLLPKYNAKC---IYISDVLPQ--SLVDNFEFKGYQFK 264
              +P++V+   K E +  F    L +Y  +    I + D  P    L   F+   +  K
Sbjct: 260 ENDIPIQVVTTGK-EMKPQFIQ-QLREYTVQTGQRIQLVDSSPMLDRLYVAFKITRFLNK 317

Query: 265 SLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLW---------------PDF 309
            ++ I ++FE  +L+D D+ P  PL   F+ E YK+TG+ ++                DF
Sbjct: 318 WVATIFNTFEEAILIDVDSIPFVPLSTFFEIESYKTTGIYMYRDRDIKHEHAPEKCIADF 377

Query: 310 WRRTTNPAYYDIADIPISYN---------KRVRNCIDNITPPELYTEDMEDLSNVPLHDL 360
             R   P+  +   I  S           +R +   ++IT  E+  ++     N  LH +
Sbjct: 378 --RNLEPSVQETDLIGTSLRFDLSQSNDLQRQQQNGESITIEEVIYKNF--FHNYNLHQV 433

Query: 361 DGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGA 420
           D         SG ++I+K   L ++LL+   +++G      +F +     GDKE F  G 
Sbjct: 434 D---------SGLVVINKHKQLHSLLLAFQLHLSG------VFEKCV--HGDKEFFWLGP 476

Query: 421 NFYGLPFYQVKSATAVDG-YHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIR-TQYSGK 478
              G+ +      ++V G +++ +GK   G+   Q   + D+ +  W    ++  ++ G 
Sbjct: 477 LLSGVDYTIDPLGSSVIGQFYEDNGK--TGICAPQMSHLNDFDQLMWTNGGLKICKFKGA 534

Query: 479 TSNSIHLDKDYTPESFYRKYFEGDDIKEV 507
            +N    D D  P+ F  +Y   D++  +
Sbjct: 535 AAN----DFDKYPDFFTNRYSTVDNLDSI 559

>Kwal_55.20984 s55 complement(634833..636692) [1860 bp, 619 aa] {ON}
           YIL014W (MNT3) - Product of gene unknown [contig 135]
           FULL
          Length = 619

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 96/411 (23%), Positives = 164/411 (39%), Gaps = 89/411 (21%)

Query: 134 DDYDNWFKLTSEELGQCLMLSTR-------EKAMLKENHAKFVENLSSLVLPKDSYKGNG 186
           D  D W  +T    GQ +    R       +     +N   F +N +S        KG G
Sbjct: 171 DATDLWPTITHLNSGQVVARGVRPHYSKDDDVPFSADNSKSFWQNWNSFS------KGKG 224

Query: 187 IVTVGGGKFSLLAFL-IIKTLRNMHTTLPVEVLIPPKDEGETDFCDV--LLPKYNAKCIY 243
           +V    G+  L  FL ++K L   + +LP++++  P +  +    ++   L   + +  Y
Sbjct: 225 LV-FSLGERHLDPFLRLLKILDQQNNSLPIQIVQQPHELSDAFLGNLTEFLQSSHQEVYY 283

Query: 244 ISDVLPQSLVDNFEFKGYQF----KSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYK 299
           I     ++L+D   +K Y      K L+ I ++F  ++L+DAD  P  P++  F EE YK
Sbjct: 284 ID---CEALLDT-TYKAYMTYFVNKWLASIFNTFSEVVLMDADVVPFVPVESFFQEEQYK 339

Query: 300 STGMVLWPDFWRRTTNPAYYDIADIP-----------ISYNKRVRNCIDNITPPELYTED 348
           +TG++L+ D  R       +D                +  N R++     + P      +
Sbjct: 340 ATGVLLYKD--RDMPQETTFDYCITTFKLLEPSSQEVVLMNHRMKTNSSVVDPGAHIFAN 397

Query: 349 MED------LSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPI 402
            +D        N  LH++D         SG +++ K+  L  +L+S   N++        
Sbjct: 398 EKDKVYHRFFYNETLHNVD---------SGLVVLHKTERLSGLLISFIMNLD-------- 440

Query: 403 FSQKAAG--EGDKETFIAGANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQD 460
             QKA+    GDKE F  G  F G  +       A+D    P      G   L HD V  
Sbjct: 441 --QKASNCIYGDKELFWLGQLFSGNDY-------AID----PLDGAAVGRVNLTHDKVSG 487

Query: 461 YQRYQWAF-------KDIRTQYSG------KTSNSIHLDKDYTPESFYRKY 498
           +Q+Y+           D R  ++       K   + H+D +  PE F + +
Sbjct: 488 HQKYEICATQMGHGSSDGRLLWTNGGLKACKIKGAAHIDFERKPEHFEQHF 538

>Suva_5.322 Chr5 (525925..527586) [1662 bp, 553 aa] {ON} YGL257C
           (REAL)
          Length = 553

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 107/238 (44%), Gaps = 29/238 (12%)

Query: 202 IIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLP--------KYNAKCIY---ISDVLPQ 250
           ++K LR++    P+E++   K +   D    L+         +Y A+ I+   +  VL  
Sbjct: 187 LLKVLRSIKNNFPIEIV--HKGDLSKDSIGSLVKYARNQDALEYPAQEIWFLNVHSVLSP 244

Query: 251 SLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFW 310
              + FE   Y  K L++I SSFE  +LLD+D  P   +D ++  E ++ TG++ + D  
Sbjct: 245 GYSEKFE--AYSNKWLALIFSSFEIPILLDSDTVPFVSIDKLYKLEEFQRTGVLFFKD-- 300

Query: 311 RRTTNPAYYDIADIPISYNKRVRNCID-NITPPELYTEDMEDLSNVPLHDLDGTIPDVST 369
            R  +   ++++ + +   + +  C+  N+T         + +    L ++         
Sbjct: 301 -RIISDDLFELSQVDV-LKEVIYGCVGLNLTDESNINHIKDPMVAQALENMLVKKYKHHL 358

Query: 370 ESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPF 427
           ESG +++ K  HL +VL SL    +  + Y+          GDKE F  GA   G PF
Sbjct: 359 ESGLVILDKKRHLFSVLTSLALQFSPIAEYF---------HGDKEWFWLGALLSGNPF 407

>KLTH0F13486g Chr6 complement(1108786..1110657) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014W MNT3 Alpha-1 3-mannosyltransferase
           adds the fourth and fifth alpha-1 3-linked mannose
           residues to O-linked glycans during protein
           O-glycosylation
          Length = 623

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 72/330 (21%), Positives = 134/330 (40%), Gaps = 48/330 (14%)

Query: 203 IKTLRNMHTTLPVEVLIPPKDEGETDFCDVL---LPKYNAKCIYISDVLPQSLVDNFEFK 259
           +K L ++   LP+++ +  ++E    F + L   L + + +  YI+       +   E  
Sbjct: 241 LKILDHLGNKLPIQI-VQRENELSEQFLNALSSFLQRSHQRVYYINCGAILEPLYGLEMT 299

Query: 260 GYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYY 319
            +  K ++ I ++F  ++L+DAD  P  PL++ FD++ Y  +G++L+ D  R       +
Sbjct: 300 YFVNKWIASIFNTFSEVILMDADVIPFIPLEEFFDDDQYNRSGVLLYKD--RDMPGETTF 357

Query: 320 DI-----------ADIPISYNKRVRNCIDNITPPELYTEDMED------LSNVPLHDLDG 362
           D            A+  I  N  ++     + P      + E+        N  LH++D 
Sbjct: 358 DYCIESFNYLMPSAEATILMNHTMKVNGSAVRPDSTIFSNEEEHIYYRFFYNKTLHNVD- 416

Query: 363 TIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANF 422
                   SG ++  K   L  +L+SL+ N++      P  S+     GDKE F  G  F
Sbjct: 417 --------SGLVVFRKPEKLIGLLISLFMNLD------PRLSRCVY--GDKELFWLGQLF 460

Query: 423 YGL-----PFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSG 477
            G      P         V    +  G+    +   Q       +R  W    ++     
Sbjct: 461 GGQDYTIDPIDGSVVGPLVTKLSEETGEKEYEICATQMSHSSRDKRLLWTNGGLK---KC 517

Query: 478 KTSNSIHLDKDYTPESFYRKYFEGDDIKEV 507
           KT  + H+D D +P+ F  +Y   +D++ V
Sbjct: 518 KTPGAAHMDFDRSPDYFKSQYSSEEDLQNV 547

>KNAG0J02990 Chr10 (576491..578425) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 62/287 (21%), Positives = 122/287 (42%), Gaps = 31/287 (10%)

Query: 184 GNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAK--- 240
           G GIVT     FS   F  +K L+     LP+++++     GE  F    L K + +   
Sbjct: 271 GKGIVTTFSEPFSDFFFRQLKVLQYQENKLPIQIVVK---NGE--FTKEFLSKLSERGRQ 325

Query: 241 ------CIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFD 294
                  +  S++L +  V+    + Y  K ++ I ++FE  +LLDAD  P  P++   +
Sbjct: 326 TGQRLFLVEYSEILEEKNVN--LIRKYFNKLIANIFNTFEEFVLLDADAVPYSPIESFME 383

Query: 295 EEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSN 354
              YK+TG+ ++ D   R  +    D   + + + +     ++ +    L+T +M+  + 
Sbjct: 384 LPEYKNTGIYMFRD---RVVDNELDDTCLVTLEHLEPTIEEVELLGSTLLFTSEMQKTTG 440

Query: 355 VPLHDLDGTIPD----VSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGE 410
                +   + +     + E+G ++++K      ++++L  + N           +A   
Sbjct: 441 SVEESIYRKMMEDRMKENVETGLVVVNKKEKFAGLVMTLMLSFN--------HKLQACFH 492

Query: 411 GDKETFIAGANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDF 457
           GDKE +  G  F G  +       A+ G+ Q   K  + V+    DF
Sbjct: 493 GDKEFYWLGPLFAGQSYSIEPKGAALTGFPQKKYKDGKYVSTKLCDF 539

>KNAG0G01060 Chr7 complement(228987..231071) [2085 bp, 694 aa] {ON}
           Anc_7.123 YIL014W
          Length = 694

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 81/357 (22%), Positives = 146/357 (40%), Gaps = 53/357 (14%)

Query: 183 KGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVL--LPKYNAK 240
           +G GIV       S + +  + T + +   LP++V+   K E    F + L  L K   +
Sbjct: 285 EGKGIVLTMRESDSGMFYKQLNTFKELGNKLPIQVVTTGK-EATNKFVETLGKLAKKTEQ 343

Query: 241 CIYISDVLPQSLVDNFEFKGYQF--KSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPY 298
            IY+ DV      D  + K   F  K ++ I ++FE  + +D D     P+ D F  E Y
Sbjct: 344 KIYLVDVSKLLKPDFVQDKIINFLNKWIATIFNTFEEEVFIDVDAISYVPMQDYFQTENY 403

Query: 299 KSTGMVLWPD-------FWRRTTN---PAYYDIADIPISYNKRVRNCI-----DNITPPE 343
           K TG++++ D        ++R T+    A     ++ +  ++++ + +     D++   E
Sbjct: 404 KDTGILMFRDRTLLQENTFKRCTDLLIEAEPTKEEVRLIGSRQMFDSLWLKKNDDVPDKE 463

Query: 344 LYTEDMEDLSN----VPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWY 399
           L + + E   N    + LH +D         SG + I K   L  VL+S ++N++     
Sbjct: 464 LMSTEAEVYRNFYERLKLHHVD---------SGLIAIHKKYKLTGVLMSFFFNLDA---- 510

Query: 400 YPIFSQKAAGEGDKETFIAGANFYGLPFY------QVKSATAVDGYHQPDGKGFR---GV 450
                  +   GDKE F  G    G  F        +  A + +   + DGK  +    +
Sbjct: 511 ----RLSSCVYGDKELFWLGQLVAGERFAINQMEGGILGAVSEEVVTEDDGKSKKVNYNI 566

Query: 451 AMLQHDFVQDYQRYQWAFKDIRTQYSGKTSNSIHLDKDYTPESFYRKYFEGDDIKEV 507
              Q   + +  +  W+   +RT    K  NS   D     E F  +Y + + ++ V
Sbjct: 567 CSTQIAHIDENNKLLWSNGGLRT---CKFLNSAGSDFQSNEEYFASRYGDAETLQRV 620

>Skud_7.10 Chr7 complement(16816..18516) [1701 bp, 566 aa] {ON}
           YGL257C (REAL)
          Length = 566

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 94/190 (49%), Gaps = 20/190 (10%)

Query: 235 PKYNAKCIYISDVLPQSLVD---NFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDD 291
           P+Y A+ I+ S+V  ++L+    + +F  Y  K L++I S FE  +LLD+D  P  P+D+
Sbjct: 238 PEYPAQEIWFSNV--RNLLSPKYSNKFATYSNKWLALIFSFFEVPILLDSDTVPFVPIDE 295

Query: 292 IFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCID-NITPPELYTEDME 350
            +  E ++ TG + + D   R  +   ++ + + +   + +  CI  N+T      E +E
Sbjct: 296 FYKLEEFQRTGALFFKD---RIISNDLFESSQLDV-LKEIIHGCIGLNLTDESDIHEKIE 351

Query: 351 DLSNVP-LHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAG 409
           D + V  L ++         ESG +++ K  HL +VL+S+    +  S Y+         
Sbjct: 352 DPTVVQVLENMLIKKHKHHLESGLVVLHKDKHLFSVLISVALQFSPISEYF--------- 402

Query: 410 EGDKETFIAG 419
            GDK+ F  G
Sbjct: 403 HGDKDWFWMG 412

>KNAG0D03070 Chr4 (552018..553970) [1953 bp, 650 aa] {ON} 
          Length = 650

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 67/286 (23%), Positives = 118/286 (41%), Gaps = 28/286 (9%)

Query: 184 GNGIVTVGGGKFSLLAFLI-IKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKY----- 237
           G GI+T    K     FL  +K L+    TLP+++L+      + DF D  + K      
Sbjct: 273 GKGIITTFNPKAHGDYFLRQLKILQYQKNTLPIQILVR-----DGDFSDSFVRKLADAAR 327

Query: 238 --NAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDE 295
             N K   ++        +  EFK Y  K  + + ++FE  +LLDAD  P  PL+   + 
Sbjct: 328 RTNQKIYLVNYTAILDKSNMGEFKSYINKLAANLFNTFEEFILLDADAVPYFPLESYLEL 387

Query: 296 EPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNV 355
             Y+ TGM ++ D   R  +    D     + + +        +    +YT     +   
Sbjct: 388 PDYQKTGMYMFRD---RILDHRIDDACTTTLEHLEPSMEEAVLLGTSIMYTVSSNVVPTT 444

Query: 356 PLHDL-DGTIPD---VSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEG 411
           P   +  G + +    + E+G +++ K + LP +L++L  N++            A   G
Sbjct: 445 PEEKVYVGMVREHIRENVETGLVVVDKKNKLPGLLMALALNLSK--------KLNACMYG 496

Query: 412 DKETFIAGANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDF 457
           +KE +  G  F G+ +       A+ G+ +    GF+ V     DF
Sbjct: 497 EKEFYWLGPYFSGMSYSIEAKGAALTGFPEKMYDGFQYVNTKLCDF 542

>CAGL0C03916g Chr3 complement(383989..385875) [1887 bp, 628 aa] {ON}
           weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3 or uniprot|P53059 Saccharomyces
           cerevisiae YGL257c MNT2 or uniprot|P39106 Saccharomyces
           cerevisiae YER001w MNN1
          Length = 628

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 74/300 (24%), Positives = 126/300 (42%), Gaps = 44/300 (14%)

Query: 179 KDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYN 238
           K   KG GI      K   L   + K    +  T P++++    +   T   + L+  Y 
Sbjct: 233 KQESKGRGIALTAAPKDVKLLRSLFKVFEKLGNTYPIQIVQKGGEMSPT--MESLIKDYA 290

Query: 239 AKC---IYISDVLPQSLVDNF---EFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDI 292
            +    ++I D+ P  L  +F     + +Q K  + I ++FE ++L+DAD       +  
Sbjct: 291 IETNQNVFIVDLSP-VLDPDFATDHIRKFQNKWFASIFNTFEEVMLIDADVVIYTEPESF 349

Query: 293 FDEEPYKSTGMVLWPD--------FWRRTTNPAYYDIADIPISYNKRVRNCID--NITPP 342
           F+ + YK+TG++LW D          R T    Y++    P     R+   +    +T P
Sbjct: 350 FNLDGYKNTGLLLWRDREIVDAKTHERCTDMAPYFE----PALEEHRLLGTVQKYRLTGP 405

Query: 343 ELYTEDMEDLSNV--PLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYY 400
            L T D  +   +    H    TI D    SG ++ +K   L  ++L+ Y++        
Sbjct: 406 SLETHDEPEAETLFDFFHRRIVTIID----SGVVIYNKKQKLHGLILAEYFHN------- 454

Query: 401 PIFSQKAAG--EGDKETFIAGANFYGLPFY-QVKSATAVD--GYHQPDGKGFRGVAMLQH 455
              S++ AG   GDKE F  GA   G  ++ + + A A+   GYH P  K +     + H
Sbjct: 455 ---SKQFAGCVYGDKEYFEFGALVAGEDYHVEAEKAVAIGAVGYHPPREKYYVCSGQMGH 511

>TDEL0H03260 Chr8 complement(542810..544735) [1926 bp, 641 aa] {ON}
           Anc_7.123 YIL014W
          Length = 641

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 71/137 (51%), Gaps = 21/137 (15%)

Query: 184 GNGIV-TVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKC- 241
           G+GIV T+  G  +LL +  +K   +   TLP++++         DF D  + +  AK  
Sbjct: 251 GSGIVITLNEGSKNLL-YKQLKVFDHSDNTLPIQIITTG-----NDFSDGFIEELKAKVA 304

Query: 242 -----IYISDVLPQSLVDNFEFKGYQF-----KSLSIIASSFENLLLLDADNFPIKPLDD 291
                +Y+ D  P  ++D+ EF          K +++I ++FE  +LLD D  P  P+DD
Sbjct: 305 ASKQNVYLVDCSP--ILDS-EFAKEHIGDIINKWIAVIFTTFEESILLDVDAVPFVPMDD 361

Query: 292 IFDEEPYKSTGMVLWPD 308
              E+ YK++G++++ D
Sbjct: 362 FLTEKSYKASGILMYKD 378

>CAGL0C03938g Chr3 complement(386673..388586) [1914 bp, 637 aa] {ON}
           weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3 or uniprot|P53059 Saccharomyces
           cerevisiae YGL257c MNT2 or uniprot|P39106 Saccharomyces
           cerevisiae YER001w MNN1
          Length = 637

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 85/326 (26%), Positives = 132/326 (40%), Gaps = 46/326 (14%)

Query: 151 LMLSTREKAMLKENHAKFVENLSSLVLPKDSYKGNGI-VTVGGGKFSLLAFLIIKTLRNM 209
           ++   R K   KE +A F+ +       K   +G GI +TV      LL  L  K L  +
Sbjct: 220 IIAKPRTKMSAKEYNANFMGHW------KAEARGRGITLTVAPDDIKLLRSLF-KVLEKL 272

Query: 210 HTTLPVEVL-----IPPKDEGETDFCDVLLPKYNAKC--IYISDVLPQSLVDNFEFKGYQ 262
               PVEV+     + PK E   D       + N +   I +S +L          K ++
Sbjct: 273 GNEYPVEVVHKGGEMTPKME---DLIRQYAEETNQEVYVINLSPILDPDFASQ-NIKSFK 328

Query: 263 FKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYD-I 321
            K  + + ++FE  +LLD D       +  F+ + YK TG++LW D  R  T     D  
Sbjct: 329 NKWFAAMFNTFEEAILLDVDVVLYASPEYFFELDGYKKTGLMLWKD--REYTEVETSDRC 386

Query: 322 ADI-----PISYNKRVRNCID--NITPPELYTEDMEDLSNVPLHDLDGTIPDVSTESGQL 374
           A +     P      +   I    +T P+L T +  + +   L+D          +SG +
Sbjct: 387 ASMAPYFEPSEEEHELLGTIQKYRLTGPDLETHNESEATT--LNDFFNNKLATIIDSGVV 444

Query: 375 MISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETF-----IAGANFYGLPFYQ 429
           +I+K   L  +LL+ YY++   S Y+          GDKE F      AG ++Y  P   
Sbjct: 445 LINKKQKLNALLLAAYYHM---SKYF-----GGCTYGDKELFEIAALAAGEDYYVDP--N 494

Query: 430 VKSATAVDGYHQPDGKGFRGVAMLQH 455
              A    GYH P  K +   A + H
Sbjct: 495 KAGAIGPIGYHPPREKYYVCSAQMGH 520

>NDAI0A08550 Chr1 complement(1967085..1969079) [1995 bp, 664 aa]
           {ON} 
          Length = 664

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 69/314 (21%), Positives = 118/314 (37%), Gaps = 30/314 (9%)

Query: 151 LMLSTREKAMLKENHAKFVENLSSLVLPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMH 210
           LM S +E      N+A F  +       K +  G GIV         +   ++     M 
Sbjct: 235 LMPSAKEGDFSASNNANFFASW------KKAAHGKGIVVTMKDLDKNMFEGLVTVFEEMG 288

Query: 211 TTLPVEVLIPPKDEGETDFCDVLLPKYNAKC-IYISDVLP---QSLVDNFEFKGYQFKSL 266
             LP++++   KD  +     +     NAK  +Y  D  P   Q  V+    K Y  K +
Sbjct: 289 NKLPIQLVSTGKDFTKETMDHLQNFAKNAKQDVYYVDCSPMLDQDFVEK-NIKSYVNKWI 347

Query: 267 SIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADI-- 324
            ++ ++FE L+  DAD+ P    +   +   YK TG   + D          Y I  I  
Sbjct: 348 GVLFNTFEELVFFDADSVPFIAPEKFLENSEYKKTGAYFFRDRSLGNDRTFQYCIDMIQV 407

Query: 325 --PISYNKRV---RNCIDNITPPELYTEDMEDLSNVPLHDLDGTIPDVSTESGQLMISKS 379
             P    K++   +   + + PPE  +     + N    +        + +SG +M++K 
Sbjct: 408 MEPSKEEKKLIKSKTKFETLNPPETKSSSEAAIFNSFFQNFQHN----NVDSGVVMLNKK 463

Query: 380 SHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDGY 439
             +  +L+  + +++           K    GDKE F  G    G  +   KS  ++ G 
Sbjct: 464 QKMGGLLMGFFLHLDAK--------MKKCVSGDKEMFWLGNLLAGQDYSIAKSYGSIAGN 515

Query: 440 HQPDGKGFRGVAML 453
               G G  G + L
Sbjct: 516 VGSMGDGKEGESTL 529

>Kwal_23.2926 s23 complement(78806..80512) [1707 bp, 568 aa] {ON}
           YGL257C (MNT2) - Mannosyltransferase [contig 247] FULL
          Length = 568

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 98/238 (41%), Gaps = 42/238 (17%)

Query: 198 LAFLIIKTLRNMHTTLPVEVLIPPKDEGETD---FCDVLLPKYNAKCIYISDVLPQSLVD 254
           L   ++K L +    LP++V I   D  E       + L P  N   + +S +L +  V 
Sbjct: 194 LVIRLLKVLHHQKNELPIQV-IHKGDLSEASKNLISEALSPSQNLWFVDVSSMLNKRFVR 252

Query: 255 NFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTT 314
             +F GY+ K L++I ++F   + +DAD   +   +D F+   Y  TG + + D  R   
Sbjct: 253 --DFSGYKNKWLAMILNTFSEAVFIDADAVSMMSFEDYFEMGLYNQTGALFFKD--RAFD 308

Query: 315 NPAYYDIADIPI-----------SYNKRVRNCID----NITPPELYTEDMED-LSNVPLH 358
           +   YD   +P+            Y +  +  ID    N   P      ++D       H
Sbjct: 309 HKFDYDFC-VPMIKSLQPGKHETRYFQHRKRLIDLQLRNTQDPSTEQTIIKDFFEGYQRH 367

Query: 359 DLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETF 416
            +D         SG ++I K  HL  +L +++ N+       P  S+     GDKETF
Sbjct: 368 QMD---------SGLVLIEKGKHLTPLLAAVFLNLA------PKLSK--CTHGDKETF 408

>NCAS0F00780 Chr6 (156307..158226) [1920 bp, 639 aa] {ON} Anc_7.123
          Length = 639

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/271 (23%), Positives = 112/271 (41%), Gaps = 51/271 (18%)

Query: 179 KDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKD---EGETDFCDVLLP 235
           K S  G GIV   G +   +    ++ L ++   LP++++    +   E   D  D L  
Sbjct: 236 KQSSHGKGIVLTMGERDVDMFKKQLRVLDHLGNKLPIQLVTAGSEYSPEFLKDLTDFL-- 293

Query: 236 KYNAKCIYISDVLPQSLVDNFEFKGYQF---KSLSIIASSFENLLLLDADNFPIKPLDDI 292
           K   + +Y+ +  P  L   F  K   F   K ++I+ ++FE L+L+DAD  P  PL   
Sbjct: 294 KTTNQEVYLVEASP-ILDPEFVSKYIVFFFHKWIAILLNTFEELVLIDADVVPFVPLKSF 352

Query: 293 FDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDL 352
           F  E YK+TG++L+ D   +  +   Y               C++++   E   ++ E +
Sbjct: 353 FKSEGYKTTGLLLFKDRNMKGEHTFTY---------------CMESLKYMEPSRQETEYI 397

Query: 353 SNVPLHDLDGTIPDVST-------------------ESGQLMISKSSHLPTVLLSLYYNV 393
               L D    +P  ++                   +SG + ++K+  +  +L+S   ++
Sbjct: 398 QTNLLIDSTKELPSPTSSEEAAVYNHFFKDLRLHHVDSGLVTVNKNEKMNGLLMSFMLHL 457

Query: 394 NGPSWYYPIFSQKAAGEGDKETFIAGANFYG 424
           NG          +    GDKE F  G  F G
Sbjct: 458 NGKI--------QRCVYGDKEFFWLGQLFAG 480

>KNAG0D05360 Chr4 (981032..982633) [1602 bp, 533 aa] {ON} 
          Length = 533

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 66/284 (23%), Positives = 117/284 (41%), Gaps = 58/284 (20%)

Query: 183 KGNGIVTV-GGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNA-- 239
           +G GIVT     KFS   F  +K L+  +  LP+++++      + +F D  + +  A  
Sbjct: 158 QGRGIVTTFSAKKFSDFFFRQLKVLQYHNNELPIQIIVQ-----DNEFSDDFIAEIAAAG 212

Query: 240 ----KCIYISDVLPQSLVDNFEFK---GYQFKSLSIIASSFENLLLLDADNFPIKPLDDI 292
               + +Y+  +    L+D    K   G+  K L+ + ++FE  +LLDAD  P       
Sbjct: 213 ERTKQSLYLVKI--SKLLDPANQKYLSGWINKLLANLFNTFEEFILLDADVVPYAAPHTY 270

Query: 293 FDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDL 352
           F  + Y STG+ ++ D                 +S  + +  C D +   E   +++E L
Sbjct: 271 FSTKEYTSTGLYMFQD--------------RALLSETETI--CTDTLNSLEPSKQEVELL 314

Query: 353 SN----VPLHDLDGTIPDVST-------------ESGQLMISKSSHLPTVLLSLYYNVNG 395
            +        DL G   + ST             E+G +  +K S +  ++ SL  N+N 
Sbjct: 315 GSYLQFTHTMDLQGKTQEESTYTALFKKKLPHNVETGLVTANKKSKMFGLVTSLMLNLNT 374

Query: 396 PSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDGY 439
                     +A   GDKE +  G  F G+ +    +  A+ G+
Sbjct: 375 --------KLRACFWGDKEFYWLGPLFAGVSYTIEPTPAALTGF 410

>CAGL0C03894g Chr3 complement(381514..383397) [1884 bp, 627 aa] {ON}
           weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3 or uniprot|P53059 Saccharomyces
           cerevisiae YGL257c MNT2
          Length = 627

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 64/260 (24%), Positives = 102/260 (39%), Gaps = 21/260 (8%)

Query: 179 KDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYN 238
           K   +G GIV     + + +   +I  L ++   LP++++I     G     ++L  K  
Sbjct: 217 KKHARGRGIVVTFKEEEANMMMKLIAVLGHLKNRLPIQIVIQGNKFGSRTI-EMLKEKAI 275

Query: 239 AK--CIYISDV--LPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFD 294
            K   IYI D   L          +GY  K ++ I ++FE  +LLD D  P       F+
Sbjct: 276 EKKQQIYIVDATKLLMEKYAEVHIQGYTNKWIASIFNTFEEFILLDVDTVPFINPKKFFE 335

Query: 295 EEPYKSTGMVLWPDFWRRTTNPAYYD-----IADIPIS-YNKRVRNCIDNITPPELYTED 348
           ++ Y++TG  ++ D  R   N          I+   +S Y  RV N     +P     +D
Sbjct: 336 KKGYRTTGFYMYQD--RNLVNEKLGRKCVDIISGAQLSGYEARVLNTGFLYSPYFAREDD 393

Query: 349 MEDLSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAA 408
               S    + L         ES  ++I+K   L  +L+S   N           + K  
Sbjct: 394 YTTASARAYYKLFNNWTLHQAESVLVVINKKQKLGGLLMSFMLNTQ--------IALKQC 445

Query: 409 GEGDKETFIAGANFYGLPFY 428
             GDKE F  G      P+Y
Sbjct: 446 FLGDKEFFWIGQLMNNSPYY 465

>CAGL0C03960g Chr3 complement(389250..391121) [1872 bp, 623 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
           YGL257c MNT2 or uniprot|P39106 Saccharomyces cerevisiae
           YER001w MNN1
          Length = 623

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 81/318 (25%), Positives = 135/318 (42%), Gaps = 60/318 (18%)

Query: 151 LMLSTREKAMLKENHAKFVENLSSLVLPKDSYKGNGI-VTVGGGKFSLLAFLIIKTLRNM 209
           ++   R K   KE +A F+ +       K   +G GI +TV      LL  L  K L  +
Sbjct: 207 IIAKPRTKMSAKEYNANFMGHW------KAEARGRGITLTVAPDDIKLLRSLF-KVLEKL 259

Query: 210 HTTLPVEVL-----IPPKDEGETDFCDVLLPKYNAKCIYISDVLPQSLVDNFE--FKGYQ 262
               PVEV+     + PK E   D       + N + +Y+ ++ P    D  E   K + 
Sbjct: 260 GNEYPVEVVHKGGEMTPKME---DLIRQYAEETNQE-VYVINLSPILDPDFAEENIKRFS 315

Query: 263 FKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYD-- 320
            K L+ + ++FE ++LLDAD       D  F+ + Y+ TG++LW D  R  T+   YD  
Sbjct: 316 NKWLAAMFNTFEEVMLLDADVVLYNHPDHFFELKGYQDTGLMLWKD--REITDTDVYDKC 373

Query: 321 IADIP-----------ISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHDLDGTIPDVST 369
            A  P           +   ++ R     +T P L   +  + + +  +     +  +  
Sbjct: 374 TAMAPFFEPSLEEHKLLGTTQKYR-----LTGPSLEAHNESEATTLIDYFRKKRLNVI-- 426

Query: 370 ESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAG--EGDKETF-----IAGANF 422
           +SG ++ +K   L  ++LS YY++N          +K  G   GDKE F      AG ++
Sbjct: 427 DSGVVIFNKKQKLHALVLSNYYHIN----------RKFLGCVHGDKEFFEFGVLAAGEDY 476

Query: 423 YGLPFYQVKSATAVDGYH 440
           +  P  Q  +A    G+H
Sbjct: 477 HIAP--QRAAALGPIGFH 492

>AEL345W Chr5 (1961..3898) [1938 bp, 645 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YIL014W (MNT3)
          Length = 645

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 61/274 (22%), Positives = 110/274 (40%), Gaps = 54/274 (19%)

Query: 183 KGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVL----IPPKDEGETDFCDVLLPKYN 238
           KG GI    G +   +   ++  L ++  TLP+E++    +PP    +      +     
Sbjct: 243 KGRGITITAGAEHVEMLPRLLNVLDHIGNTLPIELINAADLPPTTIDKIAKYVQMKSNQT 302

Query: 239 AKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPY 298
            + +     L  S        G++ K L+ I ++FE  + +D D  P   L+ +F+ E Y
Sbjct: 303 VRLVDCGKTLEHSY--RSLITGFRHKWLAYIFNTFEEAVFIDLDAVPFVDLEKLFEVEGY 360

Query: 299 KSTGMVLW---------PDFWRRTT-----NPAYYDIADIPISYNKRVRNCIDNIT---- 340
           KS G++++         PD   +       +P  + +     +Y+K+V    D +T    
Sbjct: 361 KSEGILMFRDRSYDGEKPDDCPKAMRIMMPSPKEHTMWQHGSNYDKQVAE--DELTKKPR 418

Query: 341 ---PPELYTEDMEDLSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPS 397
                  Y + ME  S    H           ESG +++ K+  LP++L+SL  ++    
Sbjct: 419 DAGAATFYIKYMEGKS---FH---------MAESGLIVMHKNKKLPSLLISLMLHMT--- 463

Query: 398 WYYPIFSQKAAGEGDKE-----TFIAGANFYGLP 426
                F       GDKE       ++G N+Y  P
Sbjct: 464 -----FETHLCSHGDKEYLWLGQLVSGENYYVDP 492

>CAGL0C04048g Chr3 complement(399734..401596) [1863 bp, 620 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
           YGL257c MNT2 or uniprot|P39106 Saccharomyces cerevisiae
           YER001w MNN1
          Length = 620

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 79/347 (22%), Positives = 140/347 (40%), Gaps = 48/347 (13%)

Query: 183 KGNGIV-TVGGGKFSLL--AFLIIKTLRNMHTTLPVEVLIPPKD---EGETDFCDVLLPK 236
           +G GIV TV      LL   F + K L N    LP++V+    +   E E    +  +  
Sbjct: 231 RGKGIVLTVSQSDVPLLRQQFRVWKELGN---KLPIQVVHKGTEINAELEQKIKEYAIEM 287

Query: 237 YNAKCIYISDVLP-------QSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPL 289
              + +Y+ D+ P       ++ + NF  K Y     + I ++FE L+L+DAD  P  P 
Sbjct: 288 --EQDVYVVDLSPVIDPDFAENSIQNFHNKWY-----AAIFNTFEELILIDADAIPYVPA 340

Query: 290 DDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIP-ISYNKRVRNCIDNITPPELY--- 345
           +D    + YK TG+ LW D         ++ +   P         N I       L    
Sbjct: 341 EDFLKSKSYKKTGLRLWRDRDITHERTLHFCVEMAPYFEPTLEEHNLIGTTLSYRLTDSG 400

Query: 346 TEDMEDLSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLS--LYYNVNGPSWYYPIF 403
            +D +D     L++    +     +SG ++I K   + ++++S  L+ +       Y   
Sbjct: 401 LKDAKDSEGRALYEFFQKMYLHHVDSGLVVIDKKDKIHSLIMSEILHSHTRFGRCTY--- 457

Query: 404 SQKAAGEGDKETFIAGANFYGLPF-YQVKSATAVD--GYHQPDGKGFRGVAMLQHDFVQD 460
                  GDKE F+ GA   G  +  + +SA  +   GY +   + +     + H    +
Sbjct: 458 -------GDKELFMLGAYMVGESYTLEAQSAAIIGTVGYEKEFSRHYICATQMGHS--DE 508

Query: 461 YQRYQWAFKDIRTQYSGKTSNSIHLDKDYTPESFYRKYFEGDDIKEV 507
             R  W+   +RT          + D++Y    + ++Y   D++K V
Sbjct: 509 DNRLLWSNGGLRTCKFDCAEEDFNKDEEY----YKKRYQNVDNLKAV 551

>CAGL0C04004g Chr3 complement(394614..396512) [1899 bp, 632 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
           YGL257c MNT2 or uniprot|P39106 Saccharomyces cerevisiae
           YER001w MNN1
          Length = 632

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 81/360 (22%), Positives = 144/360 (40%), Gaps = 43/360 (11%)

Query: 165 HAKFVENLSSLVLPKDSYKGNGI-VTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKD 223
           +A F+ N   L        G GI +TV       +  L  + L+ +  T P++V+   + 
Sbjct: 233 NANFMANWRQLA------NGKGIAITVNPDDVEFMIRLF-RVLKELGNTYPIQVI---QK 282

Query: 224 EGETDFCDVLLPKYNA----KCIYISDVLPQSLVDNF---EFKGYQFKSLSIIASSFENL 276
            GE     +   K  A    + + I D+ P  L + F   +   +  K  + + ++FE +
Sbjct: 283 GGELTSPLIEQIKKTAIETNQAVSIVDLSP-ILDEKFAREQITSFHNKFFAAMFNTFEEV 341

Query: 277 LLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCI 336
           LLLDAD  P   LD+ F+ + YK TG+  W D  R +    +     + +  +    N +
Sbjct: 342 LLLDADVVPYVSLDEFFNLKGYKDTGLQFWRDRNRGSDTHKFCSNLGVYLEPSLEEHNLL 401

Query: 337 DN---ITPPELYTEDMEDLSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNV 393
                     L  + +        H     +   + +SG ++++K   L ++++   +  
Sbjct: 402 GTELKFRINSLAKKKVRSSEERAFHRFFNELKVHNIDSGIIVLNKKQKLHSLIMGEIFYT 461

Query: 394 NGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPF-YQVKSATAVD--GYHQPDGKGFRGV 450
           NG       F + A   GDKE F+ GA   G  F    + A  +   GY+      F   
Sbjct: 462 NGR------FGRCAY--GDKEMFMMGAFATGADFIIDPRDAGIIGPIGYNIDQRVNFICS 513

Query: 451 AMLQHDFVQDYQRYQWAFKDIRTQYSGKTSNSIHLDKDYTPES---FYRKYFEGDDIKEV 507
           A + H  + +  R  W+   +R              KDYTP++   F +KY   D++  +
Sbjct: 514 AQMGH--LDENNRVLWSNGGLRF-----CKFPDFAKKDYTPKNQDYFIQKYQSYDNMARI 566

>TDEL0F05640 Chr6 complement(1055778..1057442) [1665 bp, 554 aa]
           {ON} 
          Length = 554

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 81/372 (21%), Positives = 142/372 (38%), Gaps = 60/372 (16%)

Query: 168 FVENLSSLVLPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLP------------- 214
           F EN  + ++  +S KG  ++++G G+ +     +I  LR +  TLP             
Sbjct: 163 FWENWYTSMMQANS-KGI-VISIGDGQVAD-TIRLIHVLRYLDNTLPIQLVHKGDLSSAK 219

Query: 215 VEVLIPPKDEGETDFCDVLLPKYNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFE 274
           VE L     E  +D      P      + + ++L  +++  +EFK +  K L+++  SFE
Sbjct: 220 VEELFKAARERRSDGS----PPQELWIVDVKNLLNPAMI--YEFKRFSNKWLALLFCSFE 273

Query: 275 NLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRN 334
             +LLDAD  P   L++ +D + +K  G V + D   RT               N+  R 
Sbjct: 274 KPILLDADTVPFTKLEEYYDTDQFKKYGTVFFKD---RTLTAHM---------LNRGQRR 321

Query: 335 CIDNITPPELYTEDMEDLSNVPLHDLDGTIPDV-----------STESGQLMISKSSHLP 383
            +  I    L + D +  ++      D  +                ESG +   K  HL 
Sbjct: 322 TLKRIFDGLLTSSDRQSSADSYYGIQDPIVQKALERILKKRQKHIMESGLVAYDKKKHLF 381

Query: 384 TVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPF-YQVKSATAVDGYHQP 442
            +L SL    +  + Y+          G+KE F       G+PF +    A++V    + 
Sbjct: 382 GLLTSLALQFSPLNEYF---------HGEKEWFWISQLIRGVPFSFHPVEASSVGRIEKT 432

Query: 443 DGKGFRGVAMLQHDFVQDYQRYQWAFKDIRT----QYSGKTSNSIHLDKDYTPESFYRKY 498
               FR V  +Q    +      W    +RT     +  +  N   L   ++     RK 
Sbjct: 433 SEDEFR-VCSVQLSHTEQDGSILWLNGGLRTCKFDNWDWEYENKPSLSSVFSSAEDLRKV 491

Query: 499 FEGDDIKEVDIM 510
           ++   + E  I+
Sbjct: 492 YQSPAVLEAVIL 503

>KNAG0E03170 Chr5 complement(632635..634875) [2241 bp, 746 aa] {ON} 
          Length = 746

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/313 (21%), Positives = 129/313 (41%), Gaps = 41/313 (13%)

Query: 184 GNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVL--LPKYNAKC 241
           G G++T       +L    ++ L+     LP++V I    E   +F   L  + + + + 
Sbjct: 208 GRGLITTMKSDDIVLYEKQMRILKEFDNKLPLQV-ITTGSEMRDEFVKQLQIIAEIHNQE 266

Query: 242 IYI---SDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPY 298
           IY+   SD++ +  V N +   ++ K LS++ ++FE  + +D D  P     + F+ + Y
Sbjct: 267 IYLVDLSDIIDRRFV-NDKIDRFKHKFLSVLFNTFEEAIFMDVDAVPFVETTEFFEIQAY 325

Query: 299 KSTGMVLWPDF------------WRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYT 346
           K TGM L+ D               R   P++   A+  +  N+   + +  I    + T
Sbjct: 326 KDTGMYLYRDRSLDEGGEGNCRPLMRQLEPSF---AESRLLNNRLKFDLLWAIEHNGMST 382

Query: 347 EDMED----LSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPI 402
           + M        N+ ++     I     ESG ++I++   +  ++ ++ + ++        
Sbjct: 383 KYMTSEEAVFKNMYVYGRRHHI-----ESGLMVINRRKQMAGLIGAMLFGLSN------- 430

Query: 403 FSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDGYHQPD-GKGF-RGVAMLQHDFVQD 460
            S      GDKE F  G  + G  +        + GY + D G  F + +   Q   V +
Sbjct: 431 -SGSKCSWGDKEFFWLGNLYAGKDYAVNPMEGGIVGYLKEDPGNNFKKTICGTQLAHVDE 489

Query: 461 YQRYQWAFKDIRT 473
           + R  W    +RT
Sbjct: 490 FDRLMWTNGGLRT 502

>CAGL0H09262g Chr8 complement(908258..910135) [1878 bp, 625 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3
          Length = 625

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 73/328 (22%), Positives = 123/328 (37%), Gaps = 78/328 (23%)

Query: 179 KDSYKGNGIV---TVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLP 235
           K+  KG GIV   +V   +F    F + K L N   T P++V+   K+         + P
Sbjct: 230 KNEAKGRGIVVTASVNDCRFLRSQFFVWKELGN---TYPIQVVTKGKE---------MPP 277

Query: 236 KYNAKC----------IYISDV-------LPQSLVDNFEFKGYQFKSLSIIASSFENLLL 278
           +  AK           +YI D+         +  ++NF  K Y     + + ++FE  +L
Sbjct: 278 ELIAKIKEYATEADQEVYIVDLQNVLDPNYAEKYIENFHNKWY-----AAMFNTFEEAIL 332

Query: 279 LDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISY---------- 328
           +DAD       D+ F+   +K TG+ LW D           DI DI +            
Sbjct: 333 VDADVVSYVHPDEYFESADFKKTGLKLWRD----------RDIPDIHVHIYCLNMAPYFL 382

Query: 329 -NKRVRNCIDNITPPELYTEDMEDLSNVP---LHDL----DGTIPDVSTESGQLMISKSS 380
            +K     +       L  E ++D        LH       G+I D    SG ++ +K  
Sbjct: 383 PSKEEHRTLGTTLKYRLEEESLKDAGTSEADGLHKFFFEKSGSIVD----SGLVVFNKKK 438

Query: 381 HLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDG-Y 439
            L ++++S +++ +           K    GDKE F+ GA   G+ +     A  + G  
Sbjct: 439 KLHSLIISEFFHTDAKF--------KPCTYGDKEIFMLGAYSAGVDYSLDPEAAVIIGPI 490

Query: 440 HQPDGKGFRGVAMLQHDFVQDYQRYQWA 467
            +   K F  +   Q        +  W+
Sbjct: 491 RESTNKKFNSICSAQMGHTNGRGKLLWS 518

>AAR183C Chr1 complement(672091..674037) [1947 bp, 648 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YIL014W
           (MNT3)
          Length = 648

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 99/247 (40%), Gaps = 50/247 (20%)

Query: 117 RVYDPRCKLDGDIGAR-------------------LDDYDNWFKLTSEEL----GQCLML 153
           RV+D  C + GDIG R                   L    +W +L  + L    G   +L
Sbjct: 172 RVFDT-CFMQGDIGLREVFGEDINLYSLHHELFPFLKKVRDWSELLPQVLDLNDGSRYLL 230

Query: 154 STR--EKAMLKENHAKFVENLSSLVLPKDSYKGNGIV-TVGGGKFSLLAFLIIKTLRNMH 210
             +  E+A   +N   F ENL      + S  G GIV TV       L  L+   L  + 
Sbjct: 231 GNKLPEQAFKVDNDLPFWENL------RRSSSGRGIVATVADIHLDQLKRLL-HVLDELG 283

Query: 211 TTLPVEVLIPPKDEGETDFCDVLL-----PKYNAKCIYISDVLPQSLVDNFEFKGYQFKS 265
             LP+E++    D        +        K   + +  S VL  + +   + K +  K 
Sbjct: 284 NKLPIELVYKGNDFSRLPIKRLKRYVRQHTKQRVRLVDCSRVLRSTHIP--KIKRFMNKW 341

Query: 266 LSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIP 325
           L+ I +SFE ++LLD D  P+ P+D  F    Y  TG +    F++  T P Y     +P
Sbjct: 342 LATIFNSFEEIILLDVDVVPLVPIDSYFKLPGYTKTGAL----FFKDRTLPEY-----LP 392

Query: 326 ISYNKRV 332
           +S  K +
Sbjct: 393 VSCTKAI 399

>KAFR0K01240 Chr11 complement(258683..260683) [2001 bp, 666 aa] {ON}
           Anc_7.123 YIL014W
          Length = 666

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 92/402 (22%), Positives = 155/402 (38%), Gaps = 91/402 (22%)

Query: 171 NLSSLVLPKDSYKGNGIVT---VGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGET 227
           NL+ L   K   KG GIVT   +G  K   L +  +K L  ++ TLP++++       E 
Sbjct: 251 NLNFLQYWKMLGKGRGIVTTLPIGDIK---LFYKQLKVLDYLNNTLPIQIVTTGGASVEL 307

Query: 228 DFCDVL--LPKYNAKCIYISDVLP--QSLVDNFEFKGYQFKSLSIIASSFENLLLLDADN 283
            F + L    K   + I + D  P   +   +   + +  K +SI+ ++FE ++ +D D 
Sbjct: 308 -FIEELKSYSKSTHQKILLIDTSPMLNTSFASLYIRFFSNKWISILFNTFEEMIFMDVDV 366

Query: 284 FPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPE 343
            P    ++ F+ + YK TG+ ++ D  R   N   +             + CID     E
Sbjct: 367 VPFVNPNEFFEIDGYKETGIFMYKD--RALLNEHTF-------------QYCIDTFRGLE 411

Query: 344 LYTEDMEDLSNVPLHDLDGTIPDVS---------------------------TESGQLMI 376
              ++ E LS    H LD  +   S                            +SG ++I
Sbjct: 412 PSMQENELLSKN--HVLDRLLRGSSDKSKSAKDQTGQQQTFNSFFIDQKLHHVDSGLVVI 469

Query: 377 SKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAV 436
            K      +L+S   N++        +  +    GDKE F  G  F G   Y + +  A 
Sbjct: 470 DKKRKFDGILMSFLLNID--------WKTQRCVYGDKEVFWLGHLFAGSD-YAIDATYA- 519

Query: 437 DGYHQPDGKG----------FRGVAMLQHDFVQDYQRYQWAFKDIRTQYSGKTSNSIHLD 486
            G   P GK               A + H+   D +R  WA   ++T    K  N+   D
Sbjct: 520 -GLLGPIGKDDDEATSSTRYHICSAQISHN---DGERLMWANGGLKT---CKLDNAAEAD 572

Query: 487 KDYTPESFYRKYFEGDDIKE-------VDIMFVHSNLPKFDP 521
            D  P+ F  +Y + + +++       +D M +    P+ DP
Sbjct: 573 FDANPDYFSSRYNDKETLEQMYSSALGIDAMIIPD--PEVDP 612

>Suva_14.418 Chr14 (721586..723328) [1743 bp, 580 aa] {ON} YNR059W
           (REAL)
          Length = 580

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 98/237 (41%), Gaps = 39/237 (16%)

Query: 202 IIKTLRNMHTTLPVEV--------------LIPPKDEGETDFCDVLLPKYNAKCIYISDV 247
           +I+ LR ++ +LP+E+              +   ++    D+    L   N K +   D 
Sbjct: 215 LIRVLRLLNNSLPIEIVHKSDLSEYYQQLLIASARESASLDYPPQELWFLNVKSLLKDDY 274

Query: 248 LPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWP 307
             +       FK +  K L+I   SF+  +LLD+D  P  PLD  ++ + +K TG + + 
Sbjct: 275 AAK-------FKRFSNKWLAITFCSFQKPILLDSDAVPFVPLDTFYEADEFKKTGTLFFK 327

Query: 308 DFWRRTTNPAYYDIADIPISYNKRVRNC----IDNITPPELYTEDM-EDLSNVPLHDLDG 362
           D   R+   +   +  I +   K + +C    +D+    EL    + +D++   +  L  
Sbjct: 328 D---RSFPTSKLSLRKINV-LKKVIGDCLGIPLDSKKGLELLKNRLNDDMAMDAVESLFI 383

Query: 363 TIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAG 419
                  ESG L++ K  H   +L+S+    +    Y+          GDKE F  G
Sbjct: 384 KHQKHYMESGLLVLDKQKHFFGLLVSIMLQFSPIREYF---------YGDKEWFWLG 431

>TPHA0L00820 Chr12 complement(162210..164402) [2193 bp, 730 aa] {ON}
           
          Length = 730

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 113/257 (43%), Gaps = 44/257 (17%)

Query: 202 IIKTLRNMHTTLPVEVLIPPKDE-GETDFCDVL---LPKYNA-KCIYISDV---LPQSLV 253
           +I  L   + TLP++++    +E  + +F + L   L   N+ + ++I +V   L +  V
Sbjct: 325 MINVLDFQNNTLPIQIITKGNNELTKENFINELQSFLQNNNSTQTVFIVNVETLLNKHYV 384

Query: 254 DNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIF--------DEEPYKSTGMVL 305
           +N     +  K +SII S+F+  + LD D+ P   LD+ +        D + YK TGM++
Sbjct: 385 ENM-LNFFYNKWVSIIFSTFKETIFLDVDSIPFVNLDEFYFQENNINNDYKNYKDTGMLM 443

Query: 306 WPDFWRRTTNPAYYDIADIPISYNKRV--------RNCIDNITPPELYTEDMEDLSNVPL 357
           + D  R   N   +      + + +           N + N T P++  +D+  + N   
Sbjct: 444 YKD--RMLINEFTFGYCMDALKFVEPSLQESQLINSNILFNSTSPKI--DDITSIENTND 499

Query: 358 HDLDGTIPDVSTE-------SGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGE 410
            ++     +  T+       SG ++I+K   L +++ SL  N+NG          +    
Sbjct: 500 REIYNIYNNFLTKIFAIISISGLVVINKDKKLFSLIFSLMMNLNGK--------LQRCVY 551

Query: 411 GDKETFIAGANFYGLPF 427
           GDKE F  G  F G  F
Sbjct: 552 GDKEFFWLGQLFAGERF 568

>Skud_14.395 Chr14 (704847..706589) [1743 bp, 580 aa] {ON} YNR059W
           (REAL)
          Length = 580

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 74/329 (22%), Positives = 127/329 (38%), Gaps = 53/329 (16%)

Query: 100 SQVFKYLHLYSPKGKSTRVYDPRCKLDGDIGARLDDYDNWFKLTSEE------------- 146
           SQ    L  Y    K T + D    L  ++ ++L  Y N+ KL++E+             
Sbjct: 95  SQSLSSLRWYQQCTKETTI-DQDVHLLREVESKLFPYMNFAKLSNEDSQAFWPLHTRFDG 153

Query: 147 ---LGQCLMLSTREKAMLKENHAKFV------ENLSSLVLPKDSYKGNGIVTVGGGKFSL 197
               G+ L  S    + +  +   F+      EN     + KDS    G+V         
Sbjct: 154 TTHRGRVLHFSVENNSFIGTSPVGFISGRSFWENWLHSAIQKDS---KGLVMSASDALVS 210

Query: 198 LAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKCIYISDVL----PQSLV 253
               +++ LR ++ +LP+E++        +    +   + +A   Y    L     +SL+
Sbjct: 211 DTIRLMRILRLLNNSLPIEIVHKSDLSKSSQQLLIASARESASSNYPPQELWFLDVKSLI 270

Query: 254 -DNF--EFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFW 310
            D +   FK +  K L+I  SSF+  + LD+D  P  PLD  +    ++ TG + + D  
Sbjct: 271 KDEYLNRFKRFSNKWLAITFSSFQMPIFLDSDTVPFVPLDGFYRTGEFERTGTLFFKD-- 328

Query: 311 RRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTED-MEDLSNVPLHDLD-GTIPDVS 368
                   + ++ +     K +R  I+N       +E   E L N    D   G I  V 
Sbjct: 329 ------RSFPLSKLSSQQTKALRQIINNSLGISSNSEQGFESLKNSSKDDTAIGAIDSVI 382

Query: 369 -------TESGQLMISKSSH---LPTVLL 387
                   +SG L+I K  H   LP  ++
Sbjct: 383 FKQQKHYMDSGLLVIDKQKHFFCLPIAIM 411

>TBLA0G03680 Chr7 complement(975688..977943) [2256 bp, 751 aa] {ON} 
          Length = 751

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 66/290 (22%), Positives = 111/290 (38%), Gaps = 65/290 (22%)

Query: 186 GIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLP---------- 235
           G++   G K    A  +I  LR    TLP++++I   D  +     +L            
Sbjct: 323 GVILSFGDKHLKWALKLIMALRYRQNTLPIQIIITKNDLSKNSMEKILFAAQSDEVQIKD 382

Query: 236 -----------KYNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNF 284
                      K     + +++++     DNF   G++ K L+ I + FE  + LDAD  
Sbjct: 383 KKGNVMKDVFTKQEIIFVDVTNIIDPEFFDNF--TGWKSKWLASIFNLFEEYIFLDADAI 440

Query: 285 PIKPLDDIFDEEPYKSTGMVLWPD-----FWRRTTNP------------AYYDIADIPIS 327
               L+  F+ + Y  TG + + D     +  RT N              Y+D     I 
Sbjct: 441 SYVDLNHYFNTKEYNETGTIFFRDRMLEHYLPRTCNALLESVHPMLPESKYFDNHKY-ID 499

Query: 328 YNKRVRNCIDNITPPE-LYTEDMEDLSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVL 386
               +  C   + P E +Y +   D  N+ LH +         ESG   I K+SH+  ++
Sbjct: 500 EEHVLNECEQYLDPNEKIYKQFFAD--NL-LHQM---------ESGLYAIDKTSHIIPLI 547

Query: 387 LSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLP--FYQVKSAT 434
           + +  ++       PI   +    GDKE F  G    G P  F+ + + T
Sbjct: 548 MGMTLHM------LPI---EKCSYGDKEFFWLGFLASGHPYAFHPINAGT 588

>CAGL0H09240g Chr8 complement(905670..907598) [1929 bp, 642 aa] {ON}
           some similarities with uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3
          Length = 642

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 84/197 (42%), Gaps = 38/197 (19%)

Query: 242 IYISD---VLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPY 298
           IYI D   VL ++  D      +  K + ++ ++FE  +++DAD  P    +D F+ E +
Sbjct: 302 IYIVDAGPVLDKNFADE-HITKFHNKWVGVLFNTFEEYIMVDADTVPFISAEDFFESENF 360

Query: 299 KSTGMVLWPDFWRRTTNPAYYD-IADIPISYNKRVR-------NCIDNITPPELYTEDME 350
           K +GM +W D  R  TN    +   D+ +     +             +  P+L  E   
Sbjct: 361 KKSGMRMWRD--RTLTNRHIREHCPDLALKLEPSLEEHRILGTTLRFKLLDPDLKQEKTS 418

Query: 351 D-------LSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIF 403
           +        +N+ LH +D         SG ++I+K   L ++LLS ++        + +F
Sbjct: 419 EERAFNQMRTNLALHHVD---------SGLVVINKKEKLHSLLLSEFFQ------NHALF 463

Query: 404 SQKAAGEGDKETFIAGA 420
             +    GDKE F   A
Sbjct: 464 --RRCSYGDKELFWYAA 478

>Smik_7.4 Chr7 complement(8045..9733) [1689 bp, 562 aa] {ON} YGL257C
           (REAL)
          Length = 562

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 76/174 (43%), Gaps = 29/174 (16%)

Query: 257 EFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNP 316
           +F  Y  K L++I SSFE  +LLD+D  P   +D  +  E ++ TG++ + D   R  + 
Sbjct: 253 KFATYSNKWLALIFSSFEIPILLDSDTVPFVSIDKFYKLEEFQKTGVLFFKD---RVISD 309

Query: 317 AYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHDLDGTIPDV--------- 367
             +D   + +     +++ I   T   L  E  +   N+  H  + T+  V         
Sbjct: 310 DLFDPPQLEV-----LKDIIHGCTGINLLDES-KIRDNIAEHIREPTVARVLENMLIKKY 363

Query: 368 --STESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAG 419
               ESG +++ K  HL ++L S+    +  S Y+          GDK+ F  G
Sbjct: 364 KHHLESGLVVLHKGKHLFSMLTSISLQFSPISEYF---------HGDKDFFWLG 408

>Smik_9.180 Chr9 (300789..302681) [1893 bp, 630 aa] {ON} YIL014W
           (REAL)
          Length = 630

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 75/360 (20%), Positives = 136/360 (37%), Gaps = 68/360 (18%)

Query: 183 KGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVL-LPKYNAKC 241
           +G G V     K   L    +K +  +   LP +++   +        ++  + K   + 
Sbjct: 233 EGRGFVLTFAEKDVPLFLKQLKVMDFLRNELPFQIITTGEGLSTESIAEISKIAKEAKQK 292

Query: 242 IYISDVLPQSLVDNFEFKG-----YQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEE 296
           +Y+ D    S V + EF       +Q K ++ + ++F+  +LLDAD  P    D  FD  
Sbjct: 293 VYLVDC---STVLDTEFSKKYISFFQNKWVATLFNTFKEYILLDADVVPFVESDYFFDSP 349

Query: 297 PYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDL---- 352
            Y+ +G++L+ D   ++     Y               CI+ +   E   ++ + +    
Sbjct: 350 SYRQSGILLFKDRVMKSEQTFSY---------------CIEMLREVEPSGQERKSIGSKL 394

Query: 353 ---SNVPLHDLDGTIPDV-----------STESGQLMISKSSHLPTVLLSLYYNVNGPSW 398
              S++P   ++     V             +SG ++++K   L  +L+S  +N+NG   
Sbjct: 395 IFDSSLPFSSINSEEASVYYNFFKKLQLHHVDSGLVVVNKLEKLNGLLMSFMFNLNG--- 451

Query: 399 YYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDG---------YHQPDGKGFRG 449
                  +    GDKE F  G  + G    Q  S   VDG             DG   R 
Sbjct: 452 -----KLQRCVYGDKEIFWLGQLYAG----QDYSINPVDGGIIGPVIEQSVNDDGGPSRN 502

Query: 450 VAMLQHDFVQDYQRYQ--WAFKDIRTQYSGKTSNSIHLDKDYTPESFYRKYFEGDDIKEV 507
             +          + Q  W    ++T    K SNS   D +  PE F  +Y E  +++ +
Sbjct: 503 YYICSAQIAHSDSKNQLLWINGGLKT---CKFSNSAADDFNKEPEYFKSRYKEAAELQRL 559

>ZYRO0G04048g Chr7 complement(328792..330717) [1926 bp, 641 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014W MNT3 Alpha-1 3-mannosyltransferase adds the
           fourth and fifth alpha-1 3-linked mannose residues to
           O-linked glycans during protein O-glycosylation
          Length = 641

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 68/154 (44%), Gaps = 11/154 (7%)

Query: 159 AMLKENHAKFVENLSSLVLPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVL 218
           A+ ++ +A F  N   L       KG GI          L    ++ L  ++ TLP++V+
Sbjct: 220 AVAQDTYANFWNNWIKLS------KGKGIAATFNPTELTLFHRQLRVLSKLNNTLPIQVV 273

Query: 219 IPPKD--EGETDFCDVLLPKYNAKCIYI--SDVLPQSLVDNFEFKGYQFKSLSIIASSFE 274
               +    + D         + +   I  S +L +    N   + +  K L+ + ++FE
Sbjct: 274 TSGFEFTRAQVDQLSQYARDTDQEVTLIDCSTILIKEFTQN-NVEKFVNKWLAALFNTFE 332

Query: 275 NLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPD 308
            +LLLD D  P   +++ F E  Y++TGM L+ D
Sbjct: 333 EVLLLDVDTVPFVDVEEFFKEPQYRATGMALFKD 366

>CAGL0C04026g Chr3 complement(397303..399213) [1911 bp, 636 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3
          Length = 636

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 69/165 (41%), Gaps = 17/165 (10%)

Query: 161 LKENHAKFVENLSSLVLPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIP 220
           + E +AKF+    ++       KG GI      K   +   +   L      LP++++  
Sbjct: 232 VSEYNAKFIPTWRNMA------KGKGIAVSVSPKEIRMLHSLFAVLNQQGNKLPIQII-- 283

Query: 221 PKDEGET-DFCDV-LLPKYNAKCIYISDVLPQSLVDNFEFK-----GYQFKSLSIIASSF 273
             D+GET    D  L+  Y  K      V+  S + + E+      G   K  + + ++F
Sbjct: 284 --DKGETLTLADKELIKSYAVKTNQDVSVVDLSPIIDAEYADENIIGMHNKWFAAMFNTF 341

Query: 274 ENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAY 318
           E +LLLD D  P    +  F  EPY S  ++ W +   +  NP Y
Sbjct: 342 EEVLLLDVDVIPFVGTEKFFQLEPYTSRHILFWRNRDIKKKNPKY 386

>Kpol_298.4 s298 (12426..14321) [1896 bp, 631 aa] {ON}
           (12426..14321) [1896 nt, 632 aa]
          Length = 631

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/262 (22%), Positives = 104/262 (39%), Gaps = 44/262 (16%)

Query: 184 GNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYN--AKC 241
           G GIV   G +   + F +++ L       P+++ +   +E   +F + +  +     + 
Sbjct: 239 GKGIVITMGERDKPMLFKLLRVLEFQDNKYPIQI-VTSGNELSREFINEIHDELQRIKQD 297

Query: 242 IYISDVLPQSLVDNFEFK----GYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEP 297
           +Y+ D    SL+D    K     +  K L++I ++FE ++ LD D  P   +D  FD E 
Sbjct: 298 VYLVDC--GSLLDPHYSKDLIINFLNKWLAVIFNTFEEVIFLDVDVIPFVDMDYFFDNEE 355

Query: 298 YKSTGMVLWPD--FWRRTTNPAYYD-------------IADIPISYNKRVRNCIDNITPP 342
           YKS+ ++L+ D      +T P   D             +    I ++ R +    N    
Sbjct: 356 YKSSNLLLYKDRVMLHESTYPHCIDMFHEVEPSREESAVLGTKILFDSRTKEFDHNSQVA 415

Query: 343 ELYTEDMEDLSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPI 402
             +      L    LH +D         SG ++++K   L  +L S   +++        
Sbjct: 416 MTFRNFFRKLQ---LHHVD---------SGLIVVNKMEKLNGLLFSFMLHLDAKV----- 458

Query: 403 FSQKAAGEGDKETFIAGANFYG 424
              +    GDKE F  G  F G
Sbjct: 459 ---RRCVYGDKELFWIGQLFAG 477

>YIL014W Chr9 (326103..327995) [1893 bp, 630 aa] {ON}
           MNT3Alpha-1,3-mannosyltransferase, adds the fourth and
           fifth alpha-1,3-linked mannose residues to O-linked
           glycans during protein O-glycosylation
          Length = 630

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 80/354 (22%), Positives = 132/354 (37%), Gaps = 56/354 (15%)

Query: 183 KGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVL-LPKYNAKC 241
           KG G V     K   L    +K +      LP +++    +        +    K   + 
Sbjct: 233 KGRGFVLTIAEKDVPLFLKQLKVMEFSKNELPFQIVSTGNELSAESIAKISETAKETEQR 292

Query: 242 IYISD---VLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPY 298
           +Y+ D   VL  +  + +    +Q K ++ + ++FE  +LLDAD  P    D  FD   Y
Sbjct: 293 VYLVDCSTVLDTNFANTY-ISFFQNKWVATLFNTFEEYILLDADVVPFVGSDYFFDSPSY 351

Query: 299 KSTGMVLWPDFWRRTTNPAYYDIADI----PISYNKRV---RNCIDNITPPELYTEDMED 351
           + +G++L+ D          Y I  +    P +  +R    R   D+  P    +E  E+
Sbjct: 352 RESGILLFKDRVMENEQTFQYCIEMLNEVEPSAQERRFIGSRLVFDSSLP--FSSETSEE 409

Query: 352 LS-------NVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFS 404
            S        + LH +D         SG ++++K   L  +L+S   N++G         
Sbjct: 410 ASVYYNFFKKLRLHHVD---------SGLVVVNKLEKLNGLLMSFMLNLDGK-------- 452

Query: 405 QKAAGEGDKETFIAGANFYGLPFYQVKSATAVDGY------HQPDG-----KGFRGVAML 453
            +    GDKE F  G  + G    Q  S   VDG        +P+       G   +   
Sbjct: 453 LQRCVYGDKEIFWLGQLYAG----QDYSINPVDGSIIGPVNEEPENDDGHKSGMYYICST 508

Query: 454 QHDFVQDYQRYQWAFKDIRTQYSGKTSNSIHLDKDYTPESFYRKYFEGDDIKEV 507
           Q        R  W    ++T    K SNS   D    PE F  +Y +   +K +
Sbjct: 509 QIAHSDSKNRLLWVNGGLKT---CKISNSAEDDFGREPEYFKSRYGDISKLKRI 559

>YNR059W Chr14 (736803..738545) [1743 bp, 580 aa] {ON}  MNT4Putative
           alpha-1,3-mannosyltransferase, not required for protein
           O-glycosylation
          Length = 580

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 57/255 (22%), Positives = 95/255 (37%), Gaps = 67/255 (26%)

Query: 100 SQVFKYLHLYSPKGKSTRVYDPRCKLDGDIGARLDDYDNWFKLTSEE------------- 146
           S+    L LY    K  R  D    L   I  +L  Y N+  L SE+             
Sbjct: 95  SRSLSNLDLYQKCSKEIRA-DQDISLLHSIETKLFPYINFTALNSEQSHNFWPVHTRFDG 153

Query: 147 ---LGQCLMLSTREKAMLKENHAKF------VENLSSLVLPKDSYKGNGIVTVGGGKFSL 197
               GQ L  S+   + +  +  +F       EN  +  L ++S    G+V         
Sbjct: 154 TKYRGQVLQFSSENNSFIGTSPIEFKASEPFWENWLNSALQRNS---KGVVMSVSEYLVA 210

Query: 198 LAFLIIKTLRNMHTTLPVEVL------------------------IPPKDEGETDFCDVL 233
               +I+ LR ++ +LP+E++                         PP++    D  D+L
Sbjct: 211 DTIRLIRVLRLLNNSLPIEIVHKSDLHESSQQLLIAAARESGSLNYPPQELWFLDVKDML 270

Query: 234 LPKYNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIF 293
             +Y A+                 FK +  K L+I   SF+  + LD+D  P  PLD ++
Sbjct: 271 NDEYLAR-----------------FKRFSNKWLAITFCSFQIPIFLDSDTVPFVPLDTLY 313

Query: 294 DEEPYKSTGMVLWPD 308
           + + +K TG + + D
Sbjct: 314 EIDGFKRTGTLFFKD 328

>TPHA0H00240 Chr8 (40339..42828) [2490 bp, 829 aa] {ON} 
          Length = 829

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 87/209 (41%), Gaps = 40/209 (19%)

Query: 257 EFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFW------ 310
           EF  Y+ K L+++ +  + +L LD D       +  F+ E +K+TG + + D +      
Sbjct: 430 EFTKYKNKWLALLLNPLKEVLFLDTDTVNYMDPNFYFETEQFKNTGTLFFRDRFLNIGKS 489

Query: 311 ------RRTTNPAYYD---IADIPISYNKRVRNCIDNITPPELYTEDM---EDLSNVPLH 358
                   T +P + +      +P+  N  +   + N+T  +L TE++       N   H
Sbjct: 490 EVCSQISETLSPNFQESFYFGKLPLFDNNYI---LKNLTETDLTTEELVFKSYFDNNIQH 546

Query: 359 DLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIA 418
           +L         ESG + + K +H+  +L+S   N+  P              GDKE F  
Sbjct: 547 EL---------ESGLMALDKENHIIPLLISRNLNLYKPF--------AGCSHGDKEFFWL 589

Query: 419 GANFYGLPF--YQVKSATAVDGYHQPDGK 445
           G    G PF  Y V++ T  +   + D +
Sbjct: 590 GFVASGAPFSIYPVRAGTVGEVLTETDTR 618

>CAGL0C03982g Chr3 complement(391909..393798) [1890 bp, 629 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
           YGL257c MNT2 or uniprot|P53745 Saccharomyces cerevisiae
           YNR059w MNT4
          Length = 629

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 66/138 (47%), Gaps = 13/138 (9%)

Query: 179 KDSYKGNGI-VTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGE-TDFCDVLLPK 236
           K   KG GI +T+  G   LL  L  K L+      PV+++   +  GE T   + L+ K
Sbjct: 233 KRESKGKGITLTIAPGDIKLLRSLF-KVLQRQGNEYPVQII---QKGGEMTPKMESLIKK 288

Query: 237 YNAKC---IYISDVLPQSLVDNFEFK---GYQFKSLSIIASSFENLLLLDADNFPIKPLD 290
           Y  +    +YI D+ P  L   F  +    +Q K  + + ++FE  LLLDAD       +
Sbjct: 289 YALETEQDVYIIDLAP-ILDPAFAIQRITKFQNKWFASMFNTFEEALLLDADVVLYTEPE 347

Query: 291 DIFDEEPYKSTGMVLWPD 308
             F  + Y+ TG++LW D
Sbjct: 348 HFFKMKGYQDTGLLLWRD 365

>KLTH0G07986g Chr7 complement(646652..648361) [1710 bp, 569 aa] {ON}
           weakly similar to uniprot|P39106 Saccharomyces
           cerevisiae YER001W MNN1 Alpha-1 3-mannosyltransferase
           integral membrane glycoprotein of the Golgi complex
           required for addition of alpha1 3-mannose linkages to N-
           linked and O-linked oligosaccharides one of five S.
           cerevisiae proteins of the MNN1 family
          Length = 569

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 52/240 (21%), Positives = 93/240 (38%), Gaps = 23/240 (9%)

Query: 186 GIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPP--KDEGETDFCDVLLPKYNAKCIY 243
           GIV       + L   ++K L +    LP++++      D   +     L P      + 
Sbjct: 185 GIVLSFPDAHASLVVRLLKVLEHQGNRLPIQIIHKGDLSDYSRSLISRSLPPNQRLWFVN 244

Query: 244 ISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGM 303
           +  +L    +D+F    Y+ K L++I ++F   + +DAD   ++P++D    E Y  +G 
Sbjct: 245 VKPMLDPHFIDDFSL--YRNKWLAMIFNTFSTPIFIDADAVSVQPVEDYLQSEAYVESGT 302

Query: 304 VLWPDFWRRTTNPAYYDIADIPISYNKRV-------RNCIDNITPPELYTEDMEDLSNVP 356
           + + D          Y +  +      R+       R  ID     +L   D   L    
Sbjct: 303 IFFRDRAFAHKFDYEYCVPLLKALQPSRLETLYFGQRRLIDE----QLMMSDSTSLEQRI 358

Query: 357 LHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETF 416
           +            +SG L + KS HL  ++  ++ N+       P  S+     GDKETF
Sbjct: 359 VQSFFVGGQRHQMDSGLLAVDKSKHLMPLMAGVFLNLA------PKLSK--CTHGDKETF 410

>Suva_9.191 Chr9 (314586..316463) [1878 bp, 625 aa] {ON} YIL014W
           (REAL)
          Length = 625

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 63/279 (22%), Positives = 109/279 (39%), Gaps = 53/279 (18%)

Query: 183 KGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVL-LPKYNAKC 241
           K  G V   G K   L    +K +  +   LP +++    +        +  + K   + 
Sbjct: 232 KERGFVLTMGEKDVPLFLKQLKVMELLENVLPFQIITTGNELSPESIAKISKVAKEGGQK 291

Query: 242 IYISDVLPQSLVDNFEFKG-----YQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEE 296
           +Y+ D    S V + EF       +Q K ++ + ++FE  +LLDAD  P    D  FD  
Sbjct: 292 VYLMDC---STVLDAEFSKTFISFFQNKWVATLFNTFEEFILLDADVVPFVKSDYFFDSP 348

Query: 297 PYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVP 356
            YK +G++L+ D  R   N   ++              C++ ++  E   ++   +S+  
Sbjct: 349 SYKRSGILLFKD--RVMQNEHTFEY-------------CVEMLSGVEPSGQEHRLISSKL 393

Query: 357 LHDLDGTIPDVSTE-----------------SGQLMISKSSHLPTVLLSLYYNVNGPSWY 399
           L D   + P  S E                 SG ++++K   +  +L+S   N++G    
Sbjct: 394 LFDSSLSFPSSSEEAAVYYNFFEKLQLHHVDSGLVVVNKREKINGLLMSFMLNLDG---- 449

Query: 400 YPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDG 438
                 +    GDKE F  G  + G    Q  S   VDG
Sbjct: 450 ----KMQRCVYGDKEIFWLGQLYAG----QDYSINPVDG 480

>Smik_14.393 Chr14 (693641..695383) [1743 bp, 580 aa] {ON} YNR059W
           (REAL)
          Length = 580

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 81/177 (45%), Gaps = 22/177 (12%)

Query: 148 GQCLMLSTREKAMLKENHAKF------VENLSSLVLPKDSYKGNGIVTVGGGKFSLLAFL 201
           GQ L  ST   +    +  +F       EN  +  L ++S    G+V             
Sbjct: 158 GQVLHFSTENNSFTGTSPVEFKANKPFWENWLNSALQRNS---RGLVMSVSDYLVSDTIR 214

Query: 202 IIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPK--------YNAKCIYISDVLPQSLV 253
           +I+TLR ++ +LP+E++   K + +  +  +L+          Y  + ++  DV    L 
Sbjct: 215 LIRTLRLLNNSLPIEIV--HKSDLDERYQQLLIISARESASLDYPPQELWFLDV-QSMLS 271

Query: 254 DNF--EFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPD 308
           D++  +FK +  K L+I  SSF+  + LD+D  P  P+D ++  + +  TG + + D
Sbjct: 272 DDYLGKFKRFSNKWLAITFSSFQVPIFLDSDTVPFAPVDTLYQTDEFIRTGTLFFRD 328

>CAGL0G04279g Chr7 complement(404144..406126) [1983 bp, 660 aa] {ON}
           weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3
          Length = 660

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 75/143 (52%), Gaps = 7/143 (4%)

Query: 171 NLSSLVLPKDSYKGNGIV-TVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDF 229
           NL+ L   ++  KG G+V T+      +L  L  K L+    TLP++ L+  ++     F
Sbjct: 242 NLNFLRNWRNEAKGKGLVITIESNNLHILRKLF-KFLKENGNTLPIQ-LVFKRNVTLARF 299

Query: 230 CDVLLPKYNAKCIYISDVLPQSLVDNF----EFKGYQFKSLSIIASSFENLLLLDADNFP 285
            D ++        +++ +  ++L+D+      F GY  K L+ I ++FE+++++D +  P
Sbjct: 300 KDAIISYAEESDQHVTIIEIEALIDDSFNKGTFVGYDDKFLASIFNTFEDVVMMDIEVIP 359

Query: 286 IKPLDDIFDEEPYKSTGMVLWPD 308
               +++ + E YK++G+ +W D
Sbjct: 360 YVNPEELLENEEYKNSGLYMWRD 382

>KLLA0E09813g Chr5 (867899..870139) [2241 bp, 746 aa] {ON} similar
           to uniprot|P39106 Saccharomyces cerevisiae YER001W MNN1
           Alpha-1 3-mannosyltransferase integral membrane
           glycoprotein of the Golgi complex required for addition
           of alpha1 3-mannose linkages to N-linked and O- linked
           oligosaccharides one of five S. cerevisiae proteins of
           the MNN1 family
          Length = 746

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 105/264 (39%), Gaps = 56/264 (21%)

Query: 186 GIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVL-----------IPPKDEGETDFCDVLL 234
           GI+   G         +I TLR     LP++++           +  +    T+F     
Sbjct: 336 GIILAAGDGQVDQCIRLIATLRAQGNALPIQIIHNNQLNEKSVKLLSEAAKSTEFSSG-- 393

Query: 235 PKYNAKCIYISDVLP---QSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDD 291
               A+ +++ +V P    S+  NF    ++ K LS+I ++FE  + +D D      + D
Sbjct: 394 ---RAQSLWLVNVGPTLESSMKSNF--GRFKNKWLSVIFNTFEEFIFIDTDAISYINMAD 448

Query: 292 IFDEEPYKSTGMVLWPD-----FWRRTTNPAY----------YDIADIPISYNKRV-RNC 335
            F+ + YKSTG + + D        +   P +          Y    +P+     V + C
Sbjct: 449 YFNFKEYKSTGTLFFKDRSLAIGTEQKCGPLFETLEPRILEMYYFNTLPMINGDYVEQQC 508

Query: 336 IDNITPPELYTEDMEDLSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNG 395
           +  +TP E   +   ++ +   H+L         ESG L I+K+ H+  ++ +   N+  
Sbjct: 509 MGMLTPEEKVYKRFFEVGH--QHNL---------ESGLLAINKNEHIMGLVTATVLNI-A 556

Query: 396 PSWYYPIFSQKAAGEGDKETFIAG 419
           P            G GDKE F  G
Sbjct: 557 P-------KVGGCGWGDKEFFWLG 573

>YGL257C Chr7 complement(12481..14157) [1677 bp, 558 aa] {ON}
           MNT2Mannosyltransferase involved in adding the 4th and
           5th mannose residues of O-linked glycans
          Length = 558

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 76/174 (43%), Gaps = 33/174 (18%)

Query: 257 EFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNP 316
           +F  Y  K L++  SSFE  +L+D+D  P   ++  ++ E ++ TG++ + D   R  + 
Sbjct: 254 KFTTYSNKWLALTFSSFEIPILMDSDTVPFVSIEKFYELEEFQKTGVLFFKD---RVISD 310

Query: 317 AYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHDLDGTIPDV--------- 367
             ++ +++ I   + V  CI           D+ED S +     D  +  V         
Sbjct: 311 DLFESSELKI-LREIVYGCIG---------LDLEDESKIHEQVEDPVVAQVLENMFIKKY 360

Query: 368 --STESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAG 419
               ESG +++ K  HL ++L S+    +  + Y+          GDK+ F  G
Sbjct: 361 KHHLESGLVILHKGKHLFSMLTSIALQFSPIAEYF---------HGDKDFFWLG 405

>SAKL0D15180g Chr4 complement(1259592..1261325) [1734 bp, 577 aa]
           {ON} similar to uniprot|P53059 Saccharomyces cerevisiae
           YGL257C MNT2 Mannosyltransferase involved in adding the
           4th and 5th mannose residues of O-linked glycans
          Length = 577

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 87/238 (36%), Gaps = 54/238 (22%)

Query: 95  LQDFYSQVFKYLHLYSPKGKSTRVYDPRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLS 154
           L+D  +++F YL+           +  R + +GD+          +K ++          
Sbjct: 108 LRDIETRLFPYLNFDGLSSDEENFWPVRTRWNGDV----------YKASTPRFSSNDDTY 157

Query: 155 TREKAMLKENHAKFVENLSSLVLPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLP 214
                +    +  F EN    V+   S    GIV   G   +     +I+ LR +   LP
Sbjct: 158 LDSLGIAYNKNISFWENWLQKVMQSGS---RGIVLSIGQFQTADTIRLIRILRFLKNNLP 214

Query: 215 VEV-------------LIPPKDEGETD--------FCDV---LLPKYNAKCIYISDVLPQ 250
           +EV             LI    E  +D        F DV   L P+Y+AK          
Sbjct: 215 IEVVHKGDLSPHHQSVLIGAAREDLSDEYPGQELWFLDVTNMLNPQYSAK---------- 264

Query: 251 SLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPD 308
                  F  Y  K L+++  SFE  +LLDAD  P    +  +  E +K++G   + D
Sbjct: 265 -------FTRYSNKWLALLFCSFEQPILLDADTVPFTTFERYYQSEQFKNSGTFFFKD 315

>Kpol_1015.13 s1015 complement(31451..33682) [2232 bp, 743 aa] {ON}
           complement(31451..33682) [2232 nt, 744 aa]
          Length = 743

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 58/286 (20%), Positives = 110/286 (38%), Gaps = 58/286 (20%)

Query: 198 LAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKCIY-------------- 243
           +A  +I TLR     LP++++    +  +     +L   ++++  +              
Sbjct: 328 MALKLIATLRFQGNKLPIQIIYKDNELSKDTMSKILQVAHSSELKFPGTPIDESIKPVKQ 387

Query: 244 ------ISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEP 297
                 +++ +  SL++   +  ++ K L+ I + FE  + +D D     P++  F+ + 
Sbjct: 388 DVWFLDVTNTVDPSLIE--RYTDFKNKWLACIFNLFEEFIFMDIDAVNYVPMEYFFEMDE 445

Query: 298 YKSTGMVLWPDFWRR------------TTNPAYYD---IADIP-ISYNKRVRNCIDNITP 341
           YK TG V + D   R            T  P Y +     + P I+ +     C   +TP
Sbjct: 446 YKRTGTVFFRDRMLRASVKRECVPIFETLTPNYMESKYFGNFPFINKDYVEEQCDKYLTP 505

Query: 342 PELYTEDMEDLSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYP 401
            EL  +      N  LH +         ESG   I+K+ H+  ++ S+  ++        
Sbjct: 506 EELIYKRY--FINHKLHQM---------ESGLFAINKTKHVIPLIFSMMLHMTP------ 548

Query: 402 IFSQKAAGEGDKETFIAGANFYGLPF-YQVKSATAVDGYHQPDGKG 446
               +    GDKE +  G    G  F +   +A +V  Y     KG
Sbjct: 549 --QVRDCNYGDKEFYWIGFVVSGHSFAFNEMNAGSVGKYEVLSKKG 592

>ABR245C Chr2 complement(854587..856512) [1926 bp, 641 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YIL014W
           (MNT3)
          Length = 641

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 58/130 (44%), Gaps = 7/130 (5%)

Query: 184 GNGI-VTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLP----KYN 238
           G GI ++VG G   +L   ++  L  +   LP+E+ +    E    F D L      K  
Sbjct: 244 GKGITMSVGDGHLEML-LRMLTVLDYLGNELPIEI-VEKGGELSQQFRDKLTEFVRNKSK 301

Query: 239 AKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPY 298
            K   IS              G+  K ++++ ++FE  + LD D  P    +  FD E Y
Sbjct: 302 QKVRIISCARTLDETHARLIFGFSCKWVALMFNTFEEAIFLDVDAVPYILPEQFFDMEGY 361

Query: 299 KSTGMVLWPD 308
           KSTG++L+ D
Sbjct: 362 KSTGIMLFRD 371

>KLTH0G19690g Chr7 complement(1704559..1706325) [1767 bp, 588 aa]
           {ON} weakly similar to uniprot|P53059 Saccharomyces
           cerevisiae YGL257C MNT2 Mannosyltransferase involved in
           adding the 4th and 5th mannose residues of O-linked
           glycans
          Length = 588

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 73/299 (24%), Positives = 119/299 (39%), Gaps = 66/299 (22%)

Query: 179 KDSYKGNGIV-TVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKY 237
           KDS K  GIV + G G  S +  +++  LR +   LP++++     +G+     +    Y
Sbjct: 186 KDSMKDRGIVISFGEGGVSEVK-MLLNVLRLLGNKLPIQLV----HKGDVSAEAMQSISY 240

Query: 238 NAKCIYISDV--------LPQSL--------VDNFE---FKGYQFKSLSIIASSFENLLL 278
            A+     D         LPQ +        + N     FK +  K ++ + +SF+ ++L
Sbjct: 241 VARNDVTKDAETNTHGFDLPQEIWFVNAKRGIKNGHHDLFKRFSNKWIASLFNSFDEMIL 300

Query: 279 LDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDN 338
           +D+D  P    +  FD   Y+ TG   + D   R  +  Y   +D+   Y K        
Sbjct: 301 MDSDAVPFMNPERFFDLVGYQETGAFFFKD---RLIDE-YLKTSDLKF-YKKL------- 348

Query: 339 ITPPELYTEDMEDLSNVPLHDLDGTIPDV-------STESGQLMISKSSHLPTVLLS--- 388
                L TE+   +  +P      T  D          ESG ++I +S HLP +L+S   
Sbjct: 349 -----LPTEEESKVFGIPSSTEKTTQNDFFKAGYKHLMESGVVVIKRSDHLPGLLISTAL 403

Query: 389 -LYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQV-KSATAVDGYHQPDGK 445
            L+   + P +            GDKE F  G +  G   Y+  K+A    G    D K
Sbjct: 404 QLWKETSEPVY------------GDKELFWLGQSISGNENYRFNKNAAGALGILNRDEK 450

>TBLA0C06250 Chr3 (1512916..1515126) [2211 bp, 736 aa] {ON} 
          Length = 736

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 64/299 (21%), Positives = 110/299 (36%), Gaps = 67/299 (22%)

Query: 186 GIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNA------ 239
           GI+       +  A  +I TLR M   LP++++    D  +     V     N       
Sbjct: 306 GIILSFSDGQTETALRLISTLRFMGNRLPIQIIFK-NDISDKSIEQVFYVATNKNYKPFN 364

Query: 240 ------------KCIYISDVLPQSLVD---NFEFKGYQFKSLSIIASSFENLLLLDADNF 284
                       + +Y  D+  ++L+D     +F  ++ K L+   + FE  L +D D  
Sbjct: 365 DQVNWEHKNDVKQNVYFVDI--ENLLDPKYKDKFSRFKNKWLASNFNMFEEFLFIDTDAI 422

Query: 285 PIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPEL 344
                +D F+ + YK +G V + D   RT    + D A           + + ++ PP +
Sbjct: 423 TYIDPNDYFELQEYKESGTVFFRD---RTWPKQWGDEAKC---------SSLMSLLPPRI 470

Query: 345 YTEDMEDLSNVPLHDLDGTIPDVST---------------------ESGQLMISKSSHLP 383
                   +N PL D+D      ST                     ESG   I+K+ H+ 
Sbjct: 471 LESKY--FNNYPLFDVDYIKETPSTRLSIEEKIYKRYFENGRIHQMESGVFAINKNKHII 528

Query: 384 TVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATAVDGYHQP 442
           ++L     N++  +        ++ G GDKE F  G    G  +    +   V G + P
Sbjct: 529 SILTGTILNIDHVT--------ESCGYGDKEFFWFGFMISGHKYRFYNTTVGVIGNYDP 579

>KAFR0K01260 Chr11 complement(261190..263076) [1887 bp, 628 aa] {ON}
           
          Length = 628

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 57/130 (43%), Gaps = 5/130 (3%)

Query: 183 KGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETD----FCDVLLPKYN 238
           KG GIVT    K     +  +K L+ +   LP+ ++    D  +      F  V      
Sbjct: 238 KGKGIVTTLHSKELDFFYRQLKVLQKLDNKLPIYIVSSDGDITDNHKNELFTQVKETTQQ 297

Query: 239 AKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPY 298
              +  S +L  S       K +  K ++I+ +  E ++ +DAD  P+  ++D F  E Y
Sbjct: 298 VYVVGCSQILNPSFSQK-HLKSFLNKWVAILFNPLEEVIFMDADAVPLISVEDYFKYEDY 356

Query: 299 KSTGMVLWPD 308
           K +G+ ++ D
Sbjct: 357 KESGLYVFKD 366

>AFL235W Chr6 (2..1147) [1146 bp, 381 aa] {ON} Non-syntenic homolog
           of Saccharomyces cerevisiae YIL014W (MNT3) and YER001W
           (MNN1)
          Length = 381

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 79/192 (41%), Gaps = 48/192 (25%)

Query: 261 YQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYD 320
           +++K L+ + +S E ++ +D D  P   +D  F+ E YKSTG++++ D   R  N     
Sbjct: 62  FRYKWLAYLLNSSEEVVFIDLDVVPFVSIDKFFEMEGYKSTGILMFQD---RVFNSI--- 115

Query: 321 IADIPISYNKRVRNCIDNITPPEL----------YTED--MEDLSNVPLHDLDGTIPDV- 367
                   N + R  I +I P             YT++     L N P      ++ D  
Sbjct: 116 -------KNSKCRTAIHHILPSHAEQTLWKHQAKYTKEKAKHRLKNFPDDAGAASVYDRY 168

Query: 368 -------STESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKE-----T 415
                    ESG +++ K   + ++++SL  ++N     Y          GDKE      
Sbjct: 169 LEGDRMHMVESGLVVVDKRKKISSLIISLMLHMNIAECSY----------GDKEYLWLGQ 218

Query: 416 FIAGANFYGLPF 427
            ++G ++Y  P 
Sbjct: 219 LVSGEDYYIHPL 230

>TBLA0H00130 Chr8 complement(8943..11006) [2064 bp, 687 aa] {ON} 
          Length = 687

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 60/144 (41%), Gaps = 24/144 (16%)

Query: 186 GIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKC---- 241
           GI+     K    A  ++ +LR    TLP++++    D  + +   ++    N       
Sbjct: 258 GIIMSFTDKEVDWAIRLLVSLRYQGNTLPIQIIYTDGDLTDENIQRLIFAAQNGNVRVPY 317

Query: 242 -----------------IYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNF 284
                            + ++ +L  + V++F+FKG   K L+   + FE  + LDAD  
Sbjct: 318 KNGAPRPGQLTVQEIMFLDVTKMLDSNFVEDFKFKG---KWLASFFNLFEEHIFLDADTV 374

Query: 285 PIKPLDDIFDEEPYKSTGMVLWPD 308
           P   L+  F+ + Y  TG + + D
Sbjct: 375 PYVDLNYFFNTQEYNQTGTLFFRD 398

>NCAS0I00480 Chr9 (77950..79923) [1974 bp, 657 aa] {ON} 
          Length = 657

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 55/248 (22%), Positives = 95/248 (38%), Gaps = 24/248 (9%)

Query: 183 KGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKD-EGET-DFCDVLLPKYNAK 240
           KG GIV         L   +I TL+ +  TLP++++   +D E ET +  +  L   + +
Sbjct: 248 KGKGIVINMKETEKDLFMSLIATLQEVKNTLPIQIITTGQDFEKETFESMNRFLQTTDQQ 307

Query: 241 CIYI--SDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPY 298
              I  S +L    V       +  K    + ++FE +++LDAD+ P    +  F  + Y
Sbjct: 308 VSLIDCSSILDADFVKE-HIASHLHKWFGTLFNTFEEVVILDADSVPFVAPETFFKNKEY 366

Query: 299 KSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNI-------TPPELYTEDMED 351
           K  G   + D          Y I  I      +  + + N         PPE  +     
Sbjct: 367 KDAGSFFFRDKTLGNERTYQYCIEMIEAMEPSKAESGLINTKLKFTSNNPPEDNSSPAAS 426

Query: 352 LSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEG 411
           + N       G     + +SG +++ K   L ++L+    N++           K    G
Sbjct: 427 VYNTFF----GKYKHKNLDSGVVVLKKKEKLTSLLMGFMMNLDA--------KMKQCVSG 474

Query: 412 DKETFIAG 419
           +KE F  G
Sbjct: 475 EKELFWLG 482

>Kwal_23.5454 s23 (1171360..1173111) [1752 bp, 583 aa] {ON} YGL257C
           (MNT2) - Mannosyltransferase [contig 9] FULL
          Length = 583

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 65/282 (23%), Positives = 122/282 (43%), Gaps = 53/282 (18%)

Query: 179 KDSYKGNGIV-TVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKY 237
           K+ Y G GIV ++G G    +  L+ + LR +  TLP++++   K +      ++++   
Sbjct: 183 KERYSGKGIVISIGEGGVDEVIRLL-RVLRALKNTLPIQLV--HKGDVSASSMNMIIQAG 239

Query: 238 NAKC-----IYISDVL--PQSLV----------DNFE-FKGYQFKSLSIIASSFENLLLL 279
             K      IY SD+   PQ +            N + F+ +  K ++ + +SFE ++L+
Sbjct: 240 RGKIEDKQGIY-SDISEHPQEIWFVNAARSIKKGNLDLFQRFSNKWIASLFNSFEEMILM 298

Query: 280 DADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNI 339
           D+D  P     ++FD   Y+ TG   + D       P    +    +S+ ++       +
Sbjct: 299 DSDVVPFLNPKELFDATEYRETGAYFFKD------RPIDEFLRSSDLSFYRK-------L 345

Query: 340 TPPEL-YTE-DMEDLSNVPLHDLDGTIPDVS----TESGQLMISKSSHLPTVLLSLYYNV 393
            P E  YT  +M+ L++   H               ESG +++++ +H+P +L+S    +
Sbjct: 346 LPSEWEYTAFEMQPLTD---HTYGNGFLKHGYKHFMESGVVVLNRRNHMPGLLISATMQL 402

Query: 394 NGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPFYQVKSATA 435
              +   PI+       GDKE F  G +  G   Y+     A
Sbjct: 403 WKET-SQPIY-------GDKELFWLGQSIAGNENYRFNKNEA 436

>SAKL0H19316g Chr8 complement(1705548..1707941) [2394 bp, 797 aa]
           {ON} similar to uniprot|P39106 Saccharomyces cerevisiae
           YER001W MNN1 Alpha-1 3-mannosyltransferase integral
           membrane glycoprotein of the Golgi complex required for
           addition of alpha1 3-mannose linkages to N-linked and O-
           linked oligosaccharides one of five S. cerevisiae
           proteins of the MNN1 family
          Length = 797

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 60/302 (19%), Positives = 110/302 (36%), Gaps = 70/302 (23%)

Query: 176 VLPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVL----------------- 218
            + + + K   ++++G G+       ++ TLR     LP++V+                 
Sbjct: 368 AISRKTAKRGIVISLGNGQVDY-GIKLLATLRFQGNKLPIQVIHKGDLSEDSVRKLTDVA 426

Query: 219 ------IPPKDEGETDFCDVLLPKYNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASS 272
                 IPP       F +    K     + +S  L  S+++  EF  ++ K L+++ + 
Sbjct: 427 QAAEFDIPP-----NSFDNTTDVKQELWFVDVSTTLNPSVIN--EFDRFKNKWLAVVFNL 479

Query: 273 FENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPD-----------------FWRRTTN 315
           F+  + +D D      ++D F+   YK +G V + D                    +   
Sbjct: 480 FDEFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKDRSLGYGSDAKCFAVFSTLMPKALE 539

Query: 316 PAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHDLDGTIPDVSTESGQLM 375
             Y+    + I  +     C   +TP E   ++     N   H +         ESG + 
Sbjct: 540 SKYFQSFSM-IDDDYVFDQCHKYLTPEEKIFKNF--FENNHQHQM---------ESGLVA 587

Query: 376 ISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYG--LPFYQVKSA 433
           I KS H+  +++S   N++              G GDKE F  G    G    FY V++A
Sbjct: 588 IDKSQHIMPLVISTILNMSKKI--------GGCGHGDKEFFWLGFMVSGHRYSFYDVEAA 639

Query: 434 TA 435
             
Sbjct: 640 AV 641

>TBLA0A00640 Chr1 (128803..131046) [2244 bp, 747 aa] {ON} 
          Length = 747

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 64/143 (44%), Gaps = 25/143 (17%)

Query: 188 VTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLP------------ 235
           + +G G+  L A  +I TLR    TLP+++++   +  +     ++              
Sbjct: 324 MCIGDGQLKL-ALKLITTLRYSGNTLPIQIIMKKGELSKGSIEKLIFAAQGNNFKFRIDK 382

Query: 236 -KYNAKCIY---------ISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFP 285
            +Y     Y         I+D+L    +++F++  ++ K L+ I + FE  + LDAD  P
Sbjct: 383 DEYKPASSYMPQEILFTDITDLLDPEFLNDFQW--FKNKWLASIFNVFEENIFLDADVVP 440

Query: 286 IKPLDDIFDEEPYKSTGMVLWPD 308
              L+  F+ + Y  TG + + D
Sbjct: 441 YVDLNFFFNTKEYNETGTIFFKD 463

>Skud_9.158 Chr9 (296090..297979) [1890 bp, 629 aa] {ON} YIL014W
           (REAL)
          Length = 629

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 79/356 (22%), Positives = 132/356 (37%), Gaps = 60/356 (16%)

Query: 183 KGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVL-LPKYNAKC 241
           KG G V     K   L    +K +      LP +++    +        +  +     + 
Sbjct: 232 KGRGFVLTIAEKDVPLFIRQLKVMEFSKNELPFQIITTGNELSPESIAKISKVAAEGKQK 291

Query: 242 IYISD---VLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPY 298
           +Y+ D   VL       + F  +Q K ++ + ++FE  +LLDAD  P    D  FD   Y
Sbjct: 292 VYLVDCSTVLESEFSSTYIF-SFQNKWVASLFNTFEEYILLDADVVPFVKSDYFFDSPSY 350

Query: 299 KSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRN-------CIDNITPPELYTEDMED 351
           K +G++L+ D   R      Y I  + +    R  +         D+ +     + +   
Sbjct: 351 KGSGILLFKDRVMRNELTFKYCIELLGLVEPSREEHRLIGSKLVFDSSSLLSSSSSEEAS 410

Query: 352 L-----SNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQK 406
           +      N+ LH +D         SG ++++K   L  +L+S   N++G          +
Sbjct: 411 VYYNFFKNLRLHHVD---------SGLVVVNKLEKLNGLLMSFMLNLDG--------KMQ 453

Query: 407 AAGEGDKETFIAGANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFV-----QDY 461
               GDKE F  G  + G    Q  S   VDG          G   +Q D V     ++Y
Sbjct: 454 RCVYGDKEIFWIGQLYAG----QDYSINPVDG-------SIIGPVNIQTDDVDGSLKENY 502

Query: 462 Q--RYQWAFKDIRTQY--------SGKTSNSIHLDKDYTPESFYRKYFEGDDIKEV 507
                Q A  D   Q         + K SNS   D    P+ F  +Y E   ++++
Sbjct: 503 HICSAQIAHSDFENQLLWINGGLKTCKISNSAQDDFQREPDYFKSRYNEESSLQKI 558

>Kwal_55.22238 s55 complement(1166321..1168075) [1755 bp, 584 aa]
           {ON} YNR059W (MNT4) - Product of gene unknown [contig
           697] FULL
          Length = 584

 Score = 38.5 bits (88), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 114/275 (41%), Gaps = 60/275 (21%)

Query: 179 KDSYKGNGIV-TVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKY 237
           K+S  G GIV ++G G  S +  L+ + LR +   LP++ L+   D       +++    
Sbjct: 183 KESMNGRGIVISLGEGGVSDVKRLL-RVLRTVGNRLPIQ-LVHKGDLSRAAMQEIINIGR 240

Query: 238 NAKCIYISDVL-----PQSL--VDNFE---------FKGYQFKSLSIIASSFENLLLLDA 281
               + I DV      PQ +  VD  +         FK +  K ++ + +SFE ++L+D 
Sbjct: 241 GDVIVEIGDVSQSIGNPQDIWFVDAGKSVNSSSAHLFKRFSNKWIASLFNSFEEIILMDC 300

Query: 282 DNFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITP 341
           D  P    + +F+   YK +G + + D   R  +  Y    D+ + Y K        + P
Sbjct: 301 DAVPFVDPELLFNTTEYKESGALFFVD---RLIDE-YIKTNDLKL-YQK--------LFP 347

Query: 342 PELYTEDMEDLSNVPLHDLDGTIP---------DVSTESGQLMISKSSHLPTVLLSL--- 389
                E+ + L  +  H L G +            + ESG +++ +  HLP +L+S    
Sbjct: 348 ----LENEKSLFGLQ-HTLGGAVDLRGFYEFGYKHTMESGMVVMKREDHLPGLLISTCLQ 402

Query: 390 YYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYG 424
           ++      +Y           GDKE F  G +  G
Sbjct: 403 FWKETSEPFY-----------GDKELFWLGQSISG 426

>KLLA0D13376g Chr4 (1150858..1152849) [1992 bp, 663 aa] {ON} similar
           to uniprot|P40549 Saccharomyces cerevisiae YIL014W MNT3
           Alpha-1 3-mannosyltransferase adds the fourth and fifth
           alpha-1 3-linked mannose residues to O-linked glycans
           during protein O-glycosylation
          Length = 663

 Score = 38.1 bits (87), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 75/180 (41%), Gaps = 38/180 (21%)

Query: 264 KSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPD----------FWRRT 313
           K ++++ ++F   +LLDAD+     L+  FD + Y+ TGM+L+ D          +   T
Sbjct: 351 KWMALLFNTFSECILLDADSVSFASLESYFDFKGYQDTGMLLFRDRNIIGEKTFIYCTDT 410

Query: 314 TNPAYYDIADIPISYNKR------VRNCIDNITPPELYTEDM---EDLSNVPLHDLDGTI 364
               +  + +     ++       V N  DNI    L  E+    +   N+ LH +D   
Sbjct: 411 LKKLFPSVEETHFMSHRSTFPLELVEN--DNINIDTLSMEEQIYYKFFHNLQLHHID--- 465

Query: 365 PDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYG 424
                 SG +++ +   L ++L+S   N++G          +    GDKE F  G    G
Sbjct: 466 ------SGLVVVDRVKKLSSLLISTMMNIDG--------KLQRCVYGDKEIFWLGQLLAG 511

>Suva_5.87 Chr5 (129322..131622) [2301 bp, 766 aa] {ON} YER001W
           (REAL)
          Length = 766

 Score = 37.7 bits (86), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 70/312 (22%), Positives = 123/312 (39%), Gaps = 73/312 (23%)

Query: 187 IVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKCIYISD 246
           ++++G  +FSL A   I +LR    TLP+++ I   DE   +  + L+  Y A+      
Sbjct: 326 VLSLGSNQFSL-AVKFIASLRFQGNTLPIQI-IYRGDELPQEMVEKLM--YAARSPEFKP 381

Query: 247 V---------LPQSL----VDNF-------EFKGYQFKSLSIIASSFENLLLLDADNFPI 286
           +         +PQ L    V N        +F  Y+ K L ++ + F+  + LD D    
Sbjct: 382 IENSYDNSTNVPQELWFLDVSNTVHPDWKGDFGSYKSKWLVVLFNLFQEFVFLDIDAISY 441

Query: 287 KPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCI---DNITPPE 343
           + +D  F+   Y+ TG V + +   R+ N   ++              CI   + + P +
Sbjct: 442 QEIDKYFESPEYQKTGTVFYRE---RSLNENVHE-------------RCIARYETLLPRK 485

Query: 344 LYTEDMED-LSNVPLHDLDGTIPDVST-----------------ESGQLMISKSSH-LPT 384
           L +E+ ++ L   P + L+     ++T                 E+G   +  + H +P 
Sbjct: 486 LESENFQNSLMFNPENVLNECDKLLTTEEYIFKAFFRHRRQHQLEAGLFAVDTAQHTIPL 545

Query: 385 VLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPF--YQVKSATAVDGYHQP 442
           VL S+ +     S             GDKE F  G    G P+   +V S    D   + 
Sbjct: 546 VLASMIHLAKHTS---------HCTHGDKENFWLGFLASGHPYALQKVYSGAIGDYVKKT 596

Query: 443 DGKGFRGVAMLQ 454
           D  G R  A ++
Sbjct: 597 DLNGKRQEAAVE 608

>Smik_5.115 Chr5 (157563..159851) [2289 bp, 762 aa] {ON} YER001W
           (REAL)
          Length = 762

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 66/309 (21%), Positives = 118/309 (38%), Gaps = 67/309 (21%)

Query: 187 IVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKCIYISD 246
           I+++G  +F+L A  +I  LR     LP+++ +   +E   +  D L+  Y A+      
Sbjct: 323 ILSLGPNQFAL-AVKLIAALRFQGNKLPIQI-VYRGNELSQELVDKLI--YAARSPDFKP 378

Query: 247 V---------LPQSL----VDNF-------EFKGYQFKSLSIIASSFENLLLLDADNFPI 286
           V         +PQ++    V N        +F  Y+ K L ++ + F+  + LD D    
Sbjct: 379 VKNNYDNSTNVPQNIWFLDVSNTIHPKWRDDFGSYKSKWLVVLFNLFQEFVFLDIDAISY 438

Query: 287 KPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYT 346
           + +D  FD   Y+ TG V             +Y    +  + + R     + + P +L +
Sbjct: 439 QEIDKYFDTPEYQKTGTV-------------FYRERALTETLDGRCVARYETLLPRKLES 485

Query: 347 EDMEDLSNVPLHDLDGTIPDVST------------------ESGQLMISKSSH-LPTVLL 387
           ++ ++L  +    +     ++ T                  E+G   I KS H LP VL 
Sbjct: 486 KNFQNLLTIDPDTVLNKCDELLTTEEYIFKSMFRHKGQHQLEAGLFAIDKSKHVLPLVLA 545

Query: 388 SLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLPF--YQVKSATAVDGYHQPDGK 445
           S+ +                   GDKE F  G    G P+   +V S    D   + +  
Sbjct: 546 SMIHLARDTG---------GCTHGDKENFWLGFLASGHPYALQEVYSGAIGDYVKKTELD 596

Query: 446 GFRGVAMLQ 454
           G R  A ++
Sbjct: 597 GKRQEAAIE 605

>YER001W Chr5 (153520..155808) [2289 bp, 762 aa] {ON}
           MNN1Alpha-1,3-mannosyltransferase, integral membrane
           glycoprotein of the Golgi complex, required for addition
           of alpha1,3-mannose linkages to N-linked and O-linked
           oligosaccharides, one of five S. cerevisiae proteins of
           the MNN1 family
          Length = 762

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 72/315 (22%), Positives = 121/315 (38%), Gaps = 72/315 (22%)

Query: 184 GNGIV-TVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKCI 242
           G GIV ++G  +F L A   I +LR    TLP++V +   DE   +  D L+  Y A+  
Sbjct: 317 GRGIVLSLGSNQFPL-AVKFIASLRFEGNTLPIQV-VYRGDELSQELVDKLI--YAARSP 372

Query: 243 YISDV---------LPQSL----VDNF-------EFKGYQFKSLSIIASSFENLLLLDAD 282
               V         +PQ +    V N        +F  Y+ K L ++ +  +  + LD D
Sbjct: 373 DFKPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLVVLLNLLQEFVFLDID 432

Query: 283 NFPIKPLDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPP 342
               + +D+ F    Y+ TG V             +Y    +  + N+R     + + P 
Sbjct: 433 AISYEKIDNYFKTTEYQKTGTV-------------FYRERALRENVNERCIARYETLLPR 479

Query: 343 ELYTEDMED-LSNVPLHDLDGTIPDVST-----------------ESGQLMISKSSH-LP 383
            L +++ ++ L   P H L+     ++T                 E+G   + KS H +P
Sbjct: 480 NLESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHTIP 539

Query: 384 TVLLSLYYNVNGPSWYYPIFSQKAAGEGDKET----FIAGANFYGLPFYQVKSATAVDGY 439
            VL ++ +     +             GDKE     F+A  + Y L    V S    D  
Sbjct: 540 LVLAAMIHLAKNTA---------HCTHGDKENFWLGFLAAGHTYALQ--GVYSGAIGDYV 588

Query: 440 HQPDGKGFRGVAMLQ 454
            + D  G R  A ++
Sbjct: 589 KKTDLNGKRQEAAVE 603

>Kpol_1057.22 s1057 complement(42104..44398) [2295 bp, 764 aa] {ON}
           complement(42104..44398) [2295 nt, 765 aa]
          Length = 764

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 79/196 (40%), Gaps = 28/196 (14%)

Query: 113 GKSTRVYDPRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENL 172
           G ST  YDP              + NW K++     + ++LS        + H  +   L
Sbjct: 301 GSSTFEYDPTISF----------WSNWNKMSGIVGKRGIILS------FADGHLDYATKL 344

Query: 173 SSLVLPKDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDV 232
            +       Y+GN +      K   L    IK L+ + T + ++      ++  T     
Sbjct: 345 ITTF----KYQGNKLPIQIIYKTGDLNSQTIKILQRVATDMDIDYAKIDTEDERTPVPQQ 400

Query: 233 LLPKYNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDI 292
           L+       + I+D L + ++ N+  K Y+ K L++  + FE  + +D D      ++  
Sbjct: 401 LI------FVDITDTLNKDVIGNY--KKYKNKWLAVTFNLFEEFIFMDIDAISYVDMNYY 452

Query: 293 FDEEPYKSTGMVLWPD 308
           F+ E YK TG + + D
Sbjct: 453 FETEEYKKTGTIFFRD 468

>TPHA0F00700 Chr6 (158182..160752) [2571 bp, 856 aa] {ON} 
          Length = 856

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 85/187 (45%), Gaps = 34/187 (18%)

Query: 257 EFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKSTGMVLWPDFWRR---- 312
           EF  ++ K L+   +  + +L LD D    K  +  F+ + YK++G + + D + +    
Sbjct: 434 EFITFKNKWLASTLNPCKEILFLDTDTINYKDPNFYFETKGYKNSGTLFFRDRYLKVDKK 493

Query: 313 --------TTNPAYYD---IADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLH-DL 360
                   T +P++ +      +P+ ++K+    +DN+   EL TE  E +     H D+
Sbjct: 494 EICSSFHDTLSPSFQESFYFDKLPL-FDKQY--IVDNVAKNELTTE--EHIFKSYFHLDI 548

Query: 361 DGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAGA 420
              +     ESG + I K++H+  + +S  +N+  P      FS+     GDKE F  G 
Sbjct: 549 QHEM-----ESGLMAIDKATHIIPMQMSANFNLFKP------FSK--CSHGDKEFFWLGF 595

Query: 421 NFYGLPF 427
              G PF
Sbjct: 596 MASGTPF 602

>TPHA0F00130 Chr6 (14360..16636) [2277 bp, 758 aa] {ON} 
          Length = 758

 Score = 35.4 bits (80), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 49/234 (20%), Positives = 87/234 (37%), Gaps = 49/234 (20%)

Query: 234 LPKYNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIF 293
           LP      + +S+VL  + +  F+   ++ K L+ + + FE  + LD D      + + F
Sbjct: 403 LPAQQIWFVNVSNVLDPAFMKKFD--RFKNKWLAEMLNLFEEFIFLDTDAISYIHMSEYF 460

Query: 294 DEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLS 353
           +   YK TG + + D   RT              YNK+         PP++   +  +  
Sbjct: 461 EFPEYKDTGTLFFKD---RTLE-----------DYNKKSCTAAFRTLPPKML--ETINFG 504

Query: 354 NVPLHDLDGTIPDVS---------------------TESGQLMISKSSHLPTVLLSLYYN 392
           N P+ D      + +                      ESG ++I+KS H+  +++S   +
Sbjct: 505 NFPVIDDSYVAEECNKYLTVEEKIYKHYFFDNWLHQMESGLIVINKSRHIMPIVISTMLH 564

Query: 393 VNGPSWYYPIFSQKAAGEGDKETFIAGANFYGLP--FYQVKSATAVDGYHQPDG 444
           + G           +   GDKE    G    G P  F+ V +    D   + D 
Sbjct: 565 MTG--------QLNSCSYGDKEFLWLGFLISGTPYRFHDVNAGAMGDVLTEKDN 610

>TBLA0A01160 Chr1 complement(267341..269332) [1992 bp, 663 aa] {ON} 
          Length = 663

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 30/141 (21%), Positives = 64/141 (45%), Gaps = 4/141 (2%)

Query: 184 GNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNAKCIY 243
           G GIVT        L    +  L +++   P++++       E     +L  +   + +Y
Sbjct: 271 GKGIVTTFKESDLPLFRKQLAVLEHLNNKHPIQIISAKAPTQEFLDSLILTVQKTTQKVY 330

Query: 244 ISD---VLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYKS 300
           + D   +L +    N+    +  K ++++ ++F+  + LD D  P   +D  F+ E ++ 
Sbjct: 331 LLDCSTMLDEEFSKNY-IVNFLNKWVAMLFNTFKEAIFLDVDAIPFIGMDYFFENEGFEE 389

Query: 301 TGMVLWPDFWRRTTNPAYYDI 321
           TG++++ D   RT +   Y I
Sbjct: 390 TGILMYKDRVMRTEHTFQYCI 410

>Skud_5.100 Chr5 (150236..152524) [2289 bp, 762 aa] {ON} YER001W
           (REAL)
          Length = 762

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 66/310 (21%), Positives = 117/310 (37%), Gaps = 69/310 (22%)

Query: 187 IVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLL------------ 234
           ++++G  +F L A   I  LR    TLP+++ +   +E   +  D L+            
Sbjct: 323 VLSLGSNQFPL-AVKFIAALRFQGNTLPIQI-VYRGNELSQELVDKLIFAARSPDFKPVE 380

Query: 235 PKYNAKCIYISDVLPQSL----VDNF-------EFKGYQFKSLSIIASSFENLLLLDADN 283
            KY+      S  +PQ +    V N        +F  Y+ K L ++ + F+  + LD D 
Sbjct: 381 NKYDN-----STNVPQEIWFLDVSNTIHPKWQNDFDSYKSKWLVVLFNLFKEFVFLDIDA 435

Query: 284 FPIKPLDDIFDEEPYKSTGMVLWPDFWRRTT----NPAYYDI------------ADIPIS 327
              + +D  F+   Y+ TG V + +   +        A Y+             + + I 
Sbjct: 436 ISYQEIDKYFETAEYQKTGTVFYRERALKENVHERCIARYETLLPRKLESKNFKSSLLID 495

Query: 328 YNKRVRNCIDNITPPELYTEDMEDLSNVPLHDLDGTIPDVSTESGQLMISKSSH-LPTVL 386
            ++ +  C +++ P E   +      +   H L         E+G   I KS H +P +L
Sbjct: 496 ADRVLSGCDNDLKPEEHIFKAF--FHHRRQHQL---------EAGLFAIDKSEHTIPLIL 544

Query: 387 LSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAG--ANFYGLPFYQVKSATAVDGYHQPDG 444
            S+ +     S             GDKE F  G  A+ +     +V S    D   + D 
Sbjct: 545 ASMIHLAKHTS---------HCTHGDKENFWLGFLASGHHYALQEVYSGAIGDYVKKTDL 595

Query: 445 KGFRGVAMLQ 454
            G R  A ++
Sbjct: 596 NGKRQEAAIE 605

>Ecym_2438 Chr2 (854968..856134) [1167 bp, 388 aa] {ON} similar to
           Ashbya gossypii ABR010C
          Length = 388

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 26/45 (57%)

Query: 76  MTDVSRQPASKKELQRRQKLQDFYSQVFKYLHLYSPKGKSTRVYD 120
           + ++   P++KKE Q  ++L +F+ +  KY     P+  ST+V D
Sbjct: 68  LKELMNSPSTKKEQQLDERLLEFFRKYAKYSKFLEPQNNSTKVLD 112

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 71,444,244
Number of extensions: 3493741
Number of successful extensions: 9988
Number of sequences better than 10.0: 133
Number of HSP's gapped: 9938
Number of HSP's successfully gapped: 138
Length of query: 608
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 493
Effective length of database: 40,294,809
Effective search space: 19865340837
Effective search space used: 19865340837
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)