Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0C08778g3.159ON1003100342840.0
KLTH0C08866g3.159ON97286032760.0
Kwal_56.228043.159ON97386032300.0
KLLA0F24684g3.159ON97390732260.0
Kpol_1032.113.159ON97786532090.0
YDL031W (DBP10)3.159ON99586531950.0
AEL086W3.159ON960100531750.0
Smik_4.2043.159ON998101131660.0
NCAS0C035303.159ON977100831580.0
Suva_4.2183.159ON100792031500.0
KAFR0C010603.159ON97391431470.0
CAGL0K01551g3.159ON96986431470.0
NDAI0G028703.159ON99186631440.0
Skud_4.2203.159ON100192031370.0
KNAG0K011103.159ON100192531290.0
TPHA0M003303.159ON98189630590.0
ZYRO0B04972g3.159ON97986230190.0
TDEL0D046303.159ON96891830100.0
TBLA0B015903.159ON92955418310.0
CAGL0D03124g5.208ON7253915687e-61
ZYRO0B10318g5.208ON7503925643e-60
YLL008W (DRS1)5.208ON7523935601e-59
Smik_12.555.208ON7353955601e-59
TPHA0N007005.208ON7553925592e-59
KNAG0H025205.208ON7543935592e-59
KLLA0F15752g5.208ON7483935573e-59
NDAI0C024905.208ON7713925558e-59
AAL164C5.208ON7343915538e-59
KAFR0C064205.208ON7393925492e-58
SAKL0G12760g5.208ON7373925493e-58
Skud_12.595.208ON7583975503e-58
TBLA0C061605.208ON7573935423e-57
KLTH0B03278g5.208ON7393915404e-57
Kwal_33.151655.208ON7313925388e-57
NDAI0F020106.148ON8883885431e-56
TDEL0G014206.204ON5123835161e-55
NCAS0G025602.164ON5563925172e-55
Smik_7.2056.204ON5223805143e-55
CAGL0L03846g2.164ON5443925153e-55
Suva_7.1926.204ON5183865134e-55
YGL078C (DBP3)6.204ON5233835134e-55
TBLA0C055802.164ON5403925136e-55
CAGL0L02915g8.614ON6174005176e-55
Skud_7.2046.204ON5163865091e-54
YNL112W (DBP2)2.164ON5463925102e-54
ZYRO0B09856g2.164ON5403935049e-54
NDAI0F027402.164ON5613925041e-53
Smik_14.2152.164ON5473925022e-53
KAFR0B045602.164ON5433925012e-53
TDEL0F011902.164ON5493925013e-53
KLLA0F01034g8.614ON6274005053e-53
CAGL0H03377g6.204ON5403924994e-53
KLTH0D09328g2.164ON5513924979e-53
TDEL0B040606.148ON8473995119e-53
Suva_14.2262.164ON5433924961e-52
KLLA0F23716g2.164ON5543924952e-52
Suva_16.1918.614ON6184054931e-51
Ecym_54222.164ON5603924891e-51
Kwal_14.16536.148ON6883974933e-51
NCAS0C017208.614ON6404054903e-51
CAGL0J06908g8.614ON6044054884e-51
KAFR0G020308.614ON6064004884e-51
TDEL0A055908.614ON5973984866e-51
NDAI0E015908.614ON6083994841e-50
Ecym_22696.148ON8773934951e-50
SAKL0E10670g2.164ON5743924812e-50
NDAI0E024308.614ON6614034852e-50
ZYRO0G14960g6.148ON8313874886e-50
KLTH0H05852g6.148ON8113984877e-50
NDAI0B009005.69ON4364004679e-50
Kpol_534.316.148ON8724014889e-50
Smik_8.2535.69ON4373904633e-49
YHR169W (DBP8)5.69ON4313894623e-49
TBLA0D035206.148ON8893884824e-49
Smik_2.3806.148ON8503884807e-49
YBR237W (PRP5)6.148ON8493884807e-49
KLTH0H00638g5.69ON4333894598e-49
Suva_15.3695.69ON4373904572e-48
CAGL0K07029g6.148ON8163884752e-48
NCAS0E039205.69ON4373894563e-48
Kpol_1062.55.69ON4313894553e-48
Skud_8.2335.69ON4373894528e-48
TDEL0G009305.69ON4364004511e-47
KLLA0C15433g8.469ON5394024543e-47
KNAG0M006606.148ON8843874674e-47
Suva_4.4946.148ON8503884664e-47
KLLA0A05203g5.69ON4353894465e-47
AER301C5.69ON4354074465e-47
TBLA0E041008.614ON8664164639e-47
Ecym_13958.469ON5653864474e-46
TDEL0E038505.241ON7613854554e-46
KAFR0B044805.69ON4353954377e-46
Kwal_56.247605.69ON4333894351e-45
KAFR0G034806.148ON8523984541e-45
Ecym_47755.40ON5003954401e-45
NCAS0H012806.148ON8873844542e-45
YDR243C (PRP28)8.469ON5884024432e-45
CAGL0K11198g8.469ON5824004432e-45
Suva_2.4098.469ON5894014404e-45
ZYRO0A03476g3.249ON3993914276e-45
NCAS0B025708.469ON5904104381e-44
Skud_4.5058.469ON6044014381e-44
KAFR0B015205.40ON4963954321e-44
Smik_4.4908.469ON5874044352e-44
TBLA0I018603.249ON3873914197e-44
SAKL0A06204g6.148ON8432274372e-43
KNAG0A041308.469ON6094104264e-43
Suva_12.485.241ON7703834281e-42
Kpol_165.12.164ON4413514131e-42
TDEL0E042105.208ON7402134271e-42
TPHA0B029302.164ON4273514121e-42
AFL027C6.148ON8162164281e-42
Kpol_534.535.208ON7522574262e-42
ACR040W5.241ON7633784243e-42
NCAS0A015505.208ON7482134243e-42
Kwal_26.84702.164ON4253514084e-42
KLTH0A02244g8.87ON5984034167e-42
CAGL0F05577g8.402ON6664104152e-41
Suva_10.675.208ON7442134163e-41
Skud_14.2192.164ON4353634023e-41
KLLA0F10505g6.148ON8122054165e-41
TBLA0H032408.402ON7674164139e-41
KLLA0A05731g1.211ON3963703951e-40
ACR253C1.211ON3963693951e-40
Kwal_23.51258.87ON5984114043e-40
TPHA0N011306.148ON8772304077e-40
TPHA0D019905.337ON4982453958e-40
SAKL0H13574g8.402ON6684074011e-39
TPHA0B030401.211ON3963703862e-39
KNAG0B046605.337ON4942223922e-39
TDEL0H009301.211ON3953693843e-39
NDAI0C042505.337ON5042223904e-39
KAFR0D046305.337ON4872203885e-39
Kpol_1058.438.87ON6074083945e-39
KLLA0C14608g5.337ON4872223885e-39
Kpol_1060.581.211ON3963703826e-39
Ecym_73248.87ON5974003927e-39
Skud_6.728.87ON6064033937e-39
Ecym_51961.211ON3963693817e-39
AGL112C8.402ON6583953948e-39
KLTH0F05610g1.211ON3963703801e-38
Smik_6.818.87ON6064023901e-38
CAGL0L08976g8.87ON6174113902e-38
ZYRO0C14234g5.337ON4942223842e-38
Ecym_32175.337ON4862223832e-38
Kpol_1005.115.337ON5062223833e-38
NCAS0F027905.337ON5022223833e-38
Suva_11.2941.211ON3963693763e-38
KAFR0G006501.211ON3953693754e-38
Kpol_340.28.402ON6704103885e-38
ZYRO0D03058g1.211ON3953693755e-38
Skud_2.3696.148ON8482263925e-38
Suva_6.2181.211ON3963693755e-38
ZYRO0F04312g8.87ON6023993855e-38
Smik_10.941.211ON3953693746e-38
Smik_11.3211.211ON3953693746e-38
SAKL0G09328g5.337ON5052233807e-38
Smik_8.1365.337ON5012223808e-38
SAKL0C06336g1.211ON3973693738e-38
YFL002C (SPB4)8.87ON6064033849e-38
CAGL0I04356g1.211ON3963693731e-37
YJL138C (TIF2)1.211ON3953693721e-37
YKR059W (TIF1)1.211ON3953693721e-37
NCAS0J005808.87ON6114033831e-37
KNAG0C012201.211ON3973703721e-37
YHR065C (RRP3)5.337ON5012223781e-37
Skud_10.761.211ON3953693711e-37
TDEL0E028905.337ON5012223781e-37
Skud_8.1225.337ON5032223772e-37
KLTH0F08382g8.402ON6574023832e-37
Kwal_33.140001.211ON3963703702e-37
Suva_15.2545.337ON5032223763e-37
TDEL0F052608.402ON6554043823e-37
Skud_11.2951.211ON4293693713e-37
ZYRO0C04378g8.402ON6814063824e-37
Kwal_27.117348.469ON5714063774e-37
CAGL0J10912g5.337ON4932223736e-37
TBLA0C035005.337ON5062223736e-37
TBLA0D057501.211ON4013703676e-37
NCAS0B081301.211ON3963693667e-37
Kwal_33.143255.337ON5002223728e-37
NDAI0B054401.211ON3963693668e-37
Suva_6.598.87ON6064033768e-37
TPHA0N009405.241ON7711913801e-36
Kwal_23.32358.402ON6764013781e-36
KAFR0B061708.402ON6234083761e-36
KNAG0A046608.402ON7134023781e-36
SAKL0G11748g5.241ON7631913791e-36
AAL041C5.337ON4872233682e-36
KLTH0F07106g5.337ON5252223683e-36
KNAG0A058502.384ON4493863626e-36
KLLA0D18667g8.402ON6854073726e-36
KAFR0E016405.241ON7601913729e-36
Kwal_23.28835.241ON7641963729e-36
KNAG0H015208.614ON6212443671e-35
ZYRO0G08580g6.204ON5391983632e-35
TBLA0C006908.87ON6044073643e-35
Ecym_82615.241ON7751923683e-35
YDR194C (MSS116)8.402ON6643983654e-35
ACR078W5.643ON4673873566e-35
Kpol_1004.135.241ON7681923656e-35
NCAS0A014005.241ON7621913657e-35
Smik_4.4428.402ON6654033629e-35
NCAS0B030308.402ON6844073629e-35
NDAI0C046808.402ON7164073612e-34
Kwal_56.240056.204ON5332063542e-34
KNAG0F026105.241ON7621923612e-34
Skud_4.4588.402ON6643983583e-34
ZYRO0A10802g5.241ON7711923603e-34
KNAG0I020502.164ON4232163483e-34
TDEL0C011608.87ON6033953554e-34
KLTH0G07766g5.241ON7641913584e-34
AFL221C2.164ON5571983534e-34
Ecym_22136.204ON5542093535e-34
ADL024C8.124ON5692463527e-34
KLTH0H04466g6.204ON5531973518e-34
NCAS0A140607.336ON5101953481e-33
TDEL0F010908.124ON5513893482e-33
Kpol_1072.508.614ON6502423512e-33
YDL160C (DHH1)7.336ON5061983452e-33
Suva_4.867.336ON5081983452e-33
KAFR0H028208.614ON6112423492e-33
TPHA0L009608.402ON6764123512e-33
KNAG0F020506.204ON5331973453e-33
TPHA0B028508.614ON6282423483e-33
NDAI0C023205.241ON7641913513e-33
SAKL0F11088g7.336ON4971953433e-33
KLLA0D09504g5.241ON7701933504e-33
Ecym_41658.402ON6584073485e-33
KLLA0F06941g6.355ON6304143475e-33
Kpol_2001.677.336ON4841953415e-33
CAGL0J01045g5.241ON7651913497e-33
Skud_16.1618.614ON6192423457e-33
Suva_2.3628.402ON6644063451e-32
TBLA0C006408.124ON5792243431e-32
ZYRO0F11440g7.336ON5231983411e-32
KLLA0A09669g5.40ON4972343391e-32
Smik_6.3188.614ON6132423431e-32
Smik_10.2395.241ON7701913461e-32
YGL171W (ROK1)8.124ON5642443411e-32
YJL033W (HCA4)5.241ON7701913462e-32
KLLA0C15499g6.204ON5041973382e-32
CAGL0L10021g5.643ON5043963382e-32
NCAS0B017308.614ON6182433422e-32
Skud_15.3708.614ON6092423422e-32
KLTH0H01562g7.336ON4911953372e-32
KNAG0C038207.336ON5131983372e-32
Skud_7.1008.124ON5582443393e-32
YOR204W (DED1)8.614ON6042423403e-32
TBLA0B042008.614ON6312423413e-32
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0C08778g
         (1003 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0C08778g Chr3 (804617..807628) [3012 bp, 1003 aa] {ON} simil...  1654   0.0  
KLTH0C08866g Chr3 (742559..745477) [2919 bp, 972 aa] {ON} highly...  1266   0.0  
Kwal_56.22804 s56 complement(286570..289491) [2922 bp, 973 aa] {...  1248   0.0  
KLLA0F24684g Chr6 complement(2294708..2297629) [2922 bp, 973 aa]...  1247   0.0  
Kpol_1032.11 s1032 complement(27093..30026) [2934 bp, 977 aa] {O...  1240   0.0  
YDL031W Chr4 (394217..397204) [2988 bp, 995 aa] {ON}  DBP10Putat...  1235   0.0  
AEL086W Chr5 (464521..467403) [2883 bp, 960 aa] {ON} Syntenic ho...  1227   0.0  
Smik_4.204 Chr4 (374339..377335) [2997 bp, 998 aa] {ON} YDL031W ...  1224   0.0  
NCAS0C03530 Chr3 (703955..706888) [2934 bp, 977 aa] {ON} Anc_3.159   1221   0.0  
Suva_4.218 Chr4 (384623..387646) [3024 bp, 1007 aa] {ON} YDL031W...  1217   0.0  
KAFR0C01060 Chr3 complement(215822..218743) [2922 bp, 973 aa] {O...  1216   0.0  
CAGL0K01551g Chr11 (136421..139330) [2910 bp, 969 aa] {ON} highl...  1216   0.0  
NDAI0G02870 Chr7 (664526..667501) [2976 bp, 991 aa] {ON}             1215   0.0  
Skud_4.220 Chr4 (389016..392021) [3006 bp, 1001 aa] {ON} YDL031W...  1212   0.0  
KNAG0K01110 Chr11 (215540..218545) [3006 bp, 1001 aa] {ON} Anc_3...  1209   0.0  
TPHA0M00330 Chr13 complement(61976..64921) [2946 bp, 981 aa] {ON}    1182   0.0  
ZYRO0B04972g Chr2 complement(401735..404674) [2940 bp, 979 aa] {...  1167   0.0  
TDEL0D04630 Chr4 complement(849268..852174) [2907 bp, 968 aa] {O...  1164   0.0  
TBLA0B01590 Chr2 (349441..352230) [2790 bp, 929 aa] {ON} Anc_3.1...   709   0.0  
CAGL0D03124g Chr4 complement(321029..323206) [2178 bp, 725 aa] {...   223   7e-61
ZYRO0B10318g Chr2 complement(808717..810969) [2253 bp, 750 aa] {...   221   3e-60
YLL008W Chr12 (131729..133987) [2259 bp, 752 aa] {ON}  DRS1Nucle...   220   1e-59
Smik_12.55 Chr12 (118743..120950) [2208 bp, 735 aa] {ON} YLL008W...   220   1e-59
TPHA0N00700 Chr14 (157186..159453) [2268 bp, 755 aa] {ON} Anc_5....   219   2e-59
KNAG0H02520 Chr8 complement(463527..465791) [2265 bp, 754 aa] {O...   219   2e-59
KLLA0F15752g Chr6 (1454735..1456981) [2247 bp, 748 aa] {ON} simi...   219   3e-59
NDAI0C02490 Chr3 complement(570276..572591) [2316 bp, 771 aa] {O...   218   8e-59
AAL164C Chr1 complement(55223..57427) [2205 bp, 734 aa] {ON} Syn...   217   8e-59
KAFR0C06420 Chr3 complement(1286002..1288221) [2220 bp, 739 aa] ...   216   2e-58
SAKL0G12760g Chr7 complement(1088344..1090557) [2214 bp, 737 aa]...   216   3e-58
Skud_12.59 Chr12 (122973..125249) [2277 bp, 758 aa] {ON} YLL008W...   216   3e-58
TBLA0C06160 Chr3 (1494579..1496852) [2274 bp, 757 aa] {ON} Anc_5...   213   3e-57
KLTH0B03278g Chr2 complement(257395..259614) [2220 bp, 739 aa] {...   212   4e-57
Kwal_33.15165 s33 (987878..990073) [2196 bp, 731 aa] {ON} YLL008...   211   8e-57
NDAI0F02010 Chr6 (492540..495206) [2667 bp, 888 aa] {ON} Anc_6.148    213   1e-56
TDEL0G01420 Chr7 (287165..288703) [1539 bp, 512 aa] {ON} Anc_6.2...   203   1e-55
NCAS0G02560 Chr7 (457574..458852,459621..460012) [1671 bp, 556 a...   203   2e-55
Smik_7.205 Chr7 complement(354693..356261) [1569 bp, 522 aa] {ON...   202   3e-55
CAGL0L03846g Chr12 complement(443677..444047,445148..446411) [16...   202   3e-55
Suva_7.192 Chr7 complement(353138..354694) [1557 bp, 518 aa] {ON...   202   4e-55
YGL078C Chr7 complement(360288..361859) [1572 bp, 523 aa] {ON}  ...   202   4e-55
TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 5...   202   6e-55
CAGL0L02915g Chr12 complement(342831..344684) [1854 bp, 617 aa] ...   203   6e-55
Skud_7.204 Chr7 complement(363553..365103) [1551 bp, 516 aa] {ON...   200   1e-54
YNL112W Chr14 (413639..414911,415914..416281) [1641 bp, 546 aa] ...   201   2e-54
ZYRO0B09856g Chr2 complement(769104..769462,770138..771401) [162...   198   9e-54
NDAI0F02740 Chr6 complement(670654..671051,672039..673326) [1686...   198   1e-53
Smik_14.215 Chr14 (393283..394555,395537..395907) [1644 bp, 547 ...   197   2e-53
KAFR0B04560 Chr2 complement(947248..947615,948264..949527) [1632...   197   2e-53
TDEL0F01190 Chr6 (211677..212937,213454..213842) [1650 bp, 549 a...   197   3e-53
KLLA0F01034g Chr6 (93422..95305) [1884 bp, 627 aa] {ON} similar ...   199   3e-53
CAGL0H03377g Chr8 complement(313755..315377) [1623 bp, 540 aa] {...   196   4e-53
KLTH0D09328g Chr4 complement(773449..773837,774557..775823) [165...   196   9e-53
TDEL0B04060 Chr2 complement(724075..726618) [2544 bp, 847 aa] {O...   201   9e-53
Suva_14.226 Chr14 (410416..411691,412742..413097) [1632 bp, 543 ...   195   1e-52
KLLA0F23716g Chr6 complement(2215454..2215845,2216857..2218129) ...   195   2e-52
Suva_16.191 Chr16 complement(333913..335769) [1857 bp, 618 aa] {...   194   1e-51
Ecym_5422 Chr5 complement(868686..869065,869897..871199) [1683 b...   192   1e-51
Kwal_14.1653 s14 complement(406891..408957) [2067 bp, 688 aa] {O...   194   3e-51
NCAS0C01720 Chr3 complement(317951..319873) [1923 bp, 640 aa] {O...   193   3e-51
CAGL0J06908g Chr10 complement(662041..663855) [1815 bp, 604 aa] ...   192   4e-51
KAFR0G02030 Chr7 complement(428516..430336) [1821 bp, 606 aa] {O...   192   4e-51
TDEL0A05590 Chr1 (980392..982185) [1794 bp, 597 aa] {ON} Anc_8.6...   191   6e-51
NDAI0E01590 Chr5 complement(315658..317484) [1827 bp, 608 aa] {O...   191   1e-50
Ecym_2269 Chr2 complement(527849..530482) [2634 bp, 877 aa] {ON}...   195   1e-50
SAKL0E10670g Chr5 complement(888829..889205,889934..891281) [172...   189   2e-50
NDAI0E02430 Chr5 complement(503901..505886) [1986 bp, 661 aa] {O...   191   2e-50
ZYRO0G14960g Chr7 (1201495..1203990) [2496 bp, 831 aa] {ON} simi...   192   6e-50
KLTH0H05852g Chr8 complement(514352..516787) [2436 bp, 811 aa] {...   192   7e-50
NDAI0B00900 Chr2 complement(209012..210322) [1311 bp, 436 aa] {O...   184   9e-50
Kpol_534.31 s534 complement(73551..76169) [2619 bp, 872 aa] {ON}...   192   9e-50
Smik_8.253 Chr8 (419155..420468) [1314 bp, 437 aa] {ON} YHR169W ...   182   3e-49
YHR169W Chr8 (442181..443476) [1296 bp, 431 aa] {ON}  DBP8ATPase...   182   3e-49
TBLA0D03520 Chr4 (873710..876379) [2670 bp, 889 aa] {ON} Anc_6.1...   190   4e-49
Smik_2.380 Chr2 (678057..680609) [2553 bp, 850 aa] {ON} YBR237W ...   189   7e-49
YBR237W Chr2 (691969..694518) [2550 bp, 849 aa] {ON}  PRP5RNA he...   189   7e-49
KLTH0H00638g Chr8 complement(64621..65922) [1302 bp, 433 aa] {ON...   181   8e-49
Suva_15.369 Chr15 (648232..649545) [1314 bp, 437 aa] {ON} YHR169...   180   2e-48
CAGL0K07029g Chr11 complement(690501..692951) [2451 bp, 816 aa] ...   187   2e-48
NCAS0E03920 Chr5 complement(769305..770618) [1314 bp, 437 aa] {O...   180   3e-48
Kpol_1062.5 s1062 complement(10370..11665) [1296 bp, 431 aa] {ON...   179   3e-48
Skud_8.233 Chr8 (413556..414869) [1314 bp, 437 aa] {ON} YHR169W ...   178   8e-48
TDEL0G00930 Chr7 complement(186836..188146) [1311 bp, 436 aa] {O...   178   1e-47
KLLA0C15433g Chr3 complement(1339439..1341058) [1620 bp, 539 aa]...   179   3e-47
KNAG0M00660 Chr13 complement(107772..110426) [2655 bp, 884 aa] {...   184   4e-47
Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W ...   184   4e-47
KLLA0A05203g Chr1 complement(462167..463474) [1308 bp, 435 aa] {...   176   5e-47
AER301C Chr5 complement(1188485..1189792) [1308 bp, 435 aa] {ON}...   176   5e-47
TBLA0E04100 Chr5 (1032727..1035327) [2601 bp, 866 aa] {ON} Anc_8...   182   9e-47
Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}...   176   4e-46
TDEL0E03850 Chr5 complement(723551..725836) [2286 bp, 761 aa] {O...   179   4e-46
KAFR0B04480 Chr2 complement(929008..930315) [1308 bp, 435 aa] {O...   172   7e-46
Kwal_56.24760 s56 (1136947..1138248) [1302 bp, 433 aa] {ON} YHR1...   172   1e-45
KAFR0G03480 Chr7 (718012..720570) [2559 bp, 852 aa] {ON} Anc_6.1...   179   1e-45
Ecym_4775 Chr4 (1507889..1509391) [1503 bp, 500 aa] {ON} similar...   174   1e-45
NCAS0H01280 Chr8 complement(243749..246412) [2664 bp, 887 aa] {O...   179   2e-45
YDR243C Chr4 complement(948518..950284) [1767 bp, 588 aa] {ON}  ...   175   2e-45
CAGL0K11198g Chr11 complement(1087381..1089129) [1749 bp, 582 aa...   175   2e-45
Suva_2.409 Chr2 complement(727948..729717) [1770 bp, 589 aa] {ON...   174   4e-45
ZYRO0A03476g Chr1 complement(277585..278784) [1200 bp, 399 aa] {...   169   6e-45
NCAS0B02570 Chr2 (429423..431195) [1773 bp, 590 aa] {ON} Anc_8.469    173   1e-44
Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON...   173   1e-44
KAFR0B01520 Chr2 (286962..288452) [1491 bp, 496 aa] {ON} Anc_5.4...   171   1e-44
Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON...   172   2e-44
TBLA0I01860 Chr9 (418583..419746) [1164 bp, 387 aa] {ON} Anc_3.2...   166   7e-44
SAKL0A06204g Chr1 complement(560276..562807) [2532 bp, 843 aa] {...   172   2e-43
KNAG0A04130 Chr1 (559075..560904) [1830 bp, 609 aa] {ON} Anc_8.4...   168   4e-43
Suva_12.48 Chr12 (66743..69055) [2313 bp, 770 aa] {ON} YJL033W (...   169   1e-42
Kpol_165.1 s165 complement(441..1766) [1326 bp, 441 aa] {ON} com...   163   1e-42
TDEL0E04210 Chr5 complement(786151..788373) [2223 bp, 740 aa] {O...   169   1e-42
TPHA0B02930 Chr2 (666924..668207) [1284 bp, 427 aa] {ON} Anc_6.1...   163   1e-42
AFL027C Chr6 complement(386001..388451) [2451 bp, 816 aa] {ON} S...   169   1e-42
Kpol_534.53 s534 (137204..139462) [2259 bp, 752 aa] {ON} (137204...   168   2e-42
ACR040W Chr3 (431343..433634) [2292 bp, 763 aa] {ON} Syntenic ho...   167   3e-42
NCAS0A01550 Chr1 complement(302857..305103) [2247 bp, 748 aa] {O...   167   3e-42
Kwal_26.8470 s26 complement(798445..799722) [1278 bp, 425 aa] {O...   161   4e-42
KLTH0A02244g Chr1 (190077..191873) [1797 bp, 598 aa] {ON} simila...   164   7e-42
CAGL0F05577g Chr6 (559705..561705) [2001 bp, 666 aa] {ON} simila...   164   2e-41
Suva_10.67 Chr10 (136688..138922) [2235 bp, 744 aa] {ON} YLL008W...   164   3e-41
Skud_14.219 Chr14 (403781..405088) [1308 bp, 435 aa] {ON} YNL112...   159   3e-41
KLLA0F10505g Chr6 complement(966736..969174) [2439 bp, 812 aa] {...   164   5e-41
TBLA0H03240 Chr8 complement(787863..790166) [2304 bp, 767 aa] {O...   163   9e-41
KLLA0A05731g Chr1 (536243..537433) [1191 bp, 396 aa] {ON} highly...   156   1e-40
ACR253C Chr3 complement(802236..803426) [1191 bp, 396 aa] {ON} S...   156   1e-40
Kwal_23.5125 s23 complement(1024642..1026438) [1797 bp, 598 aa] ...   160   3e-40
TPHA0N01130 Chr14 complement(237020..239653) [2634 bp, 877 aa] {...   161   7e-40
TPHA0D01990 Chr4 complement(411607..413103) [1497 bp, 498 aa] {O...   156   8e-40
SAKL0H13574g Chr8 (1161196..1163202) [2007 bp, 668 aa] {ON} simi...   159   1e-39
TPHA0B03040 Chr2 complement(690810..692000) [1191 bp, 396 aa] {O...   153   2e-39
KNAG0B04660 Chr2 complement(900857..902341) [1485 bp, 494 aa] {O...   155   2e-39
TDEL0H00930 Chr8 complement(152864..154051) [1188 bp, 395 aa] {O...   152   3e-39
NDAI0C04250 Chr3 (968216..969730) [1515 bp, 504 aa] {ON} Anc_5.337    154   4e-39
KAFR0D04630 Chr4 complement(909161..910624) [1464 bp, 487 aa] {O...   154   5e-39
Kpol_1058.43 s1058 complement(121252..123075) [1824 bp, 607 aa] ...   156   5e-39
KLLA0C14608g Chr3 (1276354..1277817) [1464 bp, 487 aa] {ON} high...   154   5e-39
Kpol_1060.58 s1060 complement(135570..136760) [1191 bp, 396 aa] ...   151   6e-39
Ecym_7324 Chr7 complement(689228..691021) [1794 bp, 597 aa] {ON}...   155   7e-39
Skud_6.72 Chr6 complement(140844..142664) [1821 bp, 606 aa] {ON}...   155   7e-39
Ecym_5196 Chr5 complement(405570..406760) [1191 bp, 396 aa] {ON}...   151   7e-39
AGL112C Chr7 complement(495879..497855) [1977 bp, 658 aa] {ON} S...   156   8e-39
KLTH0F05610g Chr6 complement(483243..484433) [1191 bp, 396 aa] {...   150   1e-38
Smik_6.81 Chr6 complement(152467..154287) [1821 bp, 606 aa] {ON}...   154   1e-38
CAGL0L08976g Chr12 complement(981008..982861) [1854 bp, 617 aa] ...   154   2e-38
ZYRO0C14234g Chr3 complement(1116350..1117834) [1485 bp, 494 aa]...   152   2e-38
Ecym_3217 Chr3 complement(411925..413385) [1461 bp, 486 aa] {ON}...   152   2e-38
Kpol_1005.11 s1005 complement(18157..19677) [1521 bp, 506 aa] {O...   152   3e-38
NCAS0F02790 Chr6 (561303..562811) [1509 bp, 502 aa] {ON} Anc_5.337    152   3e-38
Suva_11.294 Chr11 (539139..540329) [1191 bp, 396 aa] {ON} YKR059...   149   3e-38
KAFR0G00650 Chr7 complement(164087..165274) [1188 bp, 395 aa] {O...   149   4e-38
Kpol_340.2 s340 complement(3233..5245) [2013 bp, 670 aa] {ON} co...   154   5e-38
ZYRO0D03058g Chr4 complement(237526..238713) [1188 bp, 395 aa] {...   149   5e-38
Skud_2.369 Chr2 (660665..663211) [2547 bp, 848 aa] {ON} YBR237W ...   155   5e-38
Suva_6.218 Chr6 (395411..396601) [1191 bp, 396 aa] {ON} YJL138C ...   149   5e-38
ZYRO0F04312g Chr6 complement(366863..368671) [1809 bp, 602 aa] {...   152   5e-38
Smik_10.94 Chr10 complement(151257..152444) [1188 bp, 395 aa] {O...   148   6e-38
Smik_11.321 Chr11 (544869..546056) [1188 bp, 395 aa] {ON} YKR059...   148   6e-38
SAKL0G09328g Chr7 (797795..799312) [1518 bp, 505 aa] {ON} highly...   150   7e-38
Smik_8.136 Chr8 complement(202825..204330) [1506 bp, 501 aa] {ON...   150   8e-38
SAKL0C06336g Chr3 complement(584406..585599) [1194 bp, 397 aa] {...   148   8e-38
YFL002C Chr6 complement(145114..146934) [1821 bp, 606 aa] {ON}  ...   152   9e-38
CAGL0I04356g Chr9 (389225..390415) [1191 bp, 396 aa] {ON} highly...   148   1e-37
YJL138C Chr10 complement(153504..154691) [1188 bp, 395 aa] {ON} ...   147   1e-37
YKR059W Chr11 (554987..556174) [1188 bp, 395 aa] {ON}  TIF1Trans...   147   1e-37
NCAS0J00580 Chr10 (87108..88943) [1836 bp, 611 aa] {ON} Anc_8.87      152   1e-37
KNAG0C01220 Chr3 complement(237478..238671) [1194 bp, 397 aa] {O...   147   1e-37
YHR065C Chr8 complement(227532..229037) [1506 bp, 501 aa] {ON}  ...   150   1e-37
Skud_10.76 Chr10 complement(128551..129738) [1188 bp, 395 aa] {O...   147   1e-37
TDEL0E02890 Chr5 (550708..552213) [1506 bp, 501 aa] {ON} Anc_5.3...   150   1e-37
Skud_8.122 Chr8 complement(200848..202359) [1512 bp, 503 aa] {ON...   149   2e-37
KLTH0F08382g Chr6 (724794..726767) [1974 bp, 657 aa] {ON} simila...   152   2e-37
Kwal_33.14000 s33 complement(477253..478443) [1191 bp, 396 aa] {...   147   2e-37
Suva_15.254 Chr15 complement(429201..430712) [1512 bp, 503 aa] {...   149   3e-37
TDEL0F05260 Chr6 complement(983324..985291) [1968 bp, 655 aa] {O...   151   3e-37
Skud_11.295 Chr11 (536422..537711) [1290 bp, 429 aa] {ON} YKR059...   147   3e-37
ZYRO0C04378g Chr3 complement(342717..344762) [2046 bp, 681 aa] {...   151   4e-37
Kwal_27.11734 s27 complement(923899..925614) [1716 bp, 571 aa] {...   149   4e-37
CAGL0J10912g Chr10 (1063600..1065081) [1482 bp, 493 aa] {ON} hig...   148   6e-37
TBLA0C03500 Chr3 complement(835236..836756) [1521 bp, 506 aa] {O...   148   6e-37
TBLA0D05750 Chr4 (1420975..1422180) [1206 bp, 401 aa] {ON} Anc_1...   145   6e-37
NCAS0B08130 Chr2 (1551641..1552831) [1191 bp, 396 aa] {ON} Anc_1...   145   7e-37
Kwal_33.14325 s33 (619599..621101) [1503 bp, 500 aa] {ON} YHR065...   147   8e-37
NDAI0B05440 Chr2 (1333810..1335000) [1191 bp, 396 aa] {ON} Anc_1...   145   8e-37
Suva_6.59 Chr6 complement(110278..112098) [1821 bp, 606 aa] {ON}...   149   8e-37
TPHA0N00940 Chr14 (202770..205085) [2316 bp, 771 aa] {ON} Anc_5....   150   1e-36
Kwal_23.3235 s23 (209691..211721) [2031 bp, 676 aa] {ON} YDR194C...   150   1e-36
KAFR0B06170 Chr2 complement(1271195..1273066) [1872 bp, 623 aa] ...   149   1e-36
KNAG0A04660 Chr1 (663566..665707) [2142 bp, 713 aa] {ON} Anc_8.4...   150   1e-36
SAKL0G11748g Chr7 complement(998525..1000816) [2292 bp, 763 aa] ...   150   1e-36
AAL041C Chr1 complement(270739..272202) [1464 bp, 487 aa] {ON} S...   146   2e-36
KLTH0F07106g Chr6 (618637..620214) [1578 bp, 525 aa] {ON} highly...   146   3e-36
KNAG0A05850 Chr1 (873957..875306) [1350 bp, 449 aa] {ON} Anc_2.3...   144   6e-36
KLLA0D18667g Chr4 complement(1574160..1576217) [2058 bp, 685 aa]...   147   6e-36
KAFR0E01640 Chr5 complement(335123..337405) [2283 bp, 760 aa] {O...   147   9e-36
Kwal_23.2883 s23 complement(58087..60381) [2295 bp, 764 aa] {ON}...   147   9e-36
KNAG0H01520 Chr8 complement(267709..269574) [1866 bp, 621 aa] {O...   145   1e-35
ZYRO0G08580g Chr7 complement(695127..696746) [1620 bp, 539 aa] {...   144   2e-35
TBLA0C00690 Chr3 complement(136694..138508) [1815 bp, 604 aa] {O...   144   3e-35
Ecym_8261 Chr8 complement(528229..530556) [2328 bp, 775 aa] {ON}...   146   3e-35
YDR194C Chr4 complement(845952..847946) [1995 bp, 664 aa] {ON}  ...   145   4e-35
ACR078W Chr3 (501241..502644) [1404 bp, 467 aa] {ON} Syntenic ho...   141   6e-35
Kpol_1004.13 s1004 (25289..27595) [2307 bp, 768 aa] {ON} (25289....   145   6e-35
NCAS0A01400 Chr1 (274080..276368) [2289 bp, 762 aa] {ON} Anc_5.241    145   7e-35
Smik_4.442 Chr4 complement(801552..803549) [1998 bp, 665 aa] {ON...   144   9e-35
NCAS0B03030 Chr2 (522163..524217) [2055 bp, 684 aa] {ON} Anc_8.402    144   9e-35
NDAI0C04680 Chr3 complement(1077391..1079541) [2151 bp, 716 aa] ...   143   2e-34
Kwal_56.24005 s56 complement(809954..811555) [1602 bp, 533 aa] {...   140   2e-34
KNAG0F02610 Chr6 complement(488956..491244) [2289 bp, 762 aa] {O...   143   2e-34
Skud_4.458 Chr4 complement(812448..814442) [1995 bp, 664 aa] {ON...   142   3e-34
ZYRO0A10802g Chr1 complement(869465..871780) [2316 bp, 771 aa] {...   143   3e-34
KNAG0I02050 Chr9 complement(399547..399554,399758..401021) [1272...   138   3e-34
TDEL0C01160 Chr3 complement(198802..200613) [1812 bp, 603 aa] {O...   141   4e-34
KLTH0G07766g Chr7 complement(626094..628388) [2295 bp, 764 aa] {...   142   4e-34
AFL221C Chr6 complement(22711..23108,23775..25050) [1674 bp, 557...   140   4e-34
Ecym_2213 Chr2 (419873..421537) [1665 bp, 554 aa] {ON} similar t...   140   5e-34
ADL024C Chr4 complement(657270..658979) [1710 bp, 569 aa] {ON} S...   140   7e-34
KLTH0H04466g Chr8 (399689..401350) [1662 bp, 553 aa] {ON} simila...   139   8e-34
NCAS0A14060 Chr1 (2765451..2766983) [1533 bp, 510 aa] {ON} Anc_7...   138   1e-33
TDEL0F01090 Chr6 (196968..198623) [1656 bp, 551 aa] {ON} Anc_8.1...   138   2e-33
Kpol_1072.50 s1072 complement(115009..116961) [1953 bp, 650 aa] ...   139   2e-33
YDL160C Chr4 complement(170410..171930) [1521 bp, 506 aa] {ON}  ...   137   2e-33
Suva_4.86 Chr4 complement(158173..159699) [1527 bp, 508 aa] {ON}...   137   2e-33
KAFR0H02820 Chr8 (537121..538956) [1836 bp, 611 aa] {ON} Anc_8.6...   139   2e-33
TPHA0L00960 Chr12 complement(194538..196568) [2031 bp, 676 aa] {...   139   2e-33
KNAG0F02050 Chr6 (392126..393727) [1602 bp, 533 aa] {ON} Anc_6.2...   137   3e-33
TPHA0B02850 Chr2 complement(650888..652774) [1887 bp, 628 aa] {O...   138   3e-33
NDAI0C02320 Chr3 (527244..529538) [2295 bp, 764 aa] {ON} Anc_5.241    139   3e-33
SAKL0F11088g Chr6 complement(866571..868064) [1494 bp, 497 aa] {...   136   3e-33
KLLA0D09504g Chr4 complement(801783..804095) [2313 bp, 770 aa] {...   139   4e-33
Ecym_4165 Chr4 (350595..352571) [1977 bp, 658 aa] {ON} similar t...   138   5e-33
KLLA0F06941g Chr6 complement(665970..667862) [1893 bp, 630 aa] {...   138   5e-33
Kpol_2001.67 s2001 (185153..186607) [1455 bp, 484 aa] {ON} (1851...   135   5e-33
CAGL0J01045g Chr10 (101282..103579) [2298 bp, 765 aa] {ON} highl...   139   7e-33
Skud_16.161 Chr16 complement(295968..297827) [1860 bp, 619 aa] {...   137   7e-33
Suva_2.362 Chr2 complement(636909..638903) [1995 bp, 664 aa] {ON...   137   1e-32
TBLA0C00640 Chr3 (129301..131040) [1740 bp, 579 aa] {ON} Anc_8.1...   136   1e-32
ZYRO0F11440g Chr6 (939613..941184) [1572 bp, 523 aa] {ON} highly...   135   1e-32
KLLA0A09669g Chr1 complement(847036..848529) [1494 bp, 497 aa] {...   135   1e-32
Smik_6.318 Chr6 (498013..499854) [1842 bp, 613 aa] {ON} YPL119C ...   136   1e-32
Smik_10.239 Chr10 (380101..382413) [2313 bp, 770 aa] {ON} YJL033...   137   1e-32
YGL171W Chr7 (182390..184084) [1695 bp, 564 aa] {ON}  ROK1RNA-de...   135   1e-32
YJL033W Chr10 (383837..386149) [2313 bp, 770 aa] {ON}  HCA4Putat...   137   2e-32
KLLA0C15499g Chr3 complement(1345201..1346715) [1515 bp, 504 aa]...   134   2e-32
CAGL0L10021g Chr12 complement(1076197..1077711) [1515 bp, 504 aa...   134   2e-32
NCAS0B01730 Chr2 complement(286249..288105) [1857 bp, 618 aa] {O...   136   2e-32
Skud_15.370 Chr15 (661915..663744) [1830 bp, 609 aa] {ON} YOR204...   136   2e-32
KLTH0H01562g Chr8 complement(140915..142390) [1476 bp, 491 aa] {...   134   2e-32
KNAG0C03820 Chr3 complement(748934..750475) [1542 bp, 513 aa] {O...   134   2e-32
Skud_7.100 Chr7 (187842..189518) [1677 bp, 558 aa] {ON} YGL171W ...   135   3e-32
YOR204W Chr15 (722911..724725) [1815 bp, 604 aa] {ON}  DED1ATP-d...   135   3e-32
TBLA0B04200 Chr2 complement(970057..971952) [1896 bp, 631 aa] {O...   135   3e-32
Ecym_4646 Chr4 complement(1259564..1261036) [1473 bp, 490 aa] {O...   134   3e-32
SAKL0G01496g Chr7 (125044..125050,125133..126568) [1443 bp, 480 ...   133   3e-32
NDAI0A01960 Chr1 complement(436462..438066) [1605 bp, 534 aa] {O...   134   3e-32
Suva_8.257 Chr8 (461776..463632) [1857 bp, 618 aa] {ON} YOR204W ...   135   4e-32
KLTH0D09746g Chr4 (805863..807728) [1866 bp, 621 aa] {ON} simila...   135   4e-32
Skud_10.189 Chr10 (351797..354109) [2313 bp, 770 aa] {ON} YJL033...   136   5e-32
TBLA0D03400 Chr4 (844529..846856) [2328 bp, 775 aa] {ON} Anc_5.2...   136   5e-32
Smik_15.390 Chr15 (672576..674405) [1830 bp, 609 aa] {ON} YOR204...   134   5e-32
CAGL0I03476g Chr9 complement(294849..296372) [1524 bp, 507 aa] {...   133   5e-32
SAKL0H08162g Chr8 complement(702292..704166) [1875 bp, 624 aa] {...   134   6e-32
YPL119C Chr16 complement(324411..326264) [1854 bp, 617 aa] {ON} ...   134   7e-32
CAGL0M13519g Chr13 complement(1330802..1332286) [1485 bp, 494 aa...   132   7e-32
Skud_4.96 Chr4 complement(166027..167550) [1524 bp, 507 aa] {ON}...   132   8e-32
TDEL0C02100 Chr3 complement(362760..364199) [1440 bp, 479 aa] {O...   132   8e-32
KAFR0B00910 Chr2 complement(168186..169724) [1539 bp, 512 aa] {O...   132   8e-32
KAFR0C02220 Chr3 complement(439704..441239) [1536 bp, 511 aa] {O...   132   9e-32
Kwal_56.24588 s56 (1065225..1066766) [1542 bp, 513 aa] {ON} YDL1...   132   9e-32
TBLA0B05050 Chr2 (1191456..1192997) [1542 bp, 513 aa] {ON} Anc_6...   132   1e-31
ACR197W Chr3 (695405..696859) [1455 bp, 484 aa] {ON} Syntenic ho...   132   1e-31
Smik_4.77 Chr4 complement(147172..148692) [1521 bp, 506 aa] {ON}...   132   1e-31
NCAS0D03740 Chr4 complement(694809..696368) [1560 bp, 519 aa] {O...   132   1e-31
Suva_7.92 Chr7 (178376..180052) [1677 bp, 558 aa] {ON} YGL171W (...   132   1e-31
Ecym_8298 Chr8 (605258..607174) [1917 bp, 638 aa] {ON} similar t...   133   1e-31
TPHA0L02160 Chr12 complement(448305..449801) [1497 bp, 498 aa] {...   132   1e-31
TPHA0D04520 Chr4 (985683..987191) [1509 bp, 502 aa] {ON} Anc_7.3...   132   2e-31
NDAI0I01150 Chr9 (278832..280403) [1572 bp, 523 aa] {ON} Anc_6.204    132   2e-31
ADL273C Chr4 complement(225068..226939) [1872 bp, 623 aa] {ON} S...   133   2e-31
TBLA0F02360 Chr6 (582109..583866) [1758 bp, 585 aa] {ON} Anc_7.3...   132   2e-31
KLTH0B08998g Chr2 complement(731722..733200) [1479 bp, 492 aa] {...   131   2e-31
Smik_7.100 Chr7 (177395..179068) [1674 bp, 557 aa] {ON} YGL171W ...   132   2e-31
AFL080W Chr6 (288205..289812) [1608 bp, 535 aa] {ON} Syntenic ho...   132   2e-31
AGR333C Chr7 complement(1353154..1354668) [1515 bp, 504 aa] {ON}...   131   2e-31
Kpol_1033.40 s1033 complement(104203..105795) [1593 bp, 530 aa] ...   131   2e-31
NDAI0F00700 Chr6 (170569..171699) [1131 bp, 376 aa] {ON} Anc_5.643    128   2e-31
SAKL0A04752g Chr1 (434100..435749) [1650 bp, 549 aa] {ON} simila...   132   2e-31
SAKL0H01430g Chr8 (149724..151226) [1503 bp, 500 aa] {ON} highly...   130   3e-31
NCAS0F02200 Chr6 (438960..440486) [1527 bp, 508 aa] {ON} Anc_5.40     130   3e-31
Kpol_513.15 s513 complement(41334..42839) [1506 bp, 501 aa] {ON}...   130   3e-31
ZYRO0D07546g Chr4 (657145..658629) [1485 bp, 494 aa] {ON} highly...   130   4e-31
NDAI0C03600 Chr3 complement(826718..828277) [1560 bp, 519 aa] {O...   130   4e-31
TDEL0G00650 Chr7 (132659..134116) [1458 bp, 485 aa] {ON} Anc_5.4...   130   4e-31
ZYRO0F10934g Chr6 (890412..892223) [1812 bp, 603 aa] {ON} simila...   131   5e-31
KLLA0C16599g Chr3 (1453655..1455199) [1545 bp, 514 aa] {ON} simi...   130   6e-31
TPHA0E02410 Chr5 (512919..514490) [1572 bp, 523 aa] {ON} Anc_6.2...   130   6e-31
ZYRO0E02530g Chr5 (197126..198796) [1671 bp, 556 aa] {ON} highly...   130   1e-30
CAGL0K02387g Chr11 (216795..218492) [1698 bp, 565 aa] {ON} highl...   129   2e-30
CAGL0M06567g Chr13 complement(679126..680325) [1200 bp, 399 aa] ...   126   2e-30
Kwal_23.4288 s23 (654900..656378) [1479 bp, 492 aa] {ON} YMR290C...   128   2e-30
SAKL0A00924g Chr1 complement(98231..100150) [1920 bp, 639 aa] {O...   129   3e-30
KNAG0A03280 Chr1 complement(416099..417922) [1824 bp, 607 aa] {O...   128   6e-30
CAGL0I02354g Chr9 (209279..210592) [1314 bp, 437 aa] {ON} highly...   125   8e-30
YMR290C Chr13 complement(850074..851591) [1518 bp, 505 aa] {ON} ...   126   8e-30
NDAI0B02410 Chr2 complement(602541..604256) [1716 bp, 571 aa] {O...   127   8e-30
KNAG0D02250 Chr4 (387478..389160) [1683 bp, 560 aa] {ON} Anc_8.1...   127   8e-30
Skud_13.463 Chr13 complement(823646..825163) [1518 bp, 505 aa] {...   126   9e-30
SAKL0H02178g Chr8 complement(211451..212758) [1308 bp, 435 aa] {...   125   9e-30
TBLA0C06780 Chr3 complement(1636223..1637713) [1491 bp, 496 aa] ...   126   1e-29
Suva_13.480 Chr13 complement(832037..833554) [1518 bp, 505 aa] {...   126   1e-29
Smik_13.506 Chr13 complement(832760..834277) [1518 bp, 505 aa] {...   126   1e-29
SAKL0H20218g Chr8 (1770946..1772670) [1725 bp, 574 aa] {ON} simi...   127   1e-29
ZYRO0A02948g Chr1 (240353..242026) [1674 bp, 557 aa] {ON} simila...   126   1e-29
NCAS0B04630 Chr2 (845866..847557) [1692 bp, 563 aa] {ON} Anc_8.124    126   1e-29
KNAG0D02780 Chr4 complement(504774..506204) [1431 bp, 476 aa] {O...   125   2e-29
KLTH0E10890g Chr5 complement(976948..978717) [1770 bp, 589 aa] {...   126   2e-29
Ecym_8358 Chr8 (719978..721687) [1710 bp, 569 aa] {ON} similar t...   126   2e-29
KAFR0E02810 Chr5 complement(567875..569581) [1707 bp, 568 aa] {O...   126   2e-29
KLLA0C17424g Chr3 (1529941..1531680) [1740 bp, 579 aa] {ON} simi...   126   3e-29
TBLA0B07950 Chr2 complement(1884315..1885496) [1182 bp, 393 aa] ...   122   5e-29
KLTH0H08646g Chr8 (750413..752113) [1701 bp, 566 aa] {ON} highly...   125   6e-29
KAFR0D01120 Chr4 complement(222704..224536) [1833 bp, 610 aa] {O...   125   6e-29
KLLA0A10659g Chr1 complement(927059..928255) [1197 bp, 398 aa] {...   121   1e-28
TPHA0D00940 Chr4 complement(186966..188678) [1713 bp, 570 aa] {O...   124   1e-28
NCAS0A05470 Chr1 (1077464..1079413) [1950 bp, 649 aa] {ON} Anc_6...   124   2e-28
Kpol_274.7 s274 complement(11790..13502) [1713 bp, 570 aa] {ON} ...   122   4e-28
KLLA0E14367g Chr5 (1268901..1270691) [1791 bp, 596 aa] {ON} simi...   121   8e-28
Ecym_5095 Chr5 (213368..214684) [1317 bp, 438 aa] {ON} similar t...   119   9e-28
KAFR0B02030 Chr2 complement(397276..398991) [1716 bp, 571 aa] {O...   121   1e-27
KLTH0D03190g Chr4 complement(306459..308609) [2151 bp, 716 aa] {...   122   1e-27
SAKL0H11968g Chr8 (1022452..1024152) [1701 bp, 566 aa] {ON} simi...   120   1e-27
NDAI0C06300 Chr3 complement(1459510..1461354) [1845 bp, 614 aa] ...   120   2e-27
ZYRO0C11660g Chr3 (912287..913594) [1308 bp, 435 aa] {ON} highly...   118   2e-27
Suva_11.256 Chr11 complement(469196..471424) [2229 bp, 742 aa] {...   121   2e-27
KAFR0C04690 Chr3 (934039..935928) [1890 bp, 629 aa] {ON} Anc_6.3...   120   3e-27
ZYRO0B05852g Chr2 (468295..470550) [2256 bp, 751 aa] {ON} simila...   120   5e-27
NDAI0A05860 Chr1 complement(1331381..1332580) [1200 bp, 399 aa] ...   116   6e-27
TPHA0H01160 Chr8 (257728..259029) [1302 bp, 433 aa] {ON} Anc_5.6...   116   7e-27
TDEL0B01670 Chr2 (297786..299525) [1740 bp, 579 aa] {ON}              118   7e-27
Ecym_4755 Chr4 complement(1469426..1470622) [1197 bp, 398 aa] {O...   115   1e-26
TBLA0E03420 Chr5 (846796..849024) [2229 bp, 742 aa] {ON} Anc_3.1...   119   1e-26
SAKL0D03960g Chr4 complement(321960..323156) [1197 bp, 398 aa] {...   114   2e-26
TDEL0D03760 Chr4 complement(689455..690651) [1197 bp, 398 aa] {O...   114   2e-26
KNAG0L00410 Chr12 complement(57484..59325) [1842 bp, 613 aa] {ON...   117   2e-26
KNAG0H01370 Chr8 complement(243799..244995) [1197 bp, 398 aa] {O...   114   3e-26
Suva_14.394 Chr14 (676747..678666) [1920 bp, 639 aa] {ON} YNR038...   116   5e-26
NCAS0A10430 Chr1 (2073293..2074492) [1200 bp, 399 aa] {ON} Anc_3...   113   7e-26
TPHA0M00900 Chr13 (175733..176935) [1203 bp, 400 aa] {ON} Anc_3....   112   8e-26
AGL004C Chr7 complement(715482..717410) [1929 bp, 642 aa] {ON} S...   115   9e-26
Kpol_1036.3 s1036 complement(10496..11695) [1200 bp, 399 aa] {ON...   112   9e-26
TPHA0C01860 Chr3 (425216..427039) [1824 bp, 607 aa] {ON} Anc_8.4...   115   1e-25
KAFR0E01160 Chr5 (232985..234202) [1218 bp, 405 aa] {ON} Anc_3.2...   112   1e-25
TPHA0D00770 Chr4 (155185..157002) [1818 bp, 605 aa] {ON} Anc_8.8...   114   1e-25
TBLA0D02800 Chr4 (686898..688661) [1764 bp, 587 aa] {ON} Anc_8.4...   114   1e-25
YDR021W Chr4 (486804..488003) [1200 bp, 399 aa] {ON}  FAL1Nucleo...   111   2e-25
CAGL0A03652g Chr1 complement(373100..375301) [2202 bp, 733 aa] {...   115   2e-25
Suva_2.171 Chr2 (297542..298741) [1200 bp, 399 aa] {ON} YDR021W ...   111   2e-25
TPHA0K01120 Chr11 (235339..237153) [1815 bp, 604 aa] {ON} Anc_6....   113   3e-25
Smik_12.355 Chr12 complement(633462..635246) [1785 bp, 594 aa] {...   113   3e-25
Ecym_6049 Chr6 (94618..95934) [1317 bp, 438 aa] {ON} similar to ...   111   4e-25
Kpol_1007.10 s1007 complement(17289..19106) [1818 bp, 605 aa] {O...   113   4e-25
Suva_10.374 Chr10 complement(655832..657616) [1785 bp, 594 aa] {...   113   4e-25
YLR276C Chr12 complement(695046..696830) [1785 bp, 594 aa] {ON} ...   113   4e-25
KLTH0C07964g Chr3 complement(679877..681073) [1197 bp, 398 aa] {...   110   5e-25
Smik_4.255 Chr4 (467483..468682) [1200 bp, 399 aa] {ON} YDR021W ...   110   5e-25
SAKL0B02794g Chr2 complement(266645..268441) [1797 bp, 598 aa] {...   112   7e-25
ADR260C Chr4 complement(1152257..1153573) [1317 bp, 438 aa] {ON}...   110   8e-25
Skud_4.273 Chr4 (477488..478687) [1200 bp, 399 aa] {ON} YDR021W ...   109   9e-25
KLTH0H15686g Chr8 complement(1353647..1354725,1354841..1355081) ...   110   1e-24
Suva_4.163 Chr4 (294691..296031) [1341 bp, 446 aa] {ON} YDL084W ...   110   1e-24
Smik_4.152 Chr4 (281728..283068) [1341 bp, 446 aa] {ON} YDL084W ...   110   1e-24
NDAI0C05120 Chr3 complement(1191160..1193046) [1887 bp, 628 aa] ...   112   1e-24
YDL084W Chr4 (305237..306577) [1341 bp, 446 aa] {ON}  SUB2Compon...   110   1e-24
Skud_4.171 Chr4 (300716..302056) [1341 bp, 446 aa] {ON} YDL084W ...   109   1e-24
KLLA0E21935g Chr5 (1959770..1961083) [1314 bp, 437 aa] {ON} high...   109   2e-24
TDEL0H01300 Chr8 (221815..223962) [2148 bp, 715 aa] {ON} Anc_1.2...   111   2e-24
TDEL0D05010 Chr4 (911771..914023) [2253 bp, 750 aa] {ON} Anc_3.1...   111   2e-24
CAGL0L06908g Chr12 complement(779554..780873) [1320 bp, 439 aa] ...   109   2e-24
TDEL0G03990 Chr7 (726319..728085) [1767 bp, 588 aa] {ON} Anc_6.7...   110   2e-24
KNAG0K01980 Chr11 (405216..407381) [2166 bp, 721 aa] {ON} Anc_3....   111   3e-24
Skud_12.359 Chr12 complement(636149..637930) [1782 bp, 593 aa] {...   110   3e-24
KAFR0G01440 Chr7 complement(319146..321305) [2160 bp, 719 aa] {O...   111   3e-24
SAKL0A08118g Chr1 (718720..720564) [1845 bp, 614 aa] {ON} highly...   110   4e-24
NDAI0E01750 Chr5 complement(346153..347505) [1353 bp, 450 aa] {O...   108   5e-24
AER408W Chr5 (1418694..1419890) [1197 bp, 398 aa] {ON} Syntenic ...   107   5e-24
ZYRO0A08272g Chr1 (665522..666853) [1332 bp, 443 aa] {ON} highly...   107   6e-24
KLLA0C11253g Chr3 complement(967067..969457) [2391 bp, 796 aa] {...   110   8e-24
TDEL0G03140 Chr7 (587922..589256) [1335 bp, 444 aa] {ON} Anc_2.3...   107   1e-23
NDAI0A06900 Chr1 (1578643..1580622) [1980 bp, 659 aa] {ON} Anc_3...   109   1e-23
KAFR0A04960 Chr1 (981797..983572) [1776 bp, 591 aa] {ON} Anc_6.7...   108   1e-23
KAFR0F02940 Chr6 (582057..583388) [1332 bp, 443 aa] {ON} Anc_2.3...   106   1e-23
NCAS0A03950 Chr1 (799925..801265) [1341 bp, 446 aa] {ON} Anc_2.384    106   2e-23
Kpol_1058.53 s1058 complement(136863..138191) [1329 bp, 442 aa] ...   106   2e-23
SAKL0C10296g Chr3 complement(927939..930377) [2439 bp, 812 aa] {...   108   2e-23
KNAG0K00400 Chr11 (69795..71093) [1299 bp, 432 aa] {ON} Anc_5.69...   105   3e-23
NCAS0I02320 Chr9 (437124..439319) [2196 bp, 731 aa] {ON} Anc_3.1...   108   3e-23
Kpol_1041.33 s1041 complement(82855..84180) [1326 bp, 441 aa] {O...   105   3e-23
Smik_2.282 Chr2 (512869..515271) [2403 bp, 800 aa] {ON} YBR142W ...   108   3e-23
KLLA0C04576g Chr3 complement(417217..419001) [1785 bp, 594 aa] {...   107   3e-23
TBLA0B08880 Chr2 complement(2108994..2110322) [1329 bp, 442 aa] ...   105   5e-23
Kpol_1036.17 s1036 (45392..47683) [2292 bp, 763 aa] {ON} (45392....   107   6e-23
TPHA0G02585 Chr7 (535997..537313) [1317 bp, 438 aa] {ON}              104   7e-23
TPHA0G02050 Chr7 (420332..421648) [1317 bp, 438 aa] {ON} Anc_2.3...   104   7e-23
ZYRO0D14388g Chr4 complement(1218001..1219752) [1752 bp, 583 aa]...   105   8e-23
Suva_4.392 Chr4 (697442..699823) [2382 bp, 793 aa] {ON} YBR142W ...   106   1e-22
YBR142W Chr2 (528317..530638) [2322 bp, 773 aa] {ON}  MAK5Essent...   106   1e-22
SAKL0E05148g Chr5 complement(419901..420979,421045..421372) [140...   104   1e-22
Kwal_56.23164 s56 (430116..432539) [2424 bp, 807 aa] {ON} YBR142...   105   2e-22
Skud_15.210 Chr15 complement(374410..375858) [1449 bp, 482 aa] {...   103   2e-22
KLTH0G15224g Chr7 (1332767..1334557) [1791 bp, 596 aa] {ON} high...   104   2e-22
KNAG0F03020 Chr6 complement(572005..573801) [1797 bp, 598 aa] {O...   104   3e-22
Kpol_1016.14 s1016 complement(36309..38507) [2199 bp, 732 aa] {O...   104   3e-22
YOR046C Chr15 complement(414459..415907) [1449 bp, 482 aa] {ON} ...   103   3e-22
Suva_8.98 Chr8 complement(177272..178720) [1449 bp, 482 aa] {ON}...   103   3e-22
TPHA0M00750 Chr13 complement(141794..144082) [2289 bp, 762 aa] {...   104   4e-22
Smik_15.224 Chr15 complement(380539..381972) [1434 bp, 477 aa] {...   102   6e-22
Kwal_56.23291 s56 complement(479073..480842) [1770 bp, 589 aa] {...   103   6e-22
Skud_2.270 Chr2 (496096..498402) [2307 bp, 768 aa] {ON} YBR142W ...   103   1e-21
NCAS0D02940 Chr4 complement(558088..559923) [1836 bp, 611 aa] {O...   102   2e-21
AER027W Chr5 (685709..687967) [2259 bp, 752 aa] {ON} Syntenic ho...   102   2e-21
TPHA0J01230 Chr10 complement(289735..291210) [1476 bp, 491 aa] {...   100   2e-21
NDAI0I01960 Chr9 (457199..459025) [1827 bp, 608 aa] {ON} Anc_6.73     101   3e-21
KLTH0G15840g Chr7 complement(1381355..1383748) [2394 bp, 797 aa]...   101   3e-21
KNAG0B03010 Chr2 (582008..583489) [1482 bp, 493 aa] {ON} Anc_5.6...   100   4e-21
Kwal_56.22971 s56 (351639..352331) [693 bp, 230 aa] {ON} YDR021W...    95   6e-21
Kpol_473.7 s473 complement(21177..22613) [1437 bp, 478 aa] {ON} ...    99   7e-21
KLLA0F15950g Chr6 (1477113..1478522) [1410 bp, 469 aa] {ON} simi...    99   7e-21
CAGL0F04983g Chr6 complement(507217..509004) [1788 bp, 595 aa] {...    99   2e-20
NCAS0G00610 Chr7 (105992..107407) [1416 bp, 471 aa] {ON} Anc_5.643     97   3e-20
SAKL0D05258g Chr4 complement(416100..418247) [2148 bp, 715 aa] {...    97   8e-20
TDEL0B02800 Chr2 (504332..505726) [1395 bp, 464 aa] {ON} Anc_5.6...    96   8e-20
TBLA0D05490 Chr4 (1352976..1355243) [2268 bp, 755 aa] {ON}             97   8e-20
AGR278C Chr7 complement(1261914..1263701) [1788 bp, 595 aa] {ON}...    97   9e-20
KAFR0C06090 Chr3 complement(1208993..1210417) [1425 bp, 474 aa] ...    96   9e-20
TPHA0B01270 Chr2 complement(283532..285754) [2223 bp, 740 aa] {O...    97   1e-19
ZYRO0B15576g Chr2 complement(1265375..1266850) [1476 bp, 491 aa]...    96   1e-19
Ecym_5488 Chr5 (998651..1000099) [1449 bp, 482 aa] {ON} similar ...    95   1e-19
Ecym_5326 Chr5 (663464..665737) [2274 bp, 757 aa] {ON} similar t...    96   2e-19
TBLA0J00890 Chr10 complement(199404..200900) [1497 bp, 498 aa] {...    95   2e-19
KLLA0F13926g Chr6 complement(1290006..1292228) [2223 bp, 740 aa]...    96   2e-19
KLTH0F17050g Chr6 complement(1380459..1381888,1381971..1381977) ...    94   2e-19
Kpol_1028.29 s1028 complement(76405..78318) [1914 bp, 637 aa] {O...    95   3e-19
KNAG0C01480 Chr3 complement(294677..296947) [2271 bp, 756 aa] {O...    95   3e-19
TBLA0A09740 Chr1 complement(2393212..2395065) [1854 bp, 617 aa] ...    95   3e-19
TBLA0B09205 Chr2 (2175882..2177243) [1362 bp, 453 aa] {ON}             93   5e-19
Skud_11.257 Chr11 complement(465439..467658) [2220 bp, 739 aa] {...    94   5e-19
KNAG0D00300 Chr4 complement(40830..42743) [1914 bp, 637 aa] {ON}...    94   8e-19
AFR082C Chr6 complement(576175..578307) [2133 bp, 710 aa] {ON} S...    94   1e-18
Kwal_55.21609 s55 complement(912148..913269) [1122 bp, 373 aa] {...    91   1e-18
CAGL0L03047g Chr12 (352032..354179) [2148 bp, 715 aa] {ON} simil...    92   2e-18
Ecym_6354 Chr6 (686603..688819) [2217 bp, 738 aa] {ON} similar t...    92   3e-18
Ecym_2514 Chr2 (1000911..1002773) [1863 bp, 620 aa] {ON} similar...    91   4e-18
NDAI0K02300 Chr11 (514779..516908) [2130 bp, 709 aa] {ON} Anc_6....    92   4e-18
NCAS0B07760 Chr2 (1469599..1471845) [2247 bp, 748 aa] {ON} Anc_1...    92   4e-18
Kwal_26.7302 s26 complement(304411..306555) [2145 bp, 714 aa] {O...    91   5e-18
YKR024C Chr11 complement(485144..487372) [2229 bp, 742 aa] {ON} ...    91   9e-18
CAGL0G07975g Chr7 (752176..754131) [1956 bp, 651 aa] {ON} simila...    90   9e-18
KAFR0A03450 Chr1 complement(708114..710348) [2235 bp, 744 aa] {O...    90   1e-17
TPHA0M01940 Chr13 (401463..403469) [2007 bp, 668 aa] {ON} Anc_6....    90   1e-17
ZYRO0F01826g Chr6 complement(149490..151799) [2310 bp, 769 aa] {...    89   2e-17
Smik_11.281 Chr11 complement(472555..474783) [2229 bp, 742 aa] {...    89   3e-17
TDEL0A07700 Chr1 (1338381..1340264) [1884 bp, 627 aa] {ON} Anc_6...    87   7e-17
Kwal_23.6387 s23 (1558522..1560468) [1947 bp, 648 aa] {ON} YNR03...    87   8e-17
NDAI0B05110 Chr2 (1249929..1252217) [2289 bp, 762 aa] {ON} Anc_1...    87   9e-17
AGL225C Chr7 complement(275826..277649) [1824 bp, 607 aa] {ON} S...    87   1e-16
TBLA0F04210 Chr6 (1034478..1036397) [1920 bp, 639 aa] {ON} Anc_6...    84   1e-15
NCAS0D04130 Chr4 (779645..781408) [1764 bp, 587 aa] {ON} Anc_6.223     83   1e-15
KLTH0H03960g Chr8 (361653..363323) [1671 bp, 556 aa] {ON} simila...    82   3e-15
Smik_14.369 Chr14 (653538..655427) [1890 bp, 629 aa] {ON} YNR038...    82   3e-15
KLTH0A07084g Chr1 (587692..589578) [1887 bp, 628 aa] {ON} simila...    82   3e-15
YNR038W Chr14 (695595..697484) [1890 bp, 629 aa] {ON}  DBP6Essen...    82   4e-15
ZYRO0C12012g Chr3 (936848..938722) [1875 bp, 624 aa] {ON} simila...    82   4e-15
AFR452C Chr6 complement(1250342..1251203) [862 bp, 287.333333333...    76   3e-14
Agos_YGOB_AFR452C Chr6 complement(1250310..1251203) [894 bp, 298...    76   3e-14
NDAI0I00790 Chr9 complement(175765..177567) [1803 bp, 600 aa] {O...    77   9e-14
Kwal_34.15835 s34 (79657..80592) [936 bp, 311 aa] {ON} YOR204W (...    74   2e-13
CAGL0M05753g Chr13 complement(610837..612543) [1707 bp, 568 aa] ...    75   4e-13
Skud_14.371 Chr14 (663742..665631) [1890 bp, 629 aa] {ON} YNR038...    75   5e-13
Ecym_2193 Chr2 (379905..381545) [1641 bp, 546 aa] {ON} similar t...    73   2e-12
Suva_114.1 Chr114 complement(3..506) [504 bp, 168 aa] {ON} YKR05...    67   7e-12
Kpol_1002.46 s1002 (135310..136929) [1620 bp, 539 aa] {ON} (1353...    71   7e-12
Smik_7.216 Chr7 complement(376052..377737) [1686 bp, 561 aa] {ON...    71   8e-12
SAKL0A04224g Chr1 (394175..395896) [1722 bp, 573 aa] {ON} simila...    71   8e-12
TDEL0E05320 Chr5 complement(973951..975570) [1620 bp, 539 aa] {O...    70   1e-11
KLLA0B02310g Chr2 (205046..206800) [1755 bp, 584 aa] {ON} simila...    70   2e-11
Skud_7.216 Chr7 complement(384838..386586) [1749 bp, 582 aa] {ON...    69   5e-11
YGL064C Chr7 complement(381523..383208) [1686 bp, 561 aa] {ON}  ...    68   5e-11
Suva_7.205 Chr7 complement(374687..376435) [1749 bp, 582 aa] {ON...    67   1e-10
Kwal_56.22974 s56 (352370..352837) [468 bp, 155 aa] {OFF} YPL119...    63   1e-10
TPHA0J02440 Chr10 complement(537553..539259) [1707 bp, 568 aa] {...    67   1e-10
AFL102W Chr6 (247419..249083) [1665 bp, 554 aa] {ON} Syntenic ho...    67   1e-10
Kwal_56.24094 s56 complement(846901..848571) [1671 bp, 556 aa] {...    66   3e-10
ZYRO0E07040g Chr5 complement(532475..534094) [1620 bp, 539 aa] {...    65   3e-10
KAFR0K02330 Chr11 complement(477370..478992) [1623 bp, 540 aa] {...    64   2e-09
TBLA0A06180 Chr1 (1518694..1520301) [1608 bp, 535 aa] {ON} Anc_6...    62   6e-09
Kpol_1009.3 s1009 complement(4730..6169) [1440 bp, 479 aa] {ON} ...    59   3e-08
KNAG0F01930 Chr6 (371697..373379) [1683 bp, 560 aa] {ON} Anc_6.2...    54   1e-06
Suva_2.502 Chr2 (888423..890483) [2061 bp, 686 aa] {ON} YDR332W ...    47   2e-04
YDR332W Chr4 (1131001..1133070) [2070 bp, 689 aa] {ON}  IRC3Puta...    47   3e-04
Kwal_47.19313 s47 complement(1186091..1189306) [3216 bp, 1071 aa...    47   3e-04
Skud_4.599 Chr4 (1067036..1069102) [2067 bp, 688 aa] {ON} YDR332...    46   4e-04
TDEL0E02500 Chr5 complement(483905..485878) [1974 bp, 657 aa] {O...    46   5e-04
TPHA0G03720 Chr7 (787108..790563) [3456 bp, 1151 aa] {ON} Anc_3....    46   6e-04
Kpol_365.4 s365 (7095..9170) [2076 bp, 691 aa] {ON} (7095..9170)...    45   7e-04
NDAI0C04460 Chr3 (1012182..1014188) [2007 bp, 668 aa] {ON} Anc_5...    44   0.001
Kwal_14.2171 s14 (643215..643973) [759 bp, 252 aa] {ON} YOR204W ...    44   0.001
KLLA0D12694g Chr4 (1079740..1083843) [4104 bp, 1367 aa] {ON} sim...    45   0.002
KNAG0C05350 Chr3 complement(1044926..1047028) [2103 bp, 700 aa] ...    43   0.005
CAGL0J01980g Chr10 (196812..199970) [3159 bp, 1052 aa] {ON} simi...    43   0.006
TPHA0H01510 Chr8 (340988..343018) [2031 bp, 676 aa] {ON} Anc_5.3...    42   0.006
NCAS0E00200 Chr5 complement(26080..29448) [3369 bp, 1122 aa] {ON...    42   0.007
CAGL0C02563g Chr3 (259114..262965) [3852 bp, 1283 aa] {ON} simil...    42   0.007
AFL159W Chr6 (134254..137706) [3453 bp, 1150 aa] {ON} Syntenic h...    42   0.010
TBLA0H01810 Chr8 complement(426223..428346) [2124 bp, 707 aa] {O...    42   0.010
Kpol_1029.1 s1029 (145..148,407..774) [372 bp, 123 aa] {OFF} (14...    39   0.011
Suva_9.211 Chr9 complement(344361..347336) [2976 bp, 991 aa] {ON...    42   0.012
Smik_4.592 Chr4 (1057406..1059475) [2070 bp, 689 aa] {ON} YDR332...    42   0.012
Skud_9.179 Chr9 complement(328238..331216) [2979 bp, 992 aa] {ON...    42   0.012
KLTH0E03630g Chr5 complement(327367..329385) [2019 bp, 672 aa] {...    41   0.013
Kwal_55.20938 s55 complement(617612..618622) [1011 bp, 336 aa] {...    41   0.014
YIR002C Chr9 complement(357415..360396) [2982 bp, 993 aa] {ON}  ...    41   0.014
NCAS0F03010 Chr6 (598773..600782) [2010 bp, 669 aa] {ON} Anc_5.3...    41   0.015
Kwal_55.20185 s55 complement(286058..288073) [2016 bp, 671 aa] {...    41   0.017
KLLA0D13552g Chr4 (1167629..1170655) [3027 bp, 1008 aa] {ON} sim...    41   0.018
TPHA0I02220 Chr9 (496020..499136) [3117 bp, 1038 aa] {ON} Anc_7....    41   0.020
Smik_9.201 Chr9 complement(333404..336379) [2976 bp, 991 aa] {ON...    41   0.022
KLLA0E17095g Chr5 (1519323..1521395) [2073 bp, 690 aa] {ON} simi...    40   0.024
TBLA0A06360 Chr1 (1561496..1565389) [3894 bp, 1297 aa] {ON} Anc_...    40   0.027
KLTH0F13310g Chr6 complement(1090990..1094076) [3087 bp, 1028 aa...    40   0.029
NDAI0J02330 Chr10 complement(564963..568895) [3933 bp, 1310 aa] ...    40   0.029
Kwal_23.4187 s23 (607525..611301) [3777 bp, 1258 aa] {ON} YLR398...    40   0.029
TBLA0E00120 Chr5 complement(11340..15049,15149..15332) [3894 bp,...    40   0.030
Ecym_3257 Chr3 (491150..494974) [3825 bp, 1274 aa] {ON} similar ...    40   0.031
NDAI0B01020 Chr2 (236444..239377) [2934 bp, 977 aa] {ON} Anc_7.1...    40   0.036
Ecym_2138 Chr2 (256787..260971) [4185 bp, 1394 aa] {ON} similar ...    40   0.037
NCAS0J01560 Chr10 complement(276723..280619) [3897 bp, 1298 aa] ...    40   0.037
NCAS0A13190 Chr1 complement(2593419..2596559) [3141 bp, 1046 aa]...    40   0.037
Kpol_1055.74 s1055 (201332..205156) [3825 bp, 1274 aa] {ON} (201...    40   0.048
SAKL0G08228g Chr7 complement(700095..702248) [2154 bp, 717 aa] {...    39   0.050
SAKL0D06622g Chr4 complement(544709..547954) [3246 bp, 1081 aa] ...    40   0.050
Kpol_1018.31 s1018 (87697..91695) [3999 bp, 1332 aa] {ON} (87697...    40   0.050
TPHA0B02170 Chr2 (503118..506930) [3813 bp, 1270 aa] {ON} Anc_4....    40   0.050
Skud_10.145 Chr10 complement(273285..276482) [3198 bp, 1065 aa] ...    39   0.059
KAFR0A05880 Chr1 (1191511..1195341) [3831 bp, 1276 aa] {ON} Anc_...    39   0.066
ZYRO0B12650g Chr2 complement(1017101..1020862) [3762 bp, 1253 aa...    39   0.081
TDEL0H03170 Chr8 complement(522372..525392) [3021 bp, 1006 aa] {...    39   0.083
TDEL0E01090 Chr5 (222389..226162) [3774 bp, 1257 aa] {ON} Anc_4....    39   0.083
CAGL0L00407g Chr12 (42659..46774) [4116 bp, 1371 aa] {ON} simila...    39   0.084
SAKL0A02904g Chr1 (263239..267465) [4227 bp, 1408 aa] {ON} simil...    39   0.085
YJL050W Chr10 (342522..345743) [3222 bp, 1073 aa] {ON}  MTR4ATP-...    39   0.095
KNAG0B06170 Chr2 complement(1212229..1216080) [3852 bp, 1283 aa]...    39   0.11 
KAFR0A07190 Chr1 complement(1453748..1457704) [3957 bp, 1318 aa]...    39   0.11 
Ecym_8005 Chr8 (9383..11551) [2169 bp, 722 aa] {ON} similar to A...    38   0.12 
NCAS0G01110 Chr7 (196418..199387) [2970 bp, 989 aa] {ON} Anc_6.278     38   0.12 
Suva_6.125 Chr6 complement(206404..209610) [3207 bp, 1068 aa] {O...    38   0.14 
Kpol_328.1 s328 complement(673..3711) [3039 bp, 1012 aa] {ON} co...    38   0.15 
TBLA0J01920 Chr10 (455227..458469) [3243 bp, 1080 aa] {ON} Anc_7...    38   0.15 
Suva_10.515 Chr10 complement(880776..884624) [3849 bp, 1282 aa] ...    38   0.16 
YMR190C Chr13 complement(640915..645258) [4344 bp, 1447 aa] {ON}...    38   0.16 
KLTH0D14630g Chr4 complement(1193537..1197340) [3804 bp, 1267 aa...    38   0.17 
Ecym_4473 Chr4 (962193..965228) [3036 bp, 1011 aa] {ON} similar ...    38   0.18 
SAKL0H02706g Chr8 (268843..272661) [3819 bp, 1272 aa] {ON} simil...    37   0.22 
YLR398C Chr12 complement(915156..919019) [3864 bp, 1287 aa] {ON}...    37   0.23 
KAFR0K01070 Chr11 (221301..224285) [2985 bp, 994 aa] {ON} Anc_7....    37   0.24 
Skud_12.483 Chr12 complement(855363..859226) [3864 bp, 1287 aa] ...    37   0.25 
Smik_12.485 Chr12 complement(853862..857722) [3861 bp, 1286 aa] ...    37   0.25 
Kwal_56.24359 s56 complement(966614..970789) [4176 bp, 1391 aa] ...    37   0.28 
ZYRO0G03938g Chr7 (318186..321206) [3021 bp, 1006 aa] {ON} simil...    37   0.41 
Suva_13.371 Chr13 complement(621139..625512) [4374 bp, 1457 aa] ...    37   0.47 
AER067C Chr5 complement(757163..761011) [3849 bp, 1282 aa] {ON} ...    36   0.49 
KNAG0E03530 Chr5 (705077..708016) [2940 bp, 979 aa] {ON} Anc_7.1...    36   0.50 
Smik_13.395 Chr13 complement(625338..629669) [4332 bp, 1443 aa] ...    36   0.51 
ADR011C Chr4 complement(721693..724926) [3234 bp, 1077 aa] {ON} ...    36   0.59 
KNAG0A02330 Chr1 (219856..222081) [2226 bp, 741 aa] {ON} Anc_8.4...    35   0.75 
KAFR0F01050 Chr6 (198407..201028) [2622 bp, 873 aa] {ON} Anc_6.2...    35   0.88 
NDAI0F01230 Chr6 (299153..302485) [3333 bp, 1110 aa] {ON} Anc_6....    35   0.99 
ZYRO0D10802g Chr4 (911004..912956) [1953 bp, 650 aa] {ON} simila...    35   1.0  
ADR302W Chr4 (1227985..1230060) [2076 bp, 691 aa] {ON} Syntenic ...    35   1.0  
KLTH0H02706g Chr8 (238367..242578) [4212 bp, 1403 aa] {ON} simil...    35   1.0  
KNAG0D00680 Chr4 complement(102336..104981) [2646 bp, 881 aa] {O...    35   1.1  
TBLA0A02320 Chr1 complement(559955..564205) [4251 bp, 1416 aa] {...    35   1.2  
TPHA0H01970 Chr8 complement(462534..466601) [4068 bp, 1355 aa] {...    35   1.2  
SAKL0F04532g Chr6 (365436..368558) [3123 bp, 1040 aa] {ON} simil...    35   1.2  
SAKL0F00528g Chr6 complement(46584..50141) [3558 bp, 1185 aa] {O...    35   1.3  
Ecym_2529 Chr2 complement(1029384..1031567) [2184 bp, 727 aa] {O...    35   1.5  
KLLA0D11462g Chr4 (982040..985303) [3264 bp, 1087 aa] {ON} simil...    35   1.6  
KAFR0D04360 Chr4 complement(858295..860295) [2001 bp, 666 aa] {O...    34   1.8  
SAKL0H11682g Chr8 (996881..999202) [2322 bp, 773 aa] {ON} simila...    34   2.2  
TPHA0L01260 Chr12 complement(266868..269087) [2220 bp, 739 aa] {...    34   2.4  
ZYRO0A02706g Chr1 (218642..220858) [2217 bp, 738 aa] {ON} simila...    34   2.9  
Suva_16.288 Chr16 (498851..501064) [2214 bp, 737 aa] {ON} YPL029...    33   4.0  
Ecym_6004 Chr6 complement(9579..12797) [3219 bp, 1072 aa] {ON} s...    33   4.5  
CAGL0M01276g Chr13 complement(144593..146641) [2049 bp, 682 aa] ...    33   4.7  
KAFR0J00770 Chr10 (141864..144299) [2436 bp, 811 aa] {ON} Anc_2....    33   5.4  
NCAS0A07940 Chr1 complement(1573937..1574740) [804 bp, 267 aa] {...    32   6.3  
KLTH0E11176g Chr5 complement(1001391..1003625) [2235 bp, 744 aa]...    32   7.1  
SAKL0H05346g Chr8 (480397..482379) [1983 bp, 660 aa] {ON} simila...    32   7.3  
CAGL0H00759g Chr8 (74843..76999) [2157 bp, 718 aa] {ON} similar ...    32   7.6  
NDAI0B02280 Chr2 complement(567453..574025) [6573 bp, 2190 aa] {...    32   7.7  
YPL029W Chr16 (495506..497719) [2214 bp, 737 aa] {ON}  SUV3ATP-d...    32   8.8  
NDAI0G05430 Chr7 (1330372..1332813) [2442 bp, 813 aa] {ON} Anc_1...    32   9.2  
Smik_16.206 Chr16 (372765..374978) [2214 bp, 737 aa] {ON} YPL029...    32   9.3  

>SAKL0C08778g Chr3 (804617..807628) [3012 bp, 1003 aa] {ON} similar to
            uniprot|Q12389 Saccharomyces cerevisiae YDL031W DBP10
            Essential protein involved in ribosome biogenesis
            putative ATP-dependent RNA helicase of the DEAD- box
            protein family
          Length = 1003

 Score = 1654 bits (4284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 845/1003 (84%), Positives = 845/1003 (84%)

Query: 1    MGSTSLKRKRESNNPSVXXXXXXXDVFDIAGDIALXXXXXXXXXXXXXXXXXXXXXXXVI 60
            MGSTSLKRKRESNNPSV       DVFDIAGDIAL                       VI
Sbjct: 1    MGSTSLKRKRESNNPSVEEEEEEEDVFDIAGDIALDSSEDDDDDDDDGEQDSEQEVQDVI 60

Query: 61   EFSDGEEXXXXXXXXXXXXXXXXXXXXXXXXPRPSFPTLELSXXXXXXXXXXXXXVNDYF 120
            EFSDGEE                        PRPSFPTLELS             VNDYF
Sbjct: 61   EFSDGEEQGKKNQSKGAAKSAAKGNSKGAKQPRPSFPTLELSDAEDEAPDADKDAVNDYF 120

Query: 121  SXXXXXXXXXXXXXXXXXXXXXXXILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMART 180
            S                       ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMART
Sbjct: 121  STTAAAAAGKHKKGSFPSFGFSKFILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMART 180

Query: 181  GSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTG 240
            GSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTG
Sbjct: 181  GSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTG 240

Query: 241  GDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLN 300
            GDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLN
Sbjct: 241  GDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLN 300

Query: 301  ELLAALPPTRQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGE 360
            ELLAALPPTRQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGE
Sbjct: 301  ELLAALPPTRQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGE 360

Query: 361  REANLLYLLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPS 420
            REANLLYLLQEVIRIPVATAEQLKQLRAL                            MPS
Sbjct: 361  REANLLYLLQEVIRIPVATAEQLKQLRALNDRSDSDADSDANDKNDRKKRKKQARRKMPS 420

Query: 421  ANELPSEKATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSI 480
            ANELPSEKATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSI
Sbjct: 421  ANELPSEKATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSI 480

Query: 481  LVVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXX 540
            LVVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS        
Sbjct: 481  LVVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSENELPYLL 540

Query: 541  XXXXXXGKKILLAPMYDATCELMRKQWVAEGKQESEFVAPRVSYTNRMVLGSCPRLEMES 600
                  GKKILLAPMYDATCELMRKQWVAEGKQESEFVAPRVSYTNRMVLGSCPRLEMES
Sbjct: 541  DLELFLGKKILLAPMYDATCELMRKQWVAEGKQESEFVAPRVSYTNRMVLGSCPRLEMES 600

Query: 601  MGDLYKNLVESSFDLQLLKSVALKAEKLYFRTRAPASTEAMKRSKEIIASGWDEQNLKFG 660
            MGDLYKNLVESSFDLQLLKSVALKAEKLYFRTRAPASTEAMKRSKEIIASGWDEQNLKFG
Sbjct: 601  MGDLYKNLVESSFDLQLLKSVALKAEKLYFRTRAPASTEAMKRSKEIIASGWDEQNLKFG 660

Query: 661  KNLEKEKLDFLAKLQNRNHKETVFEFARNQEDEMAVLMXXXXXXXXXXXXXXXERQELLE 720
            KNLEKEKLDFLAKLQNRNHKETVFEFARNQEDEMAVLM               ERQELLE
Sbjct: 661  KNLEKEKLDFLAKLQNRNHKETVFEFARNQEDEMAVLMRRRRRQIAPIQRKARERQELLE 720

Query: 721  KERMAGLRHTLEDEVLKGGDGEFGYSVPEEVLAQEFEDADKILDEQENKKKTKTMKTRQG 780
            KERMAGLRHTLEDEVLKGGDGEFGYSVPEEVLAQEFEDADKILDEQENKKKTKTMKTRQG
Sbjct: 721  KERMAGLRHTLEDEVLKGGDGEFGYSVPEEVLAQEFEDADKILDEQENKKKTKTMKTRQG 780

Query: 781  ETXXXXXXXXXXXTYKDPNFFLSHYAPAGDIQDKQLQLTSGFTNDAADATFDLHDDNKVQ 840
            ET           TYKDPNFFLSHYAPAGDIQDKQLQLTSGFTNDAADATFDLHDDNKVQ
Sbjct: 781  ETKPKPKPKPKPKTYKDPNFFLSHYAPAGDIQDKQLQLTSGFTNDAADATFDLHDDNKVQ 840

Query: 841  VHKQTATVKWDKKRKKYVNAQGLDNKKYIIGESGQKIPASFRSGKFAEWSKARKLGPLKV 900
            VHKQTATVKWDKKRKKYVNAQGLDNKKYIIGESGQKIPASFRSGKFAEWSKARKLGPLKV
Sbjct: 841  VHKQTATVKWDKKRKKYVNAQGLDNKKYIIGESGQKIPASFRSGKFAEWSKARKLGPLKV 900

Query: 901  GARETSGPSNLLSDPASGGRRVAGGRFKHKLDKAPKLPDRHRDDYKTQQKKVANALERGI 960
            GARETSGPSNLLSDPASGGRRVAGGRFKHKLDKAPKLPDRHRDDYKTQQKKVANALERGI
Sbjct: 901  GARETSGPSNLLSDPASGGRRVAGGRFKHKLDKAPKLPDRHRDDYKTQQKKVANALERGI 960

Query: 961  SVKGFGAPGAKSEMKSTEQIRSQRVAKDKRLAKNARPSKKRKF 1003
            SVKGFGAPGAKSEMKSTEQIRSQRVAKDKRLAKNARPSKKRKF
Sbjct: 961  SVKGFGAPGAKSEMKSTEQIRSQRVAKDKRLAKNARPSKKRKF 1003

>KLTH0C08866g Chr3 (742559..745477) [2919 bp, 972 aa] {ON} highly
            similar to uniprot|Q12389 Saccharomyces cerevisiae
            YDL031W DBP10 Essential protein involved in ribosome
            biogenesis putative ATP-dependent RNA helicase of the
            DEAD-box protein family
          Length = 972

 Score = 1266 bits (3276), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/860 (71%), Positives = 712/860 (82%), Gaps = 21/860 (2%)

Query: 145  ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
            I++NI++KGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF LPMIEKLKGHSAKIG
Sbjct: 133  IVSNIAKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKGHSAKIG 192

Query: 205  VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
             RAVILSPSRELAMQT+KVF+EFSRGSDLRSVLLTGG+SLEEQFG+MM NPDVVIATPGR
Sbjct: 193  ARAVILSPSRELAMQTHKVFREFSRGSDLRSVLLTGGESLEEQFGLMMSNPDVVIATPGR 252

Query: 265  FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
            FLHLKVEMNLDLK+VEY+VFDEADRLFEMGF+EQL+ELLAALP  RQTLLFSATLP SLV
Sbjct: 253  FLHLKVEMNLDLKSVEYLVFDEADRLFEMGFEEQLSELLAALPVARQTLLFSATLPSSLV 312

Query: 325  DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
            +FAKAGLTNPVLVRLDAE+KVSENLEMLFL++KN EREANLLYLLQE ++IPVAT EQL 
Sbjct: 313  NFAKAGLTNPVLVRLDAETKVSENLEMLFLSSKNEEREANLLYLLQEAMKIPVATEEQLL 372

Query: 385  QLRA-LXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYV 443
            + +A +                            +PSANELPSE ATI+FVPTRHHVEY+
Sbjct: 373  EYKAKVKNSYDSDDSDEDAKAKAKKQRKSAIRKKLPSANELPSEHATIVFVPTRHHVEYI 432

Query: 444  SQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFS 503
            SQLLKD GYLVSY+YGTLDQ+AR+QQLFNFR+GLT+ILVVTDVAARGVDIP+LANV+N+S
Sbjct: 433  SQLLKDCGYLVSYLYGTLDQHARRQQLFNFRAGLTTILVVTDVAARGVDIPLLANVVNYS 492

Query: 504  LPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYDATCELM 563
            LP+SSKIF+HRVGRTARAGN G+AYSIVS              GKKILL PM++AT EL+
Sbjct: 493  LPASSKIFVHRVGRTARAGNKGFAYSIVSENELPYLLDLELFLGKKILLTPMFEATTELL 552

Query: 564  RKQWVAEGKQESEFVAPRVSYTNRMVLGSCPRLEMESMGDLYKNLVESSFDLQLLKSVAL 623
            + +W+AEG  E  F  P+VSYTNRMVLG+CPRL++E+ GDL+KNL +SSFDLQ LK VA 
Sbjct: 553  KSKWIAEGNSELTFNPPKVSYTNRMVLGACPRLDLETCGDLFKNLTQSSFDLQQLKGVAA 612

Query: 624  KAEKLYFRTRAPASTEAMKRSKEIIASGWDEQNLKFGKNLEKEKLDFLAKLQNRNHKETV 683
            KAEKLYFRTR PAS+++MKRSKE+IASGWDEQNL+FGKN+EKEKLDFLAKLQNRN+KETV
Sbjct: 613  KAEKLYFRTRPPASSQSMKRSKEVIASGWDEQNLRFGKNIEKEKLDFLAKLQNRNNKETV 672

Query: 684  FEFARNQEDEMAVLMXXXXXXXXXXXXXXXERQELLEKERMAGLRHTLEDEVLKGGDGEF 743
            FEFARNQ+DEM++LM               ER+ELLEKERMAGLRHT+EDE+LKG + E 
Sbjct: 673  FEFARNQDDEMSLLMKKRRIQIAPIQRRAKERKELLEKERMAGLRHTVEDEILKGDENEV 732

Query: 744  GYSVPEEVLAQEFEDADKILDEQENKKKTKTMKTRQGETXXXXXXXXXXXTYKDPNFFLS 803
            GYSVPEEVL +EF+DAD++L  Q   K+ K                    +++DP FFLS
Sbjct: 733  GYSVPEEVLHREFQDADELLGAQSKSKRPK--------------------SFRDPAFFLS 772

Query: 804  HYAPAGDIQDKQLQLTSGFTNDAADATFDLHDDNKVQVHKQTATVKWDKKRKKYVNAQGL 863
            HYAPA +IQDKQL++T+GFTN+AA+ATFDLH+D+KVQ HKQ AT KWDKKR+KYVN QGL
Sbjct: 773  HYAPASEIQDKQLEVTNGFTNEAANATFDLHNDDKVQNHKQVATTKWDKKRQKYVNTQGL 832

Query: 864  DNKKYIIGESGQKIPASFRSGKFAEWSKARKLGPLKVGARETSGPSNLLSDPASGGRRVA 923
            DNKKYI+GESG KIPASFRSGKF EWSKARKLGPLKVGA+E+S  + +LS+P + G+R  
Sbjct: 833  DNKKYIMGESGHKIPASFRSGKFDEWSKARKLGPLKVGAKESSTTAKMLSNPTAEGQRSI 892

Query: 924  GGRFKHKLDKAPKLPDRHRDDYKTQQKKVANALERGISVKGFGAPGAKSEMKSTEQIRSQ 983
            GGRFKH   +APKLPD+HRDDY  Q+KKV  A+  GI VKG+ APG KSEM+ST+QI  +
Sbjct: 893  GGRFKHNKVRAPKLPDKHRDDYHVQKKKVEKAVSSGIPVKGYNAPGMKSEMRSTQQIYKE 952

Query: 984  RVAKDKRLAKNARPSKKRKF 1003
            RVAK+K+ AKNARP+KKRKF
Sbjct: 953  RVAKEKKRAKNARPAKKRKF 972

>Kwal_56.22804 s56 complement(286570..289491) [2922 bp, 973 aa] {ON}
            YDL031W (DBP10) - similar to RNA helicases [contig 184]
            FULL
          Length = 973

 Score = 1248 bits (3230), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/860 (70%), Positives = 712/860 (82%), Gaps = 21/860 (2%)

Query: 145  ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
            I++NI++KGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF LPMIE+LKGHSAKIG
Sbjct: 134  IISNIAKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIERLKGHSAKIG 193

Query: 205  VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
             RAVI+SPSRELA+QT+KVF+EFSRGSDLRSVLLTGG+SLEEQFG+MM NPDVVIATPGR
Sbjct: 194  ARAVIMSPSRELALQTHKVFREFSRGSDLRSVLLTGGESLEEQFGLMMSNPDVVIATPGR 253

Query: 265  FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
            FLHLKVEMNLDLK++EYVVFDEADRLFEMGF+EQLNELLAA P  RQTLLFSATLP SLV
Sbjct: 254  FLHLKVEMNLDLKSIEYVVFDEADRLFEMGFEEQLNELLAAFPVARQTLLFSATLPSSLV 313

Query: 325  DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
            DFAKAGLT+PVLVRLD E+KVSENLEML+L++KN EREANLLYLLQE ++IPVAT EQL 
Sbjct: 314  DFAKAGLTSPVLVRLDTETKVSENLEMLYLSSKNEEREANLLYLLQEAMQIPVATEEQLA 373

Query: 385  QLRA-LXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYV 443
            + R  +                            MP+ANELPSE ATI+FVPTRHHVEY+
Sbjct: 374  EYRTKIKDDYDSDDSDSKDKLKAKKKKKAMIRRKMPAANELPSEHATIVFVPTRHHVEYI 433

Query: 444  SQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFS 503
            +QLLKD GYLVSY+YGTLDQ+AR+QQLFNFR+GLT+ILVVTDVAARGVDIPMLANV+N+S
Sbjct: 434  TQLLKDCGYLVSYLYGTLDQHARRQQLFNFRAGLTTILVVTDVAARGVDIPMLANVVNYS 493

Query: 504  LPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYDATCELM 563
            LP+SSKIF+HRVGRTARAGN G AYSIVS              GKKILL PMY+AT E++
Sbjct: 494  LPASSKIFVHRVGRTARAGNKGSAYSIVSDNELPYLLDLELFLGKKILLTPMYEATTEML 553

Query: 564  RKQWVAEGKQESEFVAPRVSYTNRMVLGSCPRLEMESMGDLYKNLVESSFDLQLLKSVAL 623
            + +W+AEGK E  F AP+VSYTNRMVLG+CPRLE+E+ GDL+K+L++SSFDL+ LK+VA 
Sbjct: 554  KSRWIAEGKSELTFNAPKVSYTNRMVLGACPRLELETCGDLFKSLIDSSFDLKQLKAVAN 613

Query: 624  KAEKLYFRTRAPASTEAMKRSKEIIASGWDEQNLKFGKNLEKEKLDFLAKLQNRNHKETV 683
            KAEKLYFRTR PAS+++MKRSKE+++SGWDEQNL+FGKN+EKEKLDFLAKLQNR+HKETV
Sbjct: 614  KAEKLYFRTRPPASSQSMKRSKEVLSSGWDEQNLRFGKNMEKEKLDFLAKLQNRHHKETV 673

Query: 684  FEFARNQEDEMAVLMXXXXXXXXXXXXXXXERQELLEKERMAGLRHTLEDEVLKGGDGEF 743
            FEFARN +DEMA+LM               ER+ELLEKER AGL H++EDE+LKG + E 
Sbjct: 674  FEFARNHDDEMALLMKKRRIQIAPIQRRAKERKELLEKERKAGLVHSVEDEILKGDETEV 733

Query: 744  GYSVPEEVLAQEFEDADKILDEQENKKKTKTMKTRQGETXXXXXXXXXXXTYKDPNFFLS 803
            GYSVPEEVL QEFEDAD++L+ Q+ +KK K                    +++DP +FLS
Sbjct: 734  GYSVPEEVLHQEFEDADELLEGQKKEKKQK--------------------SFRDPTYFLS 773

Query: 804  HYAPAGDIQDKQLQLTSGFTNDAADATFDLHDDNKVQVHKQTATVKWDKKRKKYVNAQGL 863
            HYAPA +IQDKQL++++GFTN+AA+ATFDLH+D+KVQ HKQ AT+KWDKKR+KYVN+QGL
Sbjct: 774  HYAPASEIQDKQLEVSNGFTNEAANATFDLHNDDKVQNHKQIATIKWDKKRQKYVNSQGL 833

Query: 864  DNKKYIIGESGQKIPASFRSGKFAEWSKARKLGPLKVGARETSGPSNLLSDPASGGRRVA 923
            DNKKYI GESG KIPASFRSGKF EWSKARKLGP+KVGARE+S  S +LS+P S  +R+ 
Sbjct: 834  DNKKYITGESGHKIPASFRSGKFDEWSKARKLGPIKVGARESSSTSKMLSNPTSNNQRMG 893

Query: 924  GGRFKHKLDKAPKLPDRHRDDYKTQQKKVANALERGISVKGFGAPGAKSEMKSTEQIRSQ 983
            GG+FKH   KAPKLPD++RDDY  Q+KKV  A+  GI VKGF APG KSEM++ +QI  +
Sbjct: 894  GGKFKHNKVKAPKLPDKNRDDYHVQKKKVEKAISSGIRVKGFNAPGMKSEMRTPQQIYKE 953

Query: 984  RVAKDKRLAKNARPSKKRKF 1003
            RVAK+K+ AKNARP+KKRK+
Sbjct: 954  RVAKEKKRAKNARPAKKRKY 973

>KLLA0F24684g Chr6 complement(2294708..2297629) [2922 bp, 973 aa] {ON}
            similar to uniprot|Q12389 Saccharomyces cerevisiae
            YDL031W DBP10 Essential protein involved in ribosome
            biogenesis
          Length = 973

 Score = 1247 bits (3226), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/907 (67%), Positives = 710/907 (78%), Gaps = 23/907 (2%)

Query: 96   FPTLELSXXXXXXXXXXXXXVNDYFSXXXXXXXXXXXXXXXXXXXXXXXILNNISRKGFR 155
            FP+LELS             +NDYF+                       +L NIS+KGFR
Sbjct: 89   FPSLELSDDEKKATNESDDDLNDYFNTTADAAAKHKKGSFASFGLSKL-VLINISKKGFR 147

Query: 156  QPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPSRE 215
            QPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF LPMIEKLK HSAKIGVRAVILSPSRE
Sbjct: 148  QPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRAVILSPSRE 207

Query: 216  LAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMNLD 275
            LA+QT++VFKEFS+GSDLRS+LLTGGDSLE+QFGMMMGNPDVVIATPGRFLHLKVEMNLD
Sbjct: 208  LAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLD 267

Query: 276  LKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLVDFAKAGLTNPV 335
            LK+VEYVVFDEADRLFEMGFQEQLNELL A P  RQTLLFSATLP SLVDFAKAGL+NPV
Sbjct: 268  LKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPV 327

Query: 336  LVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLKQLRALXXXXXX 395
            LVRLDAE+K+SENLEMLF++ K  EREANLLYLLQE I++PVAT  Q+K+L+        
Sbjct: 328  LVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQ-QNDADS 386

Query: 396  XXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVSQLLKDSGYLVS 455
                                  +P+ANE+PSEKATI+FVPTRHHVEYV+QLLK+ GYLVS
Sbjct: 387  DSDDSEDEKKKKAKKAKKSKRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVS 446

Query: 456  YIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSLPSSSKIFIHRV 515
            YIYG L+Q+ARKQQL+NFR+GLTSILVVTDVAARGVDIP+LANVIN+SLP SSKIFIHRV
Sbjct: 447  YIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRV 506

Query: 516  GRTARAGNSGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYDATCELMRKQWVAEGKQES 575
            GRTARAGN GWA+SIVS              GKKILL PMY+++C+++RK+  +EG   +
Sbjct: 507  GRTARAGNRGWAFSIVSENELPYLLDLELFLGKKILLTPMYESSCQILRKKAESEG--NN 564

Query: 576  EFVAPRVSYTNRMVLGSCPRLEMESMGDLYKNLVESSFDLQLLKSVALKAEKLYFRTRAP 635
             F  P+VSYT RMVLG+CPR E++ MGDLY N+++S F+L  +K VALKAEKLYFRTR P
Sbjct: 565  NFTDPKVSYTTRMVLGACPRSEIDGMGDLYSNMIKSDFELNTVKGVALKAEKLYFRTRTP 624

Query: 636  ASTEAMKRSKEIIASGWDEQNLKFGKNLEKEKLDFLAKLQNRNHKETVFEFARNQEDEMA 695
            AS E+MKRSKEI+ SGWDEQN+ FGKN EKEKLDFLAKLQ+RN+KETVFEFARN +DEM+
Sbjct: 625  ASAESMKRSKEILRSGWDEQNIYFGKNAEKEKLDFLAKLQHRNNKETVFEFARNPDDEMS 684

Query: 696  VLMXXXXXXXXXXXXXXXERQELLEKERMAGLRHTLEDEVLKGGDGEFGYSVPEEVLAQE 755
            VLM               ERQELLEKERM GLRH++EDE+LKG D E GYSVP+EVL +E
Sbjct: 685  VLMKRRRRQIAPIQRKAKERQELLEKERMIGLRHSIEDEILKGEDNEVGYSVPDEVL-KE 743

Query: 756  FEDADKILDEQENKKKTKTMKTRQGETXXXXXXXXXXXTYKDPNFFLSHYAPAGDIQDKQ 815
            FEDAD +L+EQEN KK +                    T++DP F+LSH+AP  DIQDKQ
Sbjct: 744  FEDADVLLEEQENIKKKQ------------------KKTFRDPTFYLSHFAPTSDIQDKQ 785

Query: 816  LQLTSGFTNDAADATFDLHDDNKVQVHKQTATVKWDKKRKKYVNAQGLDNKKYIIGESGQ 875
            LQ++SGFTNDA++A FDL +D+KVQVHKQTATVKWDKKRKKYVN QGLDNKKYIIGESGQ
Sbjct: 786  LQISSGFTNDASNAAFDLANDDKVQVHKQTATVKWDKKRKKYVNTQGLDNKKYIIGESGQ 845

Query: 876  KIPASFRSGKFAEWSKARKLGPLKVGARETSGPSNLLSDPASGGRRVAGGRFKHKLDKAP 935
            KIPASFRSGKF +WSKARK+ PLKVGARE++ PSNLL+DP S   R  GG+FKHK  KAP
Sbjct: 846  KIPASFRSGKFQDWSKARKIAPLKVGARESTIPSNLLADPTSPSERTVGGKFKHKTQKAP 905

Query: 936  KLPDRHRDDYKTQQKKVANALERGISVKGFGAPGAKSEMKSTEQIRSQRVAKDKRLAKNA 995
            KLPD+HRDDY  Q+KKV  ALERG+ VKG+  PG K E+KS ++IR  R  K+K+ +KNA
Sbjct: 906  KLPDKHRDDYAFQKKKVEAALERGVRVKGYNGPGMKQEIKSVDEIRKLREIKEKKRSKNA 965

Query: 996  RPSKKRK 1002
            RP+K+RK
Sbjct: 966  RPTKRRK 972

>Kpol_1032.11 s1032 complement(27093..30026) [2934 bp, 977 aa] {ON}
            complement(27093..30026) [2934 nt, 978 aa]
          Length = 977

 Score = 1240 bits (3209), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/865 (69%), Positives = 708/865 (81%), Gaps = 25/865 (2%)

Query: 145  ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
            IL+N+ +KGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF LPMIEKLK HS+KIG
Sbjct: 132  ILSNVHKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKSHSSKIG 191

Query: 205  VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
             RAVILSPSRELA+QT++VFKEFS+G+ LRSVLLTGGDSLE+QF MMM NPDV++ATPGR
Sbjct: 192  ARAVILSPSRELALQTHRVFKEFSKGTHLRSVLLTGGDSLEDQFSMMMSNPDVIVATPGR 251

Query: 265  FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
            FLHLKVEM+LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALP  RQTLLFSATLP SLV
Sbjct: 252  FLHLKVEMSLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPMNRQTLLFSATLPSSLV 311

Query: 325  DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
            DFAKAGLTNPVLVRLDAE+K+SENLE+LFL+TKN ERE NLLYLLQ+VI+IP+ T +Q+K
Sbjct: 312  DFAKAGLTNPVLVRLDAETKISENLEILFLSTKNEERENNLLYLLQDVIKIPLGTDDQIK 371

Query: 385  QL----RALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHV 440
            +L    ++L                            + ++NELP+EK+TI+F PTRHHV
Sbjct: 372  KLSDFNKSLSDSDSEDEDNKGKQNSRKSKKGKFQKLKVSASNELPTEKSTIVFAPTRHHV 431

Query: 441  EYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVI 500
            EY++QLLKDSG+LVSY+YGTLDQ+ARK+QL NFR+GLTSILVVTDVAARGVDIPMLANVI
Sbjct: 432  EYITQLLKDSGFLVSYLYGTLDQHARKRQLLNFRAGLTSILVVTDVAARGVDIPMLANVI 491

Query: 501  NFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYDATC 560
            N+SLP+SSKIFIHRVGRTARAGN GWAYSIVS              GKKILL  MY+A+C
Sbjct: 492  NYSLPASSKIFIHRVGRTARAGNRGWAYSIVSETELPYMLDLELFLGKKILLTSMYEASC 551

Query: 561  ELMRKQWVAEGKQESEFVAPRVSYTNRMVLGSCPRLEMESMGDLYKNLVESSFDLQLLKS 620
            +LM+ +W+A+G  ES F  P++SYTNR+VLGS PR ++ES+GDLYKN++ES+FDLQ+ K 
Sbjct: 552  KLMKSKWIADGNTESSFEDPKISYTNRLVLGSAPRYDIESVGDLYKNIIESNFDLQMAKK 611

Query: 621  VALKAEKLYFRTRAPASTEAMKRSKEIIASGWDEQNLKFGKNLEKEKLDFLAKLQNRNHK 680
            V+LKAEKLY RTR  AS E++KRSKE+IASGWDEQN++FG+NLEKEKL+FLAK QNR +K
Sbjct: 612  VSLKAEKLYCRTRTAASPESIKRSKEVIASGWDEQNIRFGRNLEKEKLNFLAKFQNRRNK 671

Query: 681  ETVFEFARNQEDEMAVLMXXXXXXXXXXXXXXXERQELLEKERMAGLRHTLEDEVLKGGD 740
            ETVFEF +N  D+ A+LM               +RQELL+KER+AGL H +EDE+LKG D
Sbjct: 672  ETVFEFGKNPNDDTAILMQKRRKQIAPIQRKARKRQELLDKERVAGLTHKIEDEILKGED 731

Query: 741  GEFGYSVPEEVLAQEFEDADKILDEQENKKKTKTMKTRQGETXXXXXXXXXXXTYKDPNF 800
             E GYSVPEE L + FEDADKIL+EQE+ +K K+                   T++DPNF
Sbjct: 732  HEAGYSVPEEAL-KSFEDADKILEEQESSRKKKS------------------KTFRDPNF 772

Query: 801  FLSHYAPAGDIQDKQLQLTSGFTNDAADATFDLHDDNKVQVHKQTATVKWDKKRKKYVNA 860
            F+SHYAPAGDIQDKQLQ+TSGFTNDAA A +DL+DD+KVQVHKQTATVKWDKKRKKYVN 
Sbjct: 773  FISHYAPAGDIQDKQLQITSGFTNDAAQAAYDLNDDDKVQVHKQTATVKWDKKRKKYVNM 832

Query: 861  QGLDNKKYIIGESGQKIPASFRSGKFAEWSKARKLGPLKVGARETSGPSNLLSDPA--SG 918
            QG+DNKKYIIGESGQKIPASF+SGKFAEWSK+R +  +K GARETS P+NLLSDP   SG
Sbjct: 833  QGIDNKKYIIGESGQKIPASFKSGKFAEWSKSRNIKGIKTGARETSIPTNLLSDPTTDSG 892

Query: 919  GRRVAGGRFKHKLDKAPKLPDRHRDDYKTQQKKVANALERGISVKGFGAPGAKSEMKSTE 978
             +R  GGRFKHK +KAP+LPD+ RDDY++Q+KKV +A+ERG+SVKGFG     +E+K+T 
Sbjct: 893  SQRGPGGRFKHKQNKAPRLPDKFRDDYQSQKKKVQSAIERGVSVKGFGGSSGNTELKTTA 952

Query: 979  QIRSQRVAKDKRLAKNARPSKKRKF 1003
            QIR +R+AK+K+  KNARP+KKRKF
Sbjct: 953  QIRKERMAKEKKRQKNARPTKKRKF 977

>YDL031W Chr4 (394217..397204) [2988 bp, 995 aa] {ON}  DBP10Putative
            ATP-dependent RNA helicase of the DEAD-box protein
            family, constituent of 66S pre-ribosomal particles;
            essential protein involved in ribosome biogenesis
          Length = 995

 Score = 1235 bits (3195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/865 (70%), Positives = 701/865 (81%), Gaps = 23/865 (2%)

Query: 145  ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
            +LNNI RKGFRQPTPIQRKTIPLILQ+RDIVGMARTGSGKTAAF LPM+EKLK HS KIG
Sbjct: 148  VLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIG 207

Query: 205  VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
             RAVILSPSRELAMQT+ VFK+F+RG++LRSVLLTGGDSLEEQFGMMM NPDV+IATPGR
Sbjct: 208  ARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFGMMMTNPDVIIATPGR 267

Query: 265  FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
            FLHLKVEMNLDLK+VEYVVFDEADRLFEMGFQEQLNELLA+LP TRQTLLFSATLP+SLV
Sbjct: 268  FLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLV 327

Query: 325  DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
            DF KAGL NPVLVRLDAE+KVSENLEMLFL++KN +REANLLY+LQE+I+IP+AT+EQL+
Sbjct: 328  DFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEIIKIPLATSEQLQ 387

Query: 385  QLRALXXXXXXXXXXXXXXXXXXXXXXXXX--XXXMPSANELPSEKATILFVPTRHHVEY 442
            +L+                                MP+ANELPSEKATILFVPTRHHVEY
Sbjct: 388  KLQNSNNEADSDSDDENDRQKKRRNFKKEKFRKQKMPAANELPSEKATILFVPTRHHVEY 447

Query: 443  VSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINF 502
            +SQLL+D GYL+SYIYGTLDQ+ARK+QL+NFR+GLTSILVVTDVAARGVDIPMLANVIN+
Sbjct: 448  ISQLLRDCGYLISYIYGTLDQHARKRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINY 507

Query: 503  SLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYDATCEL 562
            +LP SSKIF+HRVGRTARAGN GWAYSIV+              GKKILL PMYD+  ++
Sbjct: 508  TLPGSSKIFVHRVGRTARAGNKGWAYSIVAENELPYLLDLELFLGKKILLTPMYDSLVDV 567

Query: 563  MRKQWVAEGKQESEFVAPRVSYTNRMVLGSCPRLEMESMGDLYKNLVESSFDLQLLKSVA 622
            M+K+W+ EGK E +F  P++SYT R+VLGSCPRL++E +GDLYKNL+ S+FDLQL K  A
Sbjct: 568  MKKRWIDEGKPEYQFQPPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMSSNFDLQLAKKTA 627

Query: 623  LKAEKLYFRTRAPASTEAMKRSKEIIASGWDEQNLKFGKNLEKEKLDFLAKLQNRNHKET 682
            +KAEKLY+RTR  AS E++KRSKEII+SGWD QN  FGKN EKEKLDFLAKLQNR +KET
Sbjct: 628  MKAEKLYYRTRTSASPESLKRSKEIISSGWDAQNAFFGKNEEKEKLDFLAKLQNRRNKET 687

Query: 683  VFEFARNQEDEMAVLMXXXXXXXXXXXXXXXERQELLEKERMAGLRHTLEDEVLKGGDGE 742
            VFEF RN +DEMAV M               ER+ELLEKERMAGL H++EDE+LKG DGE
Sbjct: 688  VFEFTRNPDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHSIEDEILKGDDGE 747

Query: 743  FGYSVPEEVLAQEFEDADKILDEQENKKKTKTMKTRQGETXXXXXXXXXXXTYKDPNFFL 802
             GY+V E+ L +EFEDAD++L+ QEN+ K K                    ++KDP FFL
Sbjct: 748  TGYTVSEDAL-KEFEDADQLLEAQENENKKKKKPK----------------SFKDPTFFL 790

Query: 803  SHYAPAGDIQDKQLQLTSGFTNDAADATFDLHDDNKVQVHKQTATVKWDKKRKKYVNAQG 862
            SHYAPAGDIQDKQLQ+T+GF NDAA A +DL+ D+KVQVHKQTATVKWDKKRKKYVN QG
Sbjct: 791  SHYAPAGDIQDKQLQITNGFANDAAQAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNTQG 850

Query: 863  LDNKKYIIGESGQKIPASFRSGKFAEWSKARKLGPLKVGARETSGPSNLLSDPASG---G 919
            +DNKKYIIGESGQKI ASFRSG+F +WSKAR L PLKVG+RETS PSNLL DP+ G    
Sbjct: 851  IDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKVGSRETSIPSNLLEDPSQGPAAN 910

Query: 920  RRVAGGRFKHKLDKAPKLPDRHRDDYKTQQKKVANALERGISVKGF-GAPGAKSEMKSTE 978
             R   G+FKHK  KAPK+PD+HRD+Y +Q+KKV  AL+ GISVKG+  APG +SE+KSTE
Sbjct: 911  GRTVRGKFKHKQMKAPKMPDKHRDNYYSQKKKVEKALQSGISVKGYNNAPGLRSELKSTE 970

Query: 979  QIRSQRVAKDKRLAKNARPSKKRKF 1003
            QIR  R+  +K+ AKNARPSKKRKF
Sbjct: 971  QIRKDRIIAEKKRAKNARPSKKRKF 995

>AEL086W Chr5 (464521..467403) [2883 bp, 960 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YDL031W (DBP10)
          Length = 960

 Score = 1227 bits (3175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 623/1005 (61%), Positives = 739/1005 (73%), Gaps = 47/1005 (4%)

Query: 1    MGSTSLKRKRESNNPSVXXXXXXXDVFDIAGDIALXXXXXXXXXXXXXXXXXXXXXXXVI 60
            MG  S KRKR++   S        + FDIAG+IAL                       +I
Sbjct: 1    MGLAS-KRKRDTEEHS-----DEGEDFDIAGNIALDSEDSDDSVSDSDNEVQD-----II 49

Query: 61   EFSDGEEXXXXXXXXXXXXXXXXXXXXXXXXPR--PSFPTLELSXXXXXXXXXXXXXVND 118
            EFSD E+                        PR   +FP+LELS             V+ 
Sbjct: 50   EFSDDEKQNAPQVSKTAKGAKGAKVAA----PRSDAAFPSLELSDGEDADNGDKDD-VDS 104

Query: 119  YFSXXXXXXXXXXXXXXXXXXXXXXXILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMA 178
            YF+                       IL NISRKGFRQPTPIQRKTIPLILQ RDIVGMA
Sbjct: 105  YFNTTSQLAASKAKKGSFASFGLSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMA 164

Query: 179  RTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLL 238
            RTGSGKTAAF LP+IEKLK HSAKIG RA+ILSPSRELAMQT+KVFKEF++GS+LRSVLL
Sbjct: 165  RTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLL 224

Query: 239  TGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQ 298
            TGGD LE+QF MMM NPDV+IATPGRFLHLKVEMNLDL ++EYVVFDEADRLFEMGFQEQ
Sbjct: 225  TGGDGLEDQFSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQ 284

Query: 299  LNELLAALPPTRQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKN 358
            LNELL +LP  RQTLLFSATLP SLVDFAKAGLTNPVLVRLD E+KVSENLEMLFL+ KN
Sbjct: 285  LNELLGSLPTARQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKN 344

Query: 359  GEREANLLYLLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXM 418
             EREANLLYLLQEVI+IPVAT EQL++ R                              +
Sbjct: 345  DEREANLLYLLQEVIKIPVATEEQLQRFR---KQSNDDADDSDDETDKKKKHSKKSKQPL 401

Query: 419  PSANELPSEKATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLT 478
            PSA ++PS  +TI+FV TRHHVEYVS LLKD GYLVSY+YGTLDQ+AR+QQL NFR GLT
Sbjct: 402  PSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLT 461

Query: 479  SILVVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXX 538
            +ILVVTDVAARGVDIP+LANV+N SLP+SSKIF+HRVGRTARAGN GWAY+I+S      
Sbjct: 462  NILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTILSESELPY 521

Query: 539  XXXXXXXXGKKILLAPMYDATCELMRKQWVAEGKQESEFVAPRVSYTNRMVLGSCPRLEM 598
                    GKK+LL PMY+ATC+L++K+W++EG + + F  P++SY NR++LGS PRL++
Sbjct: 522  LLDLELFLGKKVLLTPMYEATCDLLKKKWISEGNEGALFQPPKISYVNRLILGSAPRLDL 581

Query: 599  ESMGDLYKNLVESSFDLQLLKSVALKAEKLYFRTRAPASTEAMKRSKEIIASGWDEQNLK 658
            E+MGDL+KNLVES+F+LQ LK+V++KAEKLY RTR PAS E++KR+KE+IA+GWDEQN++
Sbjct: 582  EAMGDLFKNLVESNFELQNLKAVSIKAEKLYLRTRQPASAESIKRAKEVIAAGWDEQNVR 641

Query: 659  FGKNLEKEKLDFLAKLQNRNHKETVFEFARNQEDEMAVLMXXXXXXXXXXXXXXXERQEL 718
            FGKN+EKEKL+FLAKLQNR++KETVFEFARN +DEMA+LM               ERQ+L
Sbjct: 642  FGKNIEKEKLEFLAKLQNRHNKETVFEFARNHDDEMAILMKRRRRQIAPIQQRAKERQQL 701

Query: 719  LEKERMAGLRHTLEDEVLKGGDGEFGYSVPEEVLAQEFEDADKILDEQENKKKTKTMKTR 778
            LEKER AGLRHTLEDE+LKG + E GYSVP+E+L ++FEDAD++  ++  KK        
Sbjct: 702  LEKERQAGLRHTLEDEILKGEENEVGYSVPQELL-RDFEDADELAAKRNTKK-------- 752

Query: 779  QGETXXXXXXXXXXXTYKDPNFFLSHYAPAGDIQDKQLQLTSGFTNDAADATFDLHDDNK 838
                            ++D NF+LSH+APA DIQDKQLQ+ S FTN+ + ATFDLH+D+K
Sbjct: 753  ---------------GFRDENFYLSHFAPASDIQDKQLQVASSFTNEVSKATFDLHNDDK 797

Query: 839  VQVHKQTATVKWDKKRKKYVNAQGLDNKKYIIGESGQKIPASFRSGKFAEWSKARKLGPL 898
            VQVHKQTATVKWDKKRKKYVN QG+DNKKYIIGESGQKIPASFRSGKF EWSKARKL PL
Sbjct: 798  VQVHKQTATVKWDKKRKKYVNVQGIDNKKYIIGESGQKIPASFRSGKFDEWSKARKLAPL 857

Query: 899  KVGARETSGPSNLLSDPASGGRRVAGGRFKHKLDKAPKLPDRHRDDYKTQQKKVANALER 958
            KVGARE+S P+NLL+DP   G R+A G+FKHK  KAPK+PD++RDDY++Q KKV  A+E 
Sbjct: 858  KVGARESSIPANLLADPT--GSRLANGKFKHKQIKAPKMPDKNRDDYQSQLKKVNKAMES 915

Query: 959  GISVKGFGAPGAKSEMKSTEQIRSQRVAKDKRLAKNARPSKKRKF 1003
            G+ VKG+ APG K E+++TEQIR QR   +KR AKNARP+KKRKF
Sbjct: 916  GLHVKGYNAPGMKQELRTTEQIRKQRSMAEKRKAKNARPAKKRKF 960

>Smik_4.204 Chr4 (374339..377335) [2997 bp, 998 aa] {ON} YDL031W
            (REAL)
          Length = 998

 Score = 1224 bits (3166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 634/1011 (62%), Positives = 728/1011 (72%), Gaps = 32/1011 (3%)

Query: 7    KRKRESNNPSVXXXXXXXDVFDIAGDIALXXXXXXXXXXXXXXXXXX--XXXXXVIEFS- 63
            KR+R   +  V         FDIA DIAL                         +IE+S 
Sbjct: 6    KRRRNLEDQDVIGSEEDDIAFDIANDIALNDSESDSNDSENEIEAGYGPSDVQDIIEYSS 65

Query: 64   DGEEXXXXXXXXXXXXXXXXXXXXXXXXPRPSFPTLELSXXXXXXXXXXXX-----XVND 118
            D EE                           +FP LELS                  VN+
Sbjct: 66   DDEEEGKKSNKKKKTNDKKPGKNKHNKKEVAAFPILELSDDENNISGQTQAGEEEDDVNE 125

Query: 119  YFSXXXXXXXXXXXXXXXXXXXXXXXILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMA 178
            YFS                       +LNNI RKGFRQPTPIQRKTIPLILQ+RDIVGMA
Sbjct: 126  YFSTNNLEKQKHKKGSFPSFGLSKI-VLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMA 184

Query: 179  RTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLL 238
            RTGSGKTAAF LPM+EKLK HS KIG RAVILSPSRELAMQT+ VFK+F+RG++LRSVLL
Sbjct: 185  RTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLL 244

Query: 239  TGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQ 298
            TGGDSLEEQF MMM NPDV+IATPGRFLHLKVEMNLDLK+VEYVVFDEADRLFEMGFQEQ
Sbjct: 245  TGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQ 304

Query: 299  LNELLAALPPTRQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKN 358
            LNELLA+LP TRQTLLFSATLP+SLVDF KAGL NPVLVRLDAE+KVSENLEMLFL++KN
Sbjct: 305  LNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKN 364

Query: 359  GEREANLLYLLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXX--XX 416
             +REANLLY+LQEVIRIP+AT+EQL +L+                               
Sbjct: 365  ADREANLLYILQEVIRIPLATSEQLLKLQKSTNEADSDSDDENDRQKKKINFKKEKFRKQ 424

Query: 417  XMPSANELPSEKATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSG 476
             MP+ANELPSEKATILFVPTRHHVEY+SQLL+D GYL+SYIYGTLDQ+ARK QL+NFR+G
Sbjct: 425  KMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAG 484

Query: 477  LTSILVVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXX 536
            LTSILVVTDVAARGVDIPMLANVIN++LP SSKIF+HRVGRTARAGN GWAYSIV+    
Sbjct: 485  LTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAENEL 544

Query: 537  XXXXXXXXXXGKKILLAPMYDATCELMRKQWVAEGKQESEFVAPRVSYTNRMVLGSCPRL 596
                      GKKILL PMYD+  ++M+K+WV EG     F  P++SYT R+VLGSCPRL
Sbjct: 545  PYLLDLELFLGKKILLTPMYDSLVDVMKKRWVEEGNSAYNFQLPKLSYTKRLVLGSCPRL 604

Query: 597  EMESMGDLYKNLVESSFDLQLLKSVALKAEKLYFRTRAPASTEAMKRSKEIIASGWDEQN 656
            ++E +GDLYKNL+ S+FDLQL K  A+KAEKLY+RTR  AS E++KRSKEIIASGWD QN
Sbjct: 605  DVEGLGDLYKNLMTSNFDLQLAKKTAMKAEKLYYRTRTSASPESLKRSKEIIASGWDAQN 664

Query: 657  LKFGKNLEKEKLDFLAKLQNRNHKETVFEFARNQEDEMAVLMXXXXXXXXXXXXXXXERQ 716
              FGKN EKEKLDFLAKLQNR +KETVFEF RN +DEMAV M               ER+
Sbjct: 665  AYFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMAVFMKRRRKQLAPIQRKATERR 724

Query: 717  ELLEKERMAGLRHTLEDEVLKGGDGEFGYSVPEEVLAQEFEDADKILDEQENKKKTKTMK 776
            ELLEKERMAGL H++EDE+LKG DGE GY+V E+ L + FEDAD++L+ QEN+ K K   
Sbjct: 725  ELLEKERMAGLSHSIEDEILKGDDGETGYTVSEDAL-KNFEDADQLLEAQENESKKKKKP 783

Query: 777  TRQGETXXXXXXXXXXXTYKDPNFFLSHYAPAGDIQDKQLQLTSGFTNDAADATFDLHDD 836
                             T+KDP FFLSHYAPAG+IQDKQLQ+T+GF NDAA A +DL+ D
Sbjct: 784  K----------------TFKDPTFFLSHYAPAGEIQDKQLQITNGFANDAAQAAYDLNSD 827

Query: 837  NKVQVHKQTATVKWDKKRKKYVNAQGLDNKKYIIGESGQKIPASFRSGKFAEWSKARKLG 896
            +KVQVHKQTATVKWDKKRKKYVN QG+DNKKYIIGESGQKI ASFRSG+F +WSKAR L 
Sbjct: 828  DKVQVHKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLK 887

Query: 897  PLKVGARETSGPSNLLSDPASG---GRRVAGGRFKHKLDKAPKLPDRHRDDYKTQQKKVA 953
            PLKVG+RE+S PSNLL DP+ G     R   G+FKHK  KAPK+PD+HRD+Y +Q+KKV 
Sbjct: 888  PLKVGSRESSIPSNLLQDPSQGTGSNGRTVRGKFKHKQMKAPKMPDKHRDNYYSQKKKVD 947

Query: 954  NALERGISVKGF-GAPGAKSEMKSTEQIRSQRVAKDKRLAKNARPSKKRKF 1003
             AL+ GISVKG+  APG ++E+KSTEQIR  R   +K+ AKNARPSKKRKF
Sbjct: 948  KALQSGISVKGYNNAPGLRNELKSTEQIRKDRNMAEKKRAKNARPSKKRKF 998

>NCAS0C03530 Chr3 (703955..706888) [2934 bp, 977 aa] {ON} Anc_3.159
          Length = 977

 Score = 1221 bits (3158), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/1008 (63%), Positives = 735/1008 (72%), Gaps = 43/1008 (4%)

Query: 5    SLKRKR--ESNNPSVXXXXXXXDV-FDIAGDIALXXXXXXXXXXXXXXXXXXXXXXXVIE 61
            +LKR R  +S+  +        DV FDIAGDIAL                       VIE
Sbjct: 4    TLKRSRLEDSDAEAASSGDEDQDVGFDIAGDIALNSSESDASESDDDEEDVQD----VIE 59

Query: 62   FSDGEEXXXXXXXXXXXXXXXXXXXXXXXXPRPSFPTLELSXXXXXXXXXXXXX--VNDY 119
            +SD E                            SFP+LELS               VN Y
Sbjct: 60   YSDDETETKKKNDKKKNNNKTKEDK--------SFPSLELSDDEADRRNNEDEDDDVNAY 111

Query: 120  FSXXXXXXXXXXXXXXXXXXXXXXXILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMAR 179
            FS                       I++NI+RKGFRQPTPIQRKTIPLILQ RDIVGMAR
Sbjct: 112  FSTTNLDKSKHKKGSFPSFGLSKF-IISNITRKGFRQPTPIQRKTIPLILQNRDIVGMAR 170

Query: 180  TGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLT 239
            TGSGKTAAF LPMIEKLK HS KIG RAVILSPSRELAMQT+ VFK+FS+G+ LRSVLLT
Sbjct: 171  TGSGKTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLT 230

Query: 240  GGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQL 299
            GGDSLE+QFGMMM NPDV+IATPGRFLHLKVEMNLDLK++EY VFDEADRLFEMGFQEQL
Sbjct: 231  GGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQL 290

Query: 300  NELLAALPPTRQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNG 359
            NELLA+LP +RQTLLFSATLP SLVDFAKAGLTNPVLVRLDAE+K+SENLEMLFL+TKN 
Sbjct: 291  NELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKND 350

Query: 360  EREANLLYLLQEVIRIPVATAEQLKQLRALX-XXXXXXXXXXXXXXXXXXXXXXXXXXXM 418
            EREANLLYLLQEVI+IP+A+ +QL +  A                              +
Sbjct: 351  EREANLLYLLQEVIKIPLASRDQLAKFNAQNIKDNASDSDSDGDDKRQKGKRKKFKKERL 410

Query: 419  PSANELPSEKATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLT 478
            P AN+LPSEK+TILFVPTRHHVEY+S LL++SGYL+SYIYGTLDQ+ARK+QL+NFR+GLT
Sbjct: 411  PPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLT 470

Query: 479  SILVVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXX 538
            SILVVTDVAARGVDIPMLANVINFSLP+SSKIF+HRVGRTARAGN GWAYSIVS      
Sbjct: 471  SILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPY 530

Query: 539  XXXXXXXXGKKILLAPMYDATCELMRKQWVAEGKQESEFVAPRVSYTNRMVLGSCPRLEM 598
                    GKKIL+ PMYD+  ++M K+W+AEG  E  F  P+VSYTNRM+LGS PRLE+
Sbjct: 531  LLDLEIFLGKKILMTPMYDSMSDIMLKKWIAEGHDEINFKPPKVSYTNRMILGSAPRLEL 590

Query: 599  ESMGDLYKNLVESSFDLQLLKSVALKAEKLYFRTRAPASTEAMKRSKEIIASGWDEQNLK 658
            E +GDLY+N+++S+F++QLLK VA+KAEKLYFRTR  AS E++KRSKEIIASGWDEQN+ 
Sbjct: 591  EGLGDLYQNVMKSNFEIQLLKGVAMKAEKLYFRTRPAASPESLKRSKEIIASGWDEQNIM 650

Query: 659  FGKNLEKEKLDFLAKLQNRNHKETVFEFARNQEDEMAVLMXXXXXXXXXXXXXXXERQEL 718
            FGKN EKEKLDFLAKLQNR +KETVFEFA N +DEM+V M               ER EL
Sbjct: 651  FGKNAEKEKLDFLAKLQNRRNKETVFEFASNPDDEMSVFMKRRRRQLAPIQRKAKERHEL 710

Query: 719  LEKERMAGLRHTLEDEVLKGGDGE-FGYSVPEEVLAQEFEDADKILDEQENKKKTKTMKT 777
            L+KE++AGL HT+EDEVLKG + E   Y++ E+ L Q FED D++L  QENKKK K    
Sbjct: 711  LQKEKLAGLTHTMEDEVLKGDNAEDNSYTISEDTLKQ-FEDGDELLAGQENKKKKK---- 765

Query: 778  RQGETXXXXXXXXXXXTYKDPNFFLSHYAPAGDIQDKQLQLTSGFTNDAADATFDLHDDN 837
                            T+KDP FFLSHYAPA DIQDKQLQ+ +GF N+AA A +DL++D+
Sbjct: 766  ----------------TFKDPTFFLSHYAPASDIQDKQLQVANGFANEAAQAAYDLNNDD 809

Query: 838  KVQVHKQTATVKWDKKRKKYVNAQGLDNKKYIIGESGQKIPASFRSGKFAEWSKARKLGP 897
            KVQVHKQTATVKWDKKRKKYVN QGLDNKKYIIGESGQKI ASFRSGKF EW+KARKL P
Sbjct: 810  KVQVHKQTATVKWDKKRKKYVNVQGLDNKKYIIGESGQKIAASFRSGKFDEWTKARKLKP 869

Query: 898  LKVGARETSGPSNLLSDPAS--GGRRVAGGRFKHKLDKAPKLPDRHRDDYKTQQKKVANA 955
            LKVGARE+S PSNLLSDP    G +    G+FKHK  KAPKLPD+HRDDY+TQ+KKVA A
Sbjct: 870  LKVGARESSIPSNLLSDPTQGPGAQNSVRGKFKHKQLKAPKLPDKHRDDYQTQKKKVAKA 929

Query: 956  LERGISVKGFGAPGAKSEMKSTEQIRSQRVAKDKRLAKNARPSKKRKF 1003
            LE G+ V+GF  PG KSE+KSTE+IR QR   +K+ AKNARP+K+RK+
Sbjct: 930  LENGVQVRGFRGPGMKSELKSTEEIRKQRAFMEKKRAKNARPAKRRKY 977

>Suva_4.218 Chr4 (384623..387646) [3024 bp, 1007 aa] {ON} YDL031W
            (REAL)
          Length = 1007

 Score = 1217 bits (3150), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 616/920 (66%), Positives = 708/920 (76%), Gaps = 29/920 (3%)

Query: 95   SFPTLELSXXXXX-----XXXXXXXXVNDYFSXXXXXXXXXXXXXXXXXXXXXXXILNNI 149
            +FPTLELS                  VN+YFS                       +LNNI
Sbjct: 106  AFPTLELSDDENSVPGKNQADDDEDDVNEYFSTTNLEKTKHKKGSFPSFGLSKI-VLNNI 164

Query: 150  SRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVI 209
             RKGFRQPTPIQRKTIPLILQ+RDIVGMARTGSGKTAAF LPM+EKLK HS KIG RAVI
Sbjct: 165  KRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVI 224

Query: 210  LSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLK 269
            LSPSRELAMQT+ VFKEF+RG+ LRSVLLTGGDSLEEQF MMM NPDV+IATPGRFLHLK
Sbjct: 225  LSPSRELAMQTFNVFKEFARGTALRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLK 284

Query: 270  VEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLVDFAKA 329
            VEMNLDLK+VEYVVFDEADRLFEMGFQEQLNELLA+LP  RQTLLFSATLP+SLVDF KA
Sbjct: 285  VEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTARQTLLFSATLPNSLVDFVKA 344

Query: 330  GLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLKQLRAL 389
            GL NPVLVRLD E+KVSENLEMLF++TKN +REANLLY+LQEVI+IP+AT+EQL++L+  
Sbjct: 345  GLVNPVLVRLDTETKVSENLEMLFVSTKNDDREANLLYILQEVIKIPLATSEQLQKLQKS 404

Query: 390  XXXXXXXXXXXXXXXXXXXXXXXXX--XXXMPSANELPSEKATILFVPTRHHVEYVSQLL 447
                                          MP  NELPSEKATILFVPTRHHVEY+SQLL
Sbjct: 405  NNEADSESDDDNDRQKKRKNFKKEKFRKQRMPGGNELPSEKATILFVPTRHHVEYISQLL 464

Query: 448  KDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSLPSS 507
            +D G+L+SYIYGTLDQ+ARK+QL+NFR+GLTSILVVTDVAARGVDIPMLANVIN++LP S
Sbjct: 465  RDCGFLISYIYGTLDQHARKRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGS 524

Query: 508  SKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYDATCELMRKQW 567
            SKIF+HRVGRTARAGN GWAYSIV+              GKKILLAPMYD+   LM+K+W
Sbjct: 525  SKIFVHRVGRTARAGNKGWAYSIVAENELPYLLDLELFLGKKILLAPMYDSLAGLMKKRW 584

Query: 568  VAEGKQESEFVAPRVSYTNRMVLGSCPRLEMESMGDLYKNLVESSFDLQLLKSVALKAEK 627
            V EGK E  F  P +SYT R+VLGSCPRL++E +GDLYKNL+ S+FDLQL K  ALKAE+
Sbjct: 585  VDEGKPEYTFQPPTLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTALKAEQ 644

Query: 628  LYFRTRAPASTEAMKRSKEIIASGWDEQNLKFGKNLEKEKLDFLAKLQNRNHKETVFEFA 687
            LY+RTR  AS E++KRSKEIIASGWD QN  FGKN EKEKLDFLAKLQNR +KETVFEF 
Sbjct: 645  LYYRTRTAASPESLKRSKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFT 704

Query: 688  RNQEDEMAVLMXXXXXXXXXXXXXXXERQELLEKERMAGLRHTLEDEVLKGGDGEFGYSV 747
            RN +DEM+VLM               ER+ELLEKERMAGL H++EDE+LKG DGE GY++
Sbjct: 705  RNPDDEMSVLMKRRRKQLAPIQRKSRERRELLEKERMAGLSHSIEDEILKGNDGETGYTI 764

Query: 748  PEEVLAQEFEDADKILDEQENKKKTKTMKTRQGETXXXXXXXXXXXTYKDPNFFLSHYAP 807
             E+ L +EFEDAD++L+ QEN  K K                    T+KDP+FFLSHYAP
Sbjct: 765  SEDAL-KEFEDADQLLEAQENDSKKKKKPK----------------TFKDPSFFLSHYAP 807

Query: 808  AGDIQDKQLQLTSGFTNDAADATFDLHDDNKVQVHKQTATVKWDKKRKKYVNAQGLDNKK 867
            AG+IQDKQL++T GF NDAA A +DL+ D+KVQVHKQTATVKWDKKRKKYVN QGLDNKK
Sbjct: 808  AGEIQDKQLEITGGFANDAAHAAYDLNGDDKVQVHKQTATVKWDKKRKKYVNTQGLDNKK 867

Query: 868  YIIGESGQKIPASFRSGKFAEWSKARKLGPLKVGARETSGPSNLLSDPASGGRRVAG--- 924
            YIIGESGQKI ASFRSG+F +WSKAR L PLKVG+RE+S PSNLL+DP+ G     G   
Sbjct: 868  YIIGESGQKIAASFRSGRFDDWSKARNLKPLKVGSRESSIPSNLLADPSQGPGARGGAVR 927

Query: 925  GRFKHKLDKAPKLPDRHRDDYKTQQKKVANALERGISVKGF-GAPGAKSEMKSTEQIRSQ 983
            G+FKHK  KAPK+PD+HRD+Y TQ+KKV  AL+ G++V+G+  APG +SE+KST+QIR  
Sbjct: 928  GKFKHKQMKAPKMPDKHRDNYYTQKKKVEKALQSGVNVRGYNNAPGLRSELKSTDQIRKD 987

Query: 984  RVAKDKRLAKNARPSKKRKF 1003
            R A DK+ AKNARP+KKRKF
Sbjct: 988  RAAADKKRAKNARPTKKRKF 1007

>KAFR0C01060 Chr3 complement(215822..218743) [2922 bp, 973 aa] {ON}
            Anc_3.159 YDL031W
          Length = 973

 Score = 1216 bits (3147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 605/914 (66%), Positives = 697/914 (76%), Gaps = 27/914 (2%)

Query: 96   FPTLELSXXXXXXXXXXXXX--VNDYFSXXXXXXXXXXXXXXXXXXXXXXXILNNISRKG 153
            FP LELS               VN YFS                       IL NIS++G
Sbjct: 81   FPLLELSDDEDSKKQANDNDDDVNSYFSTNNLNTKTKHKKGSFASFGLSKLILTNISKRG 140

Query: 154  FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPS 213
            FRQPTPIQRKTIPLILQ+RDIVGMARTGSGKTAAF LPMIEKLK HS+KIG RA+ILSPS
Sbjct: 141  FRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFVLPMIEKLKTHSSKIGARAIILSPS 200

Query: 214  RELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMN 273
            RELAMQT+ VFKEFS+GSDLRSVLLTGGDSLE+QFGM+M NPDV+IATPGRFLHLKVEMN
Sbjct: 201  RELAMQTHNVFKEFSKGSDLRSVLLTGGDSLEDQFGMIMANPDVIIATPGRFLHLKVEMN 260

Query: 274  LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLVDFAKAGLTN 333
            LDLK+VEY+ FDEADRLFEMGFQEQLNEL+ +LP  RQTLLFSATLP SLVDFAKAGLTN
Sbjct: 261  LDLKSVEYICFDEADRLFEMGFQEQLNELIYSLPSNRQTLLFSATLPSSLVDFAKAGLTN 320

Query: 334  PVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLKQLRALXXXX 393
            PVLVRLD E+K+SENLEMLFL+ KN EREANLLYLLQE I IP+AT EQ+K+L       
Sbjct: 321  PVLVRLDTETKISENLEMLFLSIKNEEREANLLYLLQEEICIPLATEEQIKKLNNESKID 380

Query: 394  XXXXXXXXXXXXXXXXXXXX-XXXXMPSANELPSEKATILFVPTRHHVEYVSQLLKDSGY 452
                                     +P AN+LPSEKATI+FVPTRHHVEY+SQLLKD GY
Sbjct: 381  DDSDSEDDEATRRQKRKSKNFKKQRLPPANQLPSEKATIIFVPTRHHVEYISQLLKDCGY 440

Query: 453  LVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSLPSSSKIFI 512
            LVSYIYGTLDQ AR +QL+NFR GLTSILVVTDVAARGVDIPMLANVINFSLP SSK+F+
Sbjct: 441  LVSYIYGTLDQRARNRQLYNFRLGLTSILVVTDVAARGVDIPMLANVINFSLPVSSKVFV 500

Query: 513  HRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYDATCELMRKQWVAEGK 572
            HRVGRTARAGN GWAYSIVS              GKKILL  MYDATC++M+K+WV+EGK
Sbjct: 501  HRVGRTARAGNRGWAYSIVSENELPYLLDLELFLGKKILLTSMYDATCDIMKKKWVSEGK 560

Query: 573  QESEFVAPRVSYTNRMVLGSCPRLEMESMGDLYKNLVESSFDLQLLKSVALKAEKLYFRT 632
             E  F  P+ SYTNRMVLGS PRL++E + DLY  ++  SFDL+++K  ALKAEKLYFRT
Sbjct: 561  SELTFQDPKPSYTNRMVLGSAPRLQVEDLNDLYTGVLSGSFDLKMMKQTALKAEKLYFRT 620

Query: 633  RAPASTEAMKRSKEIIASGWDEQNLKFGKNLEKEKLDFLAKLQNRNHKETVFEFARNQED 692
            R  AS E+MKRSKEII SGWDEQN++FGKN+EKEK  FLAKLQNR++KETVFEFARN +D
Sbjct: 621  RTSASPESMKRSKEIILSGWDEQNIRFGKNVEKEKFQFLAKLQNRHNKETVFEFARNPDD 680

Query: 693  EMAVLMXXXXXXXXXXXXXXXERQELLEKERMAGLRHTLEDEVLKGGDGEFGYSVPEEVL 752
            EM+VLM               ER+EL+EKER+AGL H +ED++LKG D E GY+VPE+ L
Sbjct: 681  EMSVLMKRRRRQLAPIQRKAEERRELMEKERLAGLTHRIEDQILKGDDFEAGYTVPEDAL 740

Query: 753  AQEFEDADKILDEQENKKKTKTMKTRQGETXXXXXXXXXXXTYKDPNFFLSHYAPAGDIQ 812
             +EFEDADK+L+    K + K                    T++D NFFLSHYAP   IQ
Sbjct: 741  -KEFEDADKVLEASNKKSEQK--------------------TFRDENFFLSHYAPTSAIQ 779

Query: 813  DKQLQLTSGFTNDAADATFDLHDDNKVQVHKQTATVKWDKKRKKYVNAQGLDNKKYIIGE 872
            D+Q +L++GFTN AA+A +DL+ D+KVQVHKQTATVKWDKKRKKYVN QG+DNKKYI+GE
Sbjct: 780  DQQYKLSTGFTNAAAEAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNMQGIDNKKYIVGE 839

Query: 873  SGQKIPASFRSGKFAEWSKARKLGPLKVGARETSGPSNLLSDPA---SGGRRVAGGRFKH 929
            SGQKI ASFRSGKF EWSKARKL PLKVGARE++  +NLLS+P    S G++   G+FKH
Sbjct: 840  SGQKIAASFRSGKFEEWSKARKLKPLKVGARESTMQTNLLSNPTENNSNGQKTVRGKFKH 899

Query: 930  KLDKAPKLPDRHRDDYKTQQKKVANALERGISVKGFGAPGAKSEMKSTEQIRSQRVAKDK 989
            K  K+PKLPD+ RDDY+ Q+KKVA+AL RG  VKG+  PG K+E+KSTEQIR +R+AK+ 
Sbjct: 900  KQMKSPKLPDKFRDDYEKQKKKVASALARGAHVKGYSGPGMKNELKSTEQIRKERMAKEN 959

Query: 990  RLAKNARPSKKRKF 1003
            R AKNARPSKKRKF
Sbjct: 960  RRAKNARPSKKRKF 973

>CAGL0K01551g Chr11 (136421..139330) [2910 bp, 969 aa] {ON} highly
            similar to uniprot|Q12389 Saccharomyces cerevisiae
            YDL031w
          Length = 969

 Score = 1216 bits (3147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/864 (69%), Positives = 683/864 (79%), Gaps = 25/864 (2%)

Query: 145  ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
            IL NIS++GFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF LPMIEKLK HS+KIG
Sbjct: 126  ILVNISKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKTHSSKIG 185

Query: 205  VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
             RA+ILSPSRELAMQT+ VFKEFSRG+ LRSVLLTGGDSLE+QFGMMM NPDV+IATPGR
Sbjct: 186  ARAIILSPSRELAMQTHSVFKEFSRGTHLRSVLLTGGDSLEDQFGMMMTNPDVIIATPGR 245

Query: 265  FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
            FLHLKVEMNLDLK+VEY VFDEADRLFEMGFQEQLNELLAALP +RQTLLFSATLP SLV
Sbjct: 246  FLHLKVEMNLDLKSVEYAVFDEADRLFEMGFQEQLNELLAALPSSRQTLLFSATLPTSLV 305

Query: 325  DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
            DFAKAGL NPVLVRLDAESK+S+NLEMLFL+TKN EREANLLY+LQEVI++P+AT EQ+K
Sbjct: 306  DFAKAGLVNPVLVRLDAESKISDNLEMLFLSTKNDEREANLLYILQEVIKLPLATPEQIK 365

Query: 385  QLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVS 444
            QL                               MP ANELPSEKAT++FVPTRHHVEY+S
Sbjct: 366  QLND-NKADDSDESAEEDEDKKRRKRKSFNRKAMPKANELPSEKATVVFVPTRHHVEYLS 424

Query: 445  QLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSL 504
             LLKD GYLVSYIYG LDQ+ARK QL+NFR GLTSILVVTDVAARGVDIPMLANV+N+SL
Sbjct: 425  NLLKDCGYLVSYIYGALDQHARKSQLYNFRIGLTSILVVTDVAARGVDIPMLANVVNYSL 484

Query: 505  PSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYDATCELMR 564
            P+SSKIFIHRVGRTARAGN GWAYSIVS              G+KILL PMY+A   L +
Sbjct: 485  PASSKIFIHRVGRTARAGNRGWAYSIVSENELPYLLDLELFLGRKILLTPMYEALERLSK 544

Query: 565  KQWVAEGKQESEFVAPRVSYTNRMVLGSCPRLEMESMGDLYKNLVESSFDLQLLKSVALK 624
            ++WVAEG  E+ F +P++SYT+RMVLGSCPRL++E++ +LY NL++S+FDL + K  ALK
Sbjct: 545  EKWVAEGNDETLFQSPKISYTSRMVLGSCPRLDIEALSELYNNLMKSNFDLDMAKKTALK 604

Query: 625  AEKLYFRTRAPASTEAMKRSKEIIASGWDEQNLKFGKNLEKEKLDFLAKLQNRNHKETVF 684
            AEKLYFRTR  AS E++KRSKEII+SGWDEQN+ FGKNLEKEK  FL KLQNR +KETVF
Sbjct: 605  AEKLYFRTRTSASPESLKRSKEIISSGWDEQNVLFGKNLEKEKNAFLEKLQNRRNKETVF 664

Query: 685  EFARNQEDEMAVLMXXXXXXXXXXXXXXXERQELLEKERMAGLRHTLEDEVLKGGDGEFG 744
            EF RN EDEMA LM               ER+ELLEKERMAGL H LEDE+LKG D E G
Sbjct: 665  EFTRNPEDEMANLMHRRRRAIAPIQRKAKERKELLEKERMAGLTHALEDEILKGDDAEVG 724

Query: 745  YSVPEEVLAQEFEDADKILDEQENKKKTKTMKTRQGETXXXXXXXXXXXTYKDPNFFLSH 804
            Y+V E+ L + FEDAD IL EQEN  K K                    T++DPNFFLSH
Sbjct: 725  YTVTEDTL-KAFEDADTILAEQENASKKK------------------KKTFRDPNFFLSH 765

Query: 805  YAPAGDIQDKQLQLTSGFTNDAADATFDLHDDNKVQVHKQTATVKWDKKRKKYVNAQGLD 864
            YAPA +IQDKQL+L+ GF N+AA + +DL+ D+KVQVHKQTATVKWDKKRKKYVN  G+D
Sbjct: 766  YAPANEIQDKQLELSGGFINEAAQSAYDLNSDDKVQVHKQTATVKWDKKRKKYVNMNGID 825

Query: 865  NKKYIIGESGQKIPASFRSGKFAEWSKARKLGPLKVGARETSGPSNLLSDPASG----GR 920
            NKKYIIGESGQKI ASFRSGKF EWSKARKL PLK GA E+S PSNLL DP  G    G 
Sbjct: 826  NKKYIIGESGQKIAASFRSGKFDEWSKARKLAPLKTGANESSIPSNLLVDPTRGPGKSGS 885

Query: 921  RVAGGRFKHKLDKAPKLPDRHRDDYKTQQKKVANALERGISVKGF-GAPGAKSEMKSTEQ 979
            ++  G+FKHKL+KAP+LPD+ RDDY  Q+KKV +ALERGI+VKG+  AP  KSE+KS  Q
Sbjct: 886  KLPNGKFKHKLEKAPRLPDKKRDDYHKQKKKVESALERGIAVKGYNNAPAFKSELKSVAQ 945

Query: 980  IRSQRVAKDKRLAKNARPSKKRKF 1003
            IR  R  K+ R AKNARPSKKRKF
Sbjct: 946  IRKDRKTKENRHAKNARPSKKRKF 969

>NDAI0G02870 Chr7 (664526..667501) [2976 bp, 991 aa] {ON} 
          Length = 991

 Score = 1215 bits (3144), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/866 (68%), Positives = 693/866 (80%), Gaps = 22/866 (2%)

Query: 145  ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
            I+ NI+++GFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF LPMI K+K HS+KIG
Sbjct: 141  IVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIKTHSSKIG 200

Query: 205  VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
             RAVILSPSRELAMQT+ VFKEFS+G+ LRSVLLTGGDSLE+QFGMMM NPDV+IATPGR
Sbjct: 201  ARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGR 260

Query: 265  FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
            FLHLKVEM+LDLK++EY VFDEADRLFEMGFQ+QLNELLA+LP  RQTLLFSATLP SLV
Sbjct: 261  FLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQTLLFSATLPSSLV 320

Query: 325  DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
            DFAKAGLTNPVLVRLDAESK+SENLEMLFL+TKN EREANLLYLLQ+VI+IP+AT EQ +
Sbjct: 321  DFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDVIKIPLATKEQQR 380

Query: 385  QL--RALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEY 442
            +   +                              +P AN+LPSEKATILFVPTRHHVEY
Sbjct: 381  KFNDQNKKDNESDSDADDNNNNNKNKKKRKFKKERLPPANQLPSEKATILFVPTRHHVEY 440

Query: 443  VSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINF 502
            +SQLLKDSGYL+SYIYGTLDQ+ARK+QL+NFR+GLTSILVVTDVAARGVDIPMLANVINF
Sbjct: 441  ISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINF 500

Query: 503  SLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYDATCEL 562
            SLP+SSKIFIHRVGRTARAGN GWAYSIVS              GKKI+L PMYD+ CE+
Sbjct: 501  SLPASSKIFIHRVGRTARAGNRGWAYSIVSESELPYLLDLELFLGKKIMLTPMYDSLCEI 560

Query: 563  MRKQWVAEGKQESEFVAPRVSYTNRMVLGSCPRLEMESMGDLYKNLVESSFDLQLLKSVA 622
            M+ +W+AEG  ES FV P+++YT+R++LGS PRLE+E +GDLYKN+++++F+L+L+K VA
Sbjct: 561  MKNKWIAEGNDESSFVNPKIAYTDRLILGSAPRLEVEGLGDLYKNMMQNNFELKLIKDVA 620

Query: 623  LKAEKLYFRTRAPASTEAMKRSKEIIASGWDEQNLKFGKNLEKEKLDFLAKLQNRNHKET 682
            +KAEKLYFRTR  AS E++KRSKEIIASGWDEQN+ FGKN EKEKLDFLAKLQNR +KET
Sbjct: 621  MKAEKLYFRTRTSASPESLKRSKEIIASGWDEQNVLFGKNQEKEKLDFLAKLQNRRNKET 680

Query: 683  VFEFARNQEDEMAVLMXXXXXXXXXXXXXXXERQELLEKERMAGLRHTLEDEVLKGGDGE 742
            VFEF+RN +DEM+V M               ER+ELL+ E+MAGL H++EDE+LKG D E
Sbjct: 681  VFEFSRNPDDEMSVFMKRRRRQLAPIQRKARERKELLQMEKMAGLTHSVEDEILKGDDNE 740

Query: 743  FGYSVPEEVLAQEFEDADKILDEQENKKKTKTMKTRQGETXXXXXXXXXXXTYKDPNFFL 802
             GYSV E+ L Q+F+DAD++L +QENK K      +  +                PNFFL
Sbjct: 741  AGYSVSEDTLKQQFQDADELLADQENKSKKDKKSKKSFKD---------------PNFFL 785

Query: 803  SHYAPAGDIQDKQLQLTSGFTNDAADATFDLHDDNKVQVHKQTATVKWDKKRKKYVNAQG 862
            SHYAPAGDIQDKQL+LT+GF NDAA   +DL++D+KVQVHKQTA VKWDKKRKKYVN QG
Sbjct: 786  SHYAPAGDIQDKQLELTTGFVNDAAKVAYDLNNDDKVQVHKQTAMVKWDKKRKKYVNTQG 845

Query: 863  LDNKKYIIGESGQKIPASFRSGKFAEWSKARKLGPLKVGARETSGPSNLLSDPASGGRRV 922
            LDNKKYIIGE GQKI ASFRSGKF EW+K RK+ PLKVGARET+ PSN+L++P +G    
Sbjct: 846  LDNKKYIIGEGGQKIAASFRSGKFDEWAKKRKMKPLKVGARETTIPSNILANPTNGSHGS 905

Query: 923  AG----GRFKHKLDKAPKLPDRHRDDYKTQQKKVANALERGISVKGFG-APGAKSEMKST 977
             G    G+FKHK  KAPK+PD+HRDDY  Q+KKV  AL  GI V+G+G APG  +E+KST
Sbjct: 906  QGNTIRGKFKHKQMKAPKMPDKHRDDYHIQKKKVEKALANGIQVRGYGNAPGMSNELKST 965

Query: 978  EQIRSQRVAKDKRLAKNARPSKKRKF 1003
            EQI   R  K+ + AKNARPSK+RKF
Sbjct: 966  EQIMKDRNVKENKRAKNARPSKRRKF 991

>Skud_4.220 Chr4 (389016..392021) [3006 bp, 1001 aa] {ON} YDL031W
            (REAL)
          Length = 1001

 Score = 1212 bits (3137), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 612/920 (66%), Positives = 707/920 (76%), Gaps = 29/920 (3%)

Query: 95   SFPTLELSXXXXXXXXXXXXX-----VNDYFSXXXXXXXXXXXXXXXXXXXXXXXILNNI 149
            +FPTLELS                  VN+YFS                       +LNNI
Sbjct: 100  AFPTLELSDDENDASGKTQADDDEDDVNEYFSTTNLEKTKHKKGSFPSFGLSKV-VLNNI 158

Query: 150  SRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVI 209
             RKGFRQPTPIQRKTIPLILQ+RDIVGMARTGSGKTAAF LPM+EKLK HS KIG RAVI
Sbjct: 159  KRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVI 218

Query: 210  LSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLK 269
            LSPSRELAMQT+ VFK+F++G++LRSVLLTGGDSLEEQF MMM NPDV+IATPGRFLHLK
Sbjct: 219  LSPSRELAMQTFNVFKDFAKGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLK 278

Query: 270  VEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLVDFAKA 329
            VEMNLDLK+VEYVVFDEADRLFEMGFQEQLNELLA+LP  RQTLLFSATLP+SLVDF KA
Sbjct: 279  VEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPARRQTLLFSATLPNSLVDFVKA 338

Query: 330  GLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLKQLRAL 389
            GL NPVLVRLD E+KVSENLEMLFL++KN +REANLLY+LQEVI+IP+AT+EQL++L+  
Sbjct: 339  GLVNPVLVRLDTETKVSENLEMLFLSSKNADREANLLYILQEVIKIPLATSEQLQKLQKS 398

Query: 390  XXXXXXXXXXXXXXXXXXXXXXXXX--XXXMPSANELPSEKATILFVPTRHHVEYVSQLL 447
                                          MP+ANELPSE+ATILFVPTRHHVEY+SQLL
Sbjct: 399  NNEADSDSDDENDRHKKKRNFKKEKFRKQKMPAANELPSERATILFVPTRHHVEYISQLL 458

Query: 448  KDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSLPSS 507
            +D GYL+SYIYGTLDQ+ARK+QL+NFR+GLTSILVVTDVAARGVDIPMLANVIN++LP S
Sbjct: 459  RDCGYLISYIYGTLDQHARKRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGS 518

Query: 508  SKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYDATCELMRKQW 567
            SKIF+HRVGRTARAGN GWAYSIVS              GKKILLAPMYD   + ++K+W
Sbjct: 519  SKIFVHRVGRTARAGNKGWAYSIVSENELPYLLDLELFLGKKILLAPMYDNLVDSIKKRW 578

Query: 568  VAEGKQESEFVAPRVSYTNRMVLGSCPRLEMESMGDLYKNLVESSFDLQLLKSVALKAEK 627
            + EG  E +F  P++SYT R+VLGSCPRL++E +GDLYKNL+ S+FDLQL    ++KAEK
Sbjct: 579  IDEGNLEFQFQPPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAMKTSMKAEK 638

Query: 628  LYFRTRAPASTEAMKRSKEIIASGWDEQNLKFGKNLEKEKLDFLAKLQNRNHKETVFEFA 687
            LY+RTR  AS E++KRSKEIIASGWD QN  FGKN EKEKLDFLAKLQNR +KETVFEF 
Sbjct: 639  LYYRTRTSASPESLKRSKEIIASGWDAQNAFFGKNEEKEKLDFLAKLQNRRNKETVFEFT 698

Query: 688  RNQEDEMAVLMXXXXXXXXXXXXXXXERQELLEKERMAGLRHTLEDEVLKGGDGEFGYSV 747
            RN +DEMAVLM               ER++LLEKERMAGL H++E+E+LKG DGE GY+V
Sbjct: 699  RNPDDEMAVLMKRRRKQLAPIQRKASERRKLLEKERMAGLSHSIENEILKGDDGETGYTV 758

Query: 748  PEEVLAQEFEDADKILDEQENKKKTKTMKTRQGETXXXXXXXXXXXTYKDPNFFLSHYAP 807
             EE L +EFEDAD++L+ QEN  K K                    T+KDP FFLSHYAP
Sbjct: 759  SEEAL-KEFEDADQLLEAQENDSKKKKKPK----------------TFKDPTFFLSHYAP 801

Query: 808  AGDIQDKQLQLTSGFTNDAADATFDLHDDNKVQVHKQTATVKWDKKRKKYVNAQGLDNKK 867
            AG+IQDKQLQ+ SGF NDAA A +DL+ D+KVQVHKQTATVKWDKKRKKYVN QG+DNKK
Sbjct: 802  AGEIQDKQLQIASGFANDAAHAAYDLNTDDKVQVHKQTATVKWDKKRKKYVNTQGIDNKK 861

Query: 868  YIIGESGQKIPASFRSGKFAEWSKARKLGPLKVGARETSGPSNLLSDPASG---GRRVAG 924
            YIIGESGQKI ASFRSG+F +WSKAR L PLK G+RE+S PSNLL+DP+ G     R A 
Sbjct: 862  YIIGESGQKIAASFRSGRFDDWSKARNLKPLKAGSRESSIPSNLLADPSQGPGSNGRTAR 921

Query: 925  GRFKHKLDKAPKLPDRHRDDYKTQQKKVANALERGISVKGF-GAPGAKSEMKSTEQIRSQ 983
            G+FKHK  KAPK+PD+HRD+Y +Q+KKV  AL+ G++VKG   APG  SE+KSTEQIR  
Sbjct: 922  GKFKHKQMKAPKMPDKHRDNYYSQKKKVEKALQSGVNVKGHNNAPGLSSELKSTEQIRKD 981

Query: 984  RVAKDKRLAKNARPSKKRKF 1003
            RV  +K+ AKNARPSKKRKF
Sbjct: 982  RVMAEKKRAKNARPSKKRKF 1001

>KNAG0K01110 Chr11 (215540..218545) [3006 bp, 1001 aa] {ON} Anc_3.159
            YDL031W
          Length = 1001

 Score = 1209 bits (3129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/925 (65%), Positives = 704/925 (76%), Gaps = 36/925 (3%)

Query: 95   SFPTLELSXXXXXXXX--XXXXXVNDYFSXXXXXXXXXXXXXXXXXXXXXXXILNNISRK 152
            +FP+LELS               VN YFS                       IL+N++RK
Sbjct: 97   AFPSLELSDDESSKAAGDASDDDVNAYFSTNNQAEKQKFKKGSFASFGLSKAILSNVTRK 156

Query: 153  GFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSP 212
            GFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF LPMIEKLK HS+KIGVRA+ILSP
Sbjct: 157  GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKTHSSKIGVRAIILSP 216

Query: 213  SRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEM 272
            SRELA+QT+ VFK+FS+G+ LRSVLLTGGDSLEEQFGMMM NPDVVIATPGRFLHLKVEM
Sbjct: 217  SRELALQTHNVFKDFSKGTHLRSVLLTGGDSLEEQFGMMMSNPDVVIATPGRFLHLKVEM 276

Query: 273  NLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLVDFAKAGLT 332
            NL LKTVEY VFDEADRLFEMGFQEQLNELLAALP +RQTLLFSATLP SLV+FAKAGLT
Sbjct: 277  NLVLKTVEYAVFDEADRLFEMGFQEQLNELLAALPSSRQTLLFSATLPSSLVEFAKAGLT 336

Query: 333  NPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLKQLR----- 387
            NPVLVRLDAESK+SENL+MLFL+ KN EREANLLYLLQ VI+IP+AT EQLK+LR     
Sbjct: 337  NPVLVRLDAESKISENLQMLFLSIKNDEREANLLYLLQNVIKIPLATPEQLKKLRDSDAK 396

Query: 388  --ALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVSQ 445
                                            +P+ANELPSE AT++FVPTRHHVEY+SQ
Sbjct: 397  FSESESEDESNEKRGGKRDFKKNGKKKFVKQRLPAANELPSENATVVFVPTRHHVEYISQ 456

Query: 446  LLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSLP 505
            +LKD GYLVSYIYG+LDQNARK QL+NFR GLTSILVVTDVAARGVDIPMLANVIN+SLP
Sbjct: 457  VLKDCGYLVSYIYGSLDQNARKSQLYNFRLGLTSILVVTDVAARGVDIPMLANVINYSLP 516

Query: 506  SSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYDATCELMRK 565
            SSSKIFIHRVGRTARAGN GWAY+IVS               KK+LL PM +A   ++++
Sbjct: 517  SSSKIFIHRVGRTARAGNKGWAYTIVSESELPYLLDLELFLSKKVLLTPMLEAKNAILKQ 576

Query: 566  QWVAEGKQESEFVAPRVSYTNRMVLGSCPRLEMESMGDLYKNLVESSFDLQLLKSVALKA 625
            +W+ +G  E  F  P VSYT+R+VLGSCPRL++ESMGDL+KN++E++FDL L+K+ +LKA
Sbjct: 577  KWIDQGNDEMSFKPPAVSYTDRIVLGSCPRLDLESMGDLFKNILENNFDLSLMKATSLKA 636

Query: 626  EKLYFRTRAPASTEAMKRSKEIIASGWDEQNLKFGKNLEKEKLDFLAKLQNRNHKETVFE 685
            EKLYFRTR  AS E++KRSKE+IASGWDEQN+ FG N+EKEK++FLAKLQNR +KETVFE
Sbjct: 637  EKLYFRTRTHASLESLKRSKEVIASGWDEQNIIFGSNVEKEKINFLAKLQNRRNKETVFE 696

Query: 686  FARNQEDEMAVLMXXXXXXXXXXXXXXXERQELLEKERMAGLRHTLEDEVLKGGDG---E 742
            F+RN +DEM+V M               ER+ELLEKER +GL H++EDE+    +    E
Sbjct: 697  FSRNPDDEMSVFMKRRRRQLAPVQKKAKERRELLEKERRSGLSHSIEDEIFNQNNNTEME 756

Query: 743  FGYSVPEEVLAQEFEDADKILDEQENKKKTKTMKTRQGETXXXXXXXXXXXTYKDPNFFL 802
             GY+V EE L Q FEDAD++L +Q ++KKTK                     YKDPNFFL
Sbjct: 757  TGYTVSEEALKQ-FEDADELLQKQ-SEKKTKP------------------KNYKDPNFFL 796

Query: 803  SHYAPAGDIQDKQLQLTSGFTNDAADATFDLHDDNKVQVHKQTATVKWDKKRKKYVNAQG 862
            SHYAPA DIQDKQLQ+TSGFTNDAA A +DL+DD+KVQVHKQTATVKWDKKRKKYVN QG
Sbjct: 797  SHYAPAADIQDKQLQVTSGFTNDAAQAAYDLNDDDKVQVHKQTATVKWDKKRKKYVNMQG 856

Query: 863  LDNKKYIIGESGQKIPASFRSGKFAEWSKARKLGPLKVGARETSGPSNLLSDPAS----G 918
            +DNKKYIIGESGQKI ASFRSGKF EWSKAR + PLKVGA+E S  ++LL DP       
Sbjct: 857  IDNKKYIIGESGQKIAASFRSGKFDEWSKARHIKPLKVGAKEDSIETHLLRDPTGRSNIS 916

Query: 919  GRRVAGGRFKHKLDKAPKLPDRHRDDYKTQQKKVANALERGISVKGFGAPGAKSEMKSTE 978
            G R A G++KHK DKAPKLPD+HRD+Y +Q+KK+A+A+ERG  VKGF  PG +SE+KST 
Sbjct: 917  GNRTASGKYKHKQDKAPKLPDKHRDNYHSQKKKIASAMERGTYVKGFNGPGTQSELKSTA 976

Query: 979  QIRSQRVAKDKRLAKNARPSKKRKF 1003
            QIR  R+  +K+ AKNARP+KKRKF
Sbjct: 977  QIRKGRLQAEKKKAKNARPNKKRKF 1001

>TPHA0M00330 Chr13 complement(61976..64921) [2946 bp, 981 aa] {ON} 
          Length = 981

 Score = 1182 bits (3059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/896 (66%), Positives = 682/896 (76%), Gaps = 29/896 (3%)

Query: 116  VNDYFSXXXXXXXXXXXXXXXXXXXXXXXILNNISRKGFRQPTPIQRKTIPLILQTRDIV 175
            VNDYFS                       IL+NI++KGFRQPTPIQRKTIPLILQ RDIV
Sbjct: 107  VNDYFSTNMQDKSKHKKGSFPSFGLSKL-ILSNINKKGFRQPTPIQRKTIPLILQRRDIV 165

Query: 176  GMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRS 235
            GMARTGSGKTAAF LPMIEKLK HS KIG RAVILSPSRELAMQT+KVFK+FSRGS LRS
Sbjct: 166  GMARTGSGKTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHKVFKDFSRGSQLRS 225

Query: 236  VLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGF 295
            VLLTGGDSLEEQF MMM NPDV++ATPGRF+HLKVEM LDLKTVEYVVFDEADRLFEMGF
Sbjct: 226  VLLTGGDSLEEQFSMMMSNPDVIVATPGRFMHLKVEMGLDLKTVEYVVFDEADRLFEMGF 285

Query: 296  QEQLNELLAALPPTRQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLT 355
            QEQLNELLA+LP  RQTLLFSATLP+SLVDFAKAGLTNPVLVRLDAESK+SENL++ F +
Sbjct: 286  QEQLNELLASLPMNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDAESKISENLQLAFFS 345

Query: 356  TKNGEREANLLYLLQEVIRIPVATAEQLKQL-----RALXXXXXXXXXXXXXXXXXXXXX 410
            TKN EREA LLY+LQ+VI + + T E++K+L     R+                      
Sbjct: 346  TKNEEREATLLYILQDVIDLQIGTEEEIKKLTASNKRSDEIDSDNEREQADRKLNKKKKF 405

Query: 411  XXXXXXXMPSANELPSEKATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQL 470
                   +PSANELPSEKATI+FVPTRHHVEY+S LLKD GYLVSY+YGTLDQ+ARK QL
Sbjct: 406  EKFIKPKLPSANELPSEKATIVFVPTRHHVEYISNLLKDCGYLVSYLYGTLDQHARKHQL 465

Query: 471  FNFRSGLTSILVVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSI 530
            FNFR+GLTSILVVTDVAARGVDIPMLANVIN+SLP+SSKIF+HRVGRTARAGN GWAYSI
Sbjct: 466  FNFRAGLTSILVVTDVAARGVDIPMLANVINYSLPASSKIFVHRVGRTARAGNKGWAYSI 525

Query: 531  VSXXXXXXXXXXXXXXGKKILLAPMYDATCELMRKQWVAEGKQESEFVAPRVSYTNRMVL 590
             S              GKKILL  MY+ATC L + +W+A G +E  F  P+ SYT+RM+L
Sbjct: 526  ASETELPYLLDLELFLGKKILLTQMYEATCSLAKNKWIAAGNEEYTFQPPKPSYTDRMIL 585

Query: 591  GSCPRLEMESMGDLYKNLVESSFDLQLLKSVALKAEKLYFRTRAPASTEAMKRSKEIIAS 650
            GSCPRLE+E++GDLYKN++ +SFDLQ+ K  +LKAEKLYFRTR  AS E++KR KE+IAS
Sbjct: 586  GSCPRLELENIGDLYKNIMSASFDLQMAKKTSLKAEKLYFRTRTAASPESIKRGKELIAS 645

Query: 651  GWDEQNLKFGKNLEKEKLDFLAKLQNRNHKETVFEFARNQEDEMAVLMXXXXXXXXXXXX 710
            GWDEQ++ FGKN+EKEKLDFL+K QNRN+KETVFEF RN  D  AVLM            
Sbjct: 646  GWDEQHIMFGKNVEKEKLDFLSKFQNRNNKETVFEFGRNPTDATAVLMNRRRRQLAPIQR 705

Query: 711  XXXERQELLEKERMAGLRHTLEDEVLKGGDGEFGYSVPEEVLAQEFEDADKILDEQENKK 770
               ER++LLEKER+AGL H LEDE+LKG D E GY++ +E LA  FEDADK+L EQE KK
Sbjct: 706  KAVERRKLLEKERLAGLSHALEDEILKGEDHESGYTISKEALAA-FEDADKLLQEQEKKK 764

Query: 771  KTKTMKTRQGETXXXXXXXXXXXTYKDPNFFLSHYAPAGDIQDKQLQLTSGFTNDAADAT 830
            +                         DP FFLSHYAPA DIQDKQL LTSGFTNDAA A 
Sbjct: 765  RKPKTYK-------------------DPQFFLSHYAPAKDIQDKQLNLTSGFTNDAAQAA 805

Query: 831  FDLHDDNKVQVHKQTATVKWDKKRKKYVNAQGLDNKKYIIGESGQKIPASFRSGKFAEWS 890
            +DL++D+KVQVHKQTA +KWDK RKKYVN  GLDNKKYIIGE GQKIPASF+SG+F EWS
Sbjct: 806  YDLNNDDKVQVHKQTANIKWDKGRKKYVNINGLDNKKYIIGEGGQKIPASFKSGRFDEWS 865

Query: 891  KARKLGPLKVGARETSGPSNLLSDPA--SGGRRVAGGRFKHKLDKAPKLPDRHRDDYKTQ 948
            KAR + PLK G RE S P+NLL+D    S G R  GGRFKHK +KAP+LPD+HRDDY++Q
Sbjct: 866  KARHIKPLKAGVREDSIPTNLLADVTGPSDGSRTFGGRFKHKQNKAPRLPDKHRDDYESQ 925

Query: 949  QKKVANALERGISVKGFGAPGA-KSEMKSTEQIRSQRVAKDKRLAKNARPSKKRKF 1003
            +KKV NALERG+ VKG+    + KSE+K+  QIR +R+  + +  KNARPSKKRK+
Sbjct: 926  KKKVQNALERGVQVKGYNNRNSVKSELKTVAQIRKERMVNENKQKKNARPSKKRKY 981

>ZYRO0B04972g Chr2 complement(401735..404674) [2940 bp, 979 aa] {ON}
            similar to uniprot|Q12389 Saccharomyces cerevisiae
            YDL031W DBP10 Essential protein involved in ribosome
            biogenesis putative ATP-dependent RNA helicase of the
            DEAD- box protein family
          Length = 979

 Score = 1167 bits (3019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/862 (67%), Positives = 684/862 (79%), Gaps = 21/862 (2%)

Query: 145  ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
            ILNNI++KGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF LPMIEKLK HS+KIG
Sbjct: 134  ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193

Query: 205  VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
             RAVILSPSRE+AMQTYKVFKEFS+GSDLRSVLLTGGDSLE+QFGMMM NPDVV+ATPGR
Sbjct: 194  ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253

Query: 265  FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
            FLHLKVEMNL+LK+VEY VFDEADRLFEMGF EQLNELLA+LP  RQTLLFSATLP++LV
Sbjct: 254  FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313

Query: 325  DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
            DFAKAGLTNPVLVRLDAESK+SENLEMLF++TK+ EREANL YLLQEVI+IP+AT EQ  
Sbjct: 314  DFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKM 373

Query: 385  QL----RALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHV 440
             L    +AL                            +PSANELPSEKATI+FVPTRHHV
Sbjct: 374  ILGEGNKALSDSEDSDAENGKKDRRKKGKKNKAKRPKLPSANELPSEKATIVFVPTRHHV 433

Query: 441  EYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVI 500
            EY+SQLLK  GYLVSYIYGTLDQ+AR++QL+NFR+GLTSILVVTDVAARGVDIPMLANVI
Sbjct: 434  EYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVI 493

Query: 501  NFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYDATC 560
            NF++PSSSKIF+HRVGRTARAGN GWAYSIVS              GKKILLAPMY+ATC
Sbjct: 494  NFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLELFLGKKILLAPMYEATC 553

Query: 561  ELMRKQWVAEGKQESEFVAPRVSYTNRMVLGSCPRLEMESMGDLYKNLVESSFDLQLLKS 620
             L++++WV EG  E  F  P+VSYT+RMVLGSCPR+E+ESMGDLYKNL++S++DL   + 
Sbjct: 554  NLLKEKWVNEGNDEFRFQPPKVSYTDRMVLGSCPRIELESMGDLYKNLMDSNYDLGSTRG 613

Query: 621  VALKAEKLYFRTRAPASTEAMKRSKEIIASGWDEQNLKFGKNLEKEKLDFLAKLQNRNHK 680
            V++KAE +Y RTR PAS E+MKR+K++I SGWDEQN+ FGKN+E EK  FLAKLQ+R +K
Sbjct: 614  VSIKAEIMYMRTRQPASAESMKRAKQMIISGWDEQNILFGKNMEAEKNKFLAKLQDRRNK 673

Query: 681  ETVFEFARNQEDEMAVLMXXXXXXXXXXXXXXXERQELLEKERMAGLRHTLEDEVLKGGD 740
            ETVFEFARN +D+M+VLM               +RQEL+EKE++AGL H+LEDEVL    
Sbjct: 674  ETVFEFARNPDDKMSVLMKKRRQQLEPVQLRAKQRQELMEKEKLAGLTHSLEDEVLDKYK 733

Query: 741  GEFGYSVPEEVLAQEFEDADKILDEQENKKKTKTMKTRQGETXXXXXXXXXXXTYKDPNF 800
            GE GYSVP+ VL +EFEDAD++L++QE + K +  K++               ++KD NF
Sbjct: 734  GEVGYSVPDAVL-EEFEDADQVLEDQETEGKKQKQKSK---------------SFKDSNF 777

Query: 801  FLSHYAPAGDIQDKQLQLTSGFTNDAADATFDLHDDNKVQVHKQTATVKWDKKRKKYVNA 860
            F+SHYAPA  +QD QL ++SGFT DAA A++DL+DD+K+QVHKQTATVKWDKK+KKYVN 
Sbjct: 778  FMSHYAPAQSVQDSQLNISSGFTTDAAQASYDLNDDDKIQVHKQTATVKWDKKKKKYVNP 837

Query: 861  QGLDNKKYIIGESGQKIPASFRSGKFAEWSKARKLGPLKVGARETSGPSNLLSDPASGGR 920
            QG DN +YI  ESGQKIPAS+RSGKF EWSK RKL   KVG+RE+S  +NLL DP  G  
Sbjct: 838  QGADNVRYITSESGQKIPASYRSGKFDEWSKKRKLKMPKVGSRESSMATNLLQDPTRGNP 897

Query: 921  RVAGGRFKHKLDKAPKLPDRHRDDYKTQQKKVANALERGISVKGF-GAPGAKSEMKSTEQ 979
                 RF HK  KAPK+PD++RDDY  Q+ KVA ALE+GI VKG   APG  +E++S +Q
Sbjct: 898  SSNNRRFMHKQVKAPKVPDKYRDDYGKQKTKVAKALEKGIHVKGHNNAPGMTNELRSADQ 957

Query: 980  IRSQRVAKDKRLAKNARPSKKR 1001
            IR QRV KDKR AKNAR  KKR
Sbjct: 958  IRKQRVVKDKRRAKNARVGKKR 979

>TDEL0D04630 Chr4 complement(849268..852174) [2907 bp, 968 aa] {ON}
            Anc_3.159 YDL031W
          Length = 968

 Score = 1164 bits (3010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/918 (64%), Positives = 697/918 (75%), Gaps = 37/918 (4%)

Query: 95   SFPTLELSXXXXXXXXXXXXXVNDYFSXXXXXXXXXXXXXXXXXXXXXXXILNNISRKGF 154
            SFP LE S             VN+YFS                       ILNNISRKGF
Sbjct: 79   SFPKLEASGDEAEDDADD---VNEYFSTTAQTNKKHKKGSFPSFGLSKL-ILNNISRKGF 134

Query: 155  RQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPSR 214
             QPTPIQRKTIPLILQ+RDIVG+ARTGSGKTAAF LPMIEKLK HS+K+G RAVILSPSR
Sbjct: 135  HQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHSSKVGARAVILSPSR 194

Query: 215  ELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMNL 274
            ELAMQT+KVFK+FSRG+ LRSVLLTGGDSLEEQFGMMM NPDV++ATPGRFLHLKVEMNL
Sbjct: 195  ELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVATPGRFLHLKVEMNL 254

Query: 275  DLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLVDFAKAGLTNP 334
            DLK++EY VFDE+DRLFEMGF+EQLNELLAALP  RQTLLFSATLP+SLVDFAKAGLTNP
Sbjct: 255  DLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNP 314

Query: 335  VLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLKQLRALX-XXX 393
            VLVRLD ESK+SENLEMLFL+TK+ EREA LLYL+QEVI+IP+AT EQ+K ++       
Sbjct: 315  VLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVIQIPLATEEQIKLIKDKSPDSD 374

Query: 394  XXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVSQLLKDSGYL 453
                                    MP+AN+LPSEK+TILFVPTRHHVEY++ LLK+ GYL
Sbjct: 375  EESDDDNGKRSHNKHKKEKFKKVRMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYL 434

Query: 454  VSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSLPSSSKIFIH 513
            VSYIYG+LDQ AR +QL+NFR+GLTSILVVTDVAARGVDIPMLANVINFS PSSSKIF+H
Sbjct: 435  VSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVH 494

Query: 514  RVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYDATCELMRKQWVAEGKQ 573
            RVGRTARAGN GWAYSI+S              GKKIL  PMY+A  +L+ K+WV EGK+
Sbjct: 495  RVGRTARAGNRGWAYSIISESELPYLLDLELFLGKKILTTPMYEAATDLLEKRWVEEGKE 554

Query: 574  ESEFVAPRVSYTNRMVLGSCPRLEMESMGDLYKNLVESSFDLQLLKSVALKAEKLYFRTR 633
            +  F AP+ SYTNR+VLGSCPRL+++SMGDLYKNL+ SSF+L+ L+ VA KAEKLY RTR
Sbjct: 555  KILFKAPKPSYTNRLVLGSCPRLDIDSMGDLYKNLM-SSFELETLRGVAKKAEKLYLRTR 613

Query: 634  APASTEAMKRSKEIIASGWDEQNLKFGKNLEKEKLDFLAKLQNRNHKETVFEFARNQEDE 693
              AS E++KRS+E++ SGWDEQN+ FGKNLEKEKLDFLAKLQ+R +KETVFEFARN +DE
Sbjct: 614  TAASVESVKRSRELMTSGWDEQNVMFGKNLEKEKLDFLAKLQDRTNKETVFEFARNADDE 673

Query: 694  MAVLMXXXXXXXXXXXXXXXERQELLEKERMAGLRHTLEDEVLKGGDGEF-GYSVPEEVL 752
             ++LM               +R+ELLE ++ AG  H +EDE+L   D E    SVPEEVL
Sbjct: 674  TSMLMKKRRFQVAPITEKAKKRKELLELQKAAGFSHAMEDELL--NDNELIKESVPEEVL 731

Query: 753  AQEFEDADKILDEQE--NKKKTKTMKTRQGETXXXXXXXXXXXTYKDPNFFLSHYAPAGD 810
             QEFEDADK+L++QE   +KK+K                    +++DPNFFLSHYAP G 
Sbjct: 732  -QEFEDADKLLEDQEKLGRKKSK--------------------SFRDPNFFLSHYAPQGG 770

Query: 811  IQDKQLQLTSGFTNDAADATFDLHDDNKVQVHKQTATVKWDKKRKKYVNAQGLDNKKYII 870
            + + +L LTSGFT DAA A  D++ D+KVQVHKQ ATVKWD K+KKY+N+QG DNKKYI+
Sbjct: 771  LHENELNLTSGFTTDAAQAACDINGDDKVQVHKQNATVKWDSKKKKYINSQGADNKKYIV 830

Query: 871  GESGQKIPASFRSGKFAEWSKARKLGPLKVGARETSGPSNLLSDPA----SGGRRVAGGR 926
            GESGQKIPASFRSGK+AEWSKAR L P+KVGARE+   +N+L +PA    + G+R  GG+
Sbjct: 831  GESGQKIPASFRSGKYAEWSKARNLQPIKVGARESPTAANMLRNPAQNHPTDGQRTVGGK 890

Query: 927  FKHKLDKAPKLPDRHRDDYKTQQKKVANALERGISVKGFGAPGA-KSEMKSTEQIRSQRV 985
            FKHK  KAPKLPD+HRDDY  Q+KKV  AL++GI+VKG+   GA K+E++S  QIR QR 
Sbjct: 891  FKHKQVKAPKLPDKHRDDYHKQKKKVKEALDKGINVKGYNTRGAPKNELQSIAQIRKQRQ 950

Query: 986  AKDKRLAKNARPSKKRKF 1003
              +K+ AKNARPSKKRK+
Sbjct: 951  TSEKKHAKNARPSKKRKY 968

>TBLA0B01590 Chr2 (349441..352230) [2790 bp, 929 aa] {ON} Anc_3.159
           YDL031W
          Length = 929

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/554 (63%), Positives = 423/554 (76%), Gaps = 21/554 (3%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           I+NNI++KG++QPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF LPMIEKLK HS+KIG
Sbjct: 116 IMNNINKKGYKQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFLLPMIEKLKTHSSKIG 175

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
           VR VILSPSRE+A+QT++VFKEFS+ ++LRSVLLTGGDSLE+QFGMMM NPDVVIATPGR
Sbjct: 176 VRGVILSPSREIAIQTHRVFKEFSKNTELRSVLLTGGDSLEDQFGMMMSNPDVVIATPGR 235

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
           FLHLKVEM LDLK+VEY+VFDEADRLFEMGF+EQLNELLAALP  RQ+LLFSATLP+SLV
Sbjct: 236 FLHLKVEMKLDLKSVEYIVFDEADRLFEMGFEEQLNELLAALPDNRQSLLFSATLPNSLV 295

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
           +FAKAGL NPVLV+LD ESK+S+NLEMLFL+ K  ERE+NLL+LLQ+VI +PVA+ E++K
Sbjct: 296 EFAKAGLKNPVLVKLDQESKISDNLEMLFLSCKKEERESNLLFLLQDVIGVPVASTEEMK 355

Query: 385 QLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVS 444
           + +                                 ++E+P E+ATI+FVPTRHHVEY+S
Sbjct: 356 RFQT-----DSREVEEKEEKEKEKGKEKEKRAKYYKSDEIPHEQATIIFVPTRHHVEYIS 410

Query: 445 QLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSL 504
           QLL   GYLVSY+YGTLDQ+AR+ QL  F  G+T ILVVTDVAARGVDIP+L NVIN+SL
Sbjct: 411 QLLMKCGYLVSYLYGTLDQHARRNQLRQFCFGITRILVVTDVAARGVDIPLLPNVINYSL 470

Query: 505 PSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYDATCELMR 564
           P SSKIF+HRVGRTARAGN GWAYSIVS              GKK++       T  ++ 
Sbjct: 471 PGSSKIFVHRVGRTARAGNRGWAYSIVSESELPYLVELGTFLGKKVI-------TTGMVE 523

Query: 565 KQWVAEGKQESEFVAPRVSYTNRMVLGSCPRLEMESMGDLYKNLVESSFDLQLLKSVALK 624
           K  V+  K         +SY   MVLGS PR+++ES GDLYKN+ +  FDLQ+ K    K
Sbjct: 524 KLGVSFDK---------ISYNKWMVLGSGPRVDVESFGDLYKNVYDQEFDLQMSKKTCEK 574

Query: 625 AEKLYFRTRAPASTEAMKRSKEIIASGWDEQNLKFGKNLEKEKLDFLAKLQNRNHKETVF 684
           AEKLY RTR  AS +++KRSKE+I   WD QN+KFG++LE+ KL+ L K   R +KETVF
Sbjct: 575 AEKLYLRTRGGASNDSVKRSKELILQKWDGQNVKFGQDLERAKLELLNKFALRKNKETVF 634

Query: 685 EFARNQEDEMAVLM 698
           EF +N EDEM+ LM
Sbjct: 635 EFGKNGEDEMSTLM 648

>CAGL0D03124g Chr4 complement(321029..323206) [2178 bp, 725 aa] {ON}
           highly similar to uniprot|P32892 Saccharomyces
           cerevisiae YLL008w DRS1 RNA helicase of the DEAD box
           family
          Length = 725

 Score =  223 bits (568), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 134/391 (34%), Positives = 212/391 (54%), Gaps = 53/391 (13%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           ++  +S  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF +P+IE+L    AK+ 
Sbjct: 217 VMKGLSNLGYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKVA 276

Query: 205 -VRAVILSPSRELAMQTYKVFKEFSR-GSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATP 262
             R ++L+P+RELA+Q   V K+  +  S+L   L  GG +L +Q  M+   PD+VIATP
Sbjct: 277 STRVIVLTPTRELAIQVADVGKKIGQFVSNLTFGLAVGGLNLRQQEQMLKTRPDIVIATP 336

Query: 263 GRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           GRF+ H++   + ++ +VE +V DEADR+ E GFQ++LNE+++ LP  RQTLLFSAT+  
Sbjct: 337 GRFIDHIRNSASFNVDSVEVLVIDEADRMLEDGFQDELNEIMSLLPSKRQTLLFSATMNS 396

Query: 322 SLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGER-EANLLYLLQEVIRIPVATA 380
            +       L  PV + +D   + +  L   F+  +  +  + +LL+ L           
Sbjct: 397 RIKQLISLSLKRPVRIMIDPPKQAATKLTQEFVRIRKRDHLKPSLLFNL----------- 445

Query: 381 EQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHV 440
                +R L                             P+      +K  ++FV  +   
Sbjct: 446 -----IRKLD----------------------------PNG-----QKRIVVFVARKDMA 467

Query: 441 EYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVI 500
             +  +L   G  V+ ++G+L Q  R   +  F+S    +L+ TD+A+RG+DIP +  VI
Sbjct: 468 HKLRIILGLLGMAVAELHGSLTQEQRLDSVNKFKSLQVPVLICTDLASRGLDIPKIEVVI 527

Query: 501 NFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           N+ +P S +I++HRVGRTARAG  G + + V
Sbjct: 528 NYDMPKSYEIYLHRVGRTARAGREGRSITFV 558

>ZYRO0B10318g Chr2 complement(808717..810969) [2253 bp, 750 aa] {ON}
           similar to uniprot|P32892 Saccharomyces cerevisiae
           YLL008W DRS1 Nucleolar DEAD-box protein required for
           ribosome assembly and function including synthesis of
           60S ribosomal subunits
          Length = 750

 Score =  221 bits (564), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 130/392 (33%), Positives = 210/392 (53%), Gaps = 55/392 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +   G+  P+PIQ  TIP+ L  +DI+  A TGSGKTAAF +P+IE+L    AK+ 
Sbjct: 248 VLKALGDLGYATPSPIQGATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLIYKPAKVA 307

Query: 205 -VRAVILSPSRELAMQTYKVFKEFSRGSD-LRSVLLTGGDSLEEQFGMMMGNPDVVIATP 262
             R ++L+P+RELA+Q   V K+  +  + L   +  GG +L +Q  ++   PD+VIATP
Sbjct: 308 STRVIVLAPTRELAIQVADVGKKLGKYVNGLTFGIAVGGLNLRQQEQILKTRPDIVIATP 367

Query: 263 GRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           GRF+ H++   + ++ +VE +V DEADR+ E GFQ+++NE++  LP  RQT+LFSAT+  
Sbjct: 368 GRFIDHIRNSSSFNVDSVEVLVIDEADRMLEEGFQDEINEIMHLLPSKRQTMLFSATMNS 427

Query: 322 SLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGE--REANLLYLLQEVIRIPVAT 379
            +       L  PV V  D   +    L+  F+  +  +  + + L YL++++       
Sbjct: 428 KIKQLVSLSLKRPVRVMTDPPQQAVSKLQQEFVRIRKRDHLKPSTLFYLIKKL------- 480

Query: 380 AEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHH 439
                                                      +  ++K  ++FV  +  
Sbjct: 481 -------------------------------------------DGAAQKRMVVFVSKKEM 497

Query: 440 VEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANV 499
           V  +  +L   G  V+ ++G+L+Q  R Q +  F+S    +L+ TD+A+RG+DIP +  V
Sbjct: 498 VHRLRIILGLLGMAVAELHGSLNQEQRLQSINKFKSLEVPVLICTDLASRGLDIPKIEVV 557

Query: 500 INFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           IN+ +P S +I++HRVGRTARAG  G + S V
Sbjct: 558 INYDMPKSFEIYLHRVGRTARAGREGRSVSFV 589

>YLL008W Chr12 (131729..133987) [2259 bp, 752 aa] {ON}
           DRS1Nucleolar DEAD-box protein required for ribosome
           assembly and function, including synthesis of 60S
           ribosomal subunits; constituent of 66S pre-ribosomal
           particles
          Length = 752

 Score =  220 bits (560), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 137/393 (34%), Positives = 207/393 (52%), Gaps = 57/393 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF +P+IE+L    AKI 
Sbjct: 242 VLKGLASLGYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKIA 301

Query: 205 -VRAVILSPSRELAMQTYKVFKEFSR-GSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATP 262
             R ++L P+RELA+Q   V K+ +R  S +   L  GG +L +Q  M+   PD+VIATP
Sbjct: 302 STRVIVLLPTRELAIQVADVGKQIARFVSGITFGLAVGGLNLRQQEQMLKSRPDIVIATP 361

Query: 263 GRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           GRF+ H++   + ++ +VE +V DEADR+ E GFQ++LNE++  LP  RQ LLFSAT+  
Sbjct: 362 GRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIMGLLPSNRQNLLFSATMNS 421

Query: 322 SLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAE 381
            +       L  PV + +D   K +  L   F+  +  +R+     LL  +IR    T +
Sbjct: 422 KIKSLVSLSLKKPVRIMIDPPKKAATKLTQEFVRIR--KRDHLKPALLFNLIRKLDPTGQ 479

Query: 382 QLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVP---TRH 438
                                                         K  ++FV    T H
Sbjct: 480 ----------------------------------------------KRIVVFVARKETAH 493

Query: 439 HVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLAN 498
            +  +  LL   G  V  ++G+L Q  R   +  F++    +L+ TD+A+RG+DIP +  
Sbjct: 494 RLRIIMGLL---GMSVGELHGSLTQEQRLDSVNKFKNLEVPVLICTDLASRGLDIPKIEV 550

Query: 499 VINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           VIN+ +P S +I++HRVGRTARAG  G + + V
Sbjct: 551 VINYDMPKSYEIYLHRVGRTARAGREGRSVTFV 583

>Smik_12.55 Chr12 (118743..120950) [2208 bp, 735 aa] {ON} YLL008W
           (REAL)
          Length = 735

 Score =  220 bits (560), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 136/395 (34%), Positives = 210/395 (53%), Gaps = 61/395 (15%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF +P+IE+L    AKI 
Sbjct: 225 VLKGLASLGYAKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKIA 284

Query: 205 -VRAVILSPSRELAMQTYKVFKEFSR-GSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATP 262
             R ++L P+RELA+Q   V K+ +R  S +   L  GG +L +Q  M+   PD+VIATP
Sbjct: 285 STRVIVLLPTRELAIQVADVGKQIARFVSGITFGLAVGGLNLRQQEQMLKSRPDIVIATP 344

Query: 263 GRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           GRF+ H++   + ++ +VE +V DEADR+ E GFQ++LNE++  LP  RQ LLFSAT+  
Sbjct: 345 GRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIMGLLPSNRQNLLFSATMNS 404

Query: 322 SLVDFAKAGLTNPVLVRLDAESKVSENL--EMLFLTTKNGEREANLLYLLQEVIRIPVAT 379
            +       L  PV + +D   K +  L  E + +  ++  + A L  L++++   PV  
Sbjct: 405 KIKSLVSLSLKKPVRIMIDPPKKAATKLTQEFVRIRKRDHLKPALLFNLIRKLD--PVG- 461

Query: 380 AEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVP---T 436
                                                          +K  ++FV    T
Sbjct: 462 -----------------------------------------------QKRIVVFVARKET 474

Query: 437 RHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPML 496
            H +  +  LL   G  V  ++G+L Q  R   +  F++    +L+ TD+A+RG+DIP +
Sbjct: 475 AHRLRIIMGLL---GMSVGELHGSLTQEQRLDSVNKFKNLEVPVLICTDLASRGLDIPKI 531

Query: 497 ANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
             VIN+ +P S +I++HRVGRTARAG  G + + V
Sbjct: 532 EVVINYDMPKSHEIYLHRVGRTARAGREGRSVTFV 566

>TPHA0N00700 Chr14 (157186..159453) [2268 bp, 755 aa] {ON} Anc_5.208
           YLL008W
          Length = 755

 Score =  219 bits (559), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 133/392 (33%), Positives = 209/392 (53%), Gaps = 55/392 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +S  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF +P+IE+L    A I 
Sbjct: 231 VLKGLSDLGYTKPSPIQSATIPIGLLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPANIA 290

Query: 205 -VRAVILSPSRELAMQTYKVFKEFSRGSD-LRSVLLTGGDSLEEQFGMMMGNPDVVIATP 262
             R ++L+P+RELA+Q   V K   +  + L   L  GG +L +Q   +   PDVVIATP
Sbjct: 291 STRVIVLTPTRELAIQVSDVGKRIGKYVNGLTFGLAVGGLNLRQQEQELKTRPDVVIATP 350

Query: 263 GRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           GRF+ H++   + ++ +VE +V DEADR+ E GFQE+LNE+++ LP  RQTLLFSAT+  
Sbjct: 351 GRFIDHIRNSASFNVDSVEVLVIDEADRMLEDGFQEELNEIMSLLPTKRQTLLFSATMNS 410

Query: 322 SLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGE--REANLLYLLQEVIRIPVAT 379
            +       L  PV + ++   + +  L   F+  +  +  + A L YL++++       
Sbjct: 411 KIKQLISLSLRRPVRIMINPPKQAAARLTQEFVRIRKRDLLKPALLYYLIRKL------- 463

Query: 380 AEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHH 439
                                                      +  S+K  ++FV  +  
Sbjct: 464 -------------------------------------------DSSSQKRIVVFVSRKEM 480

Query: 440 VEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANV 499
              +  ++   G  V+ ++G+L Q  R Q +  F+S    +L+ TD+A+RG+DIP +  V
Sbjct: 481 AHRLRIIMGLLGMKVAELHGSLTQEQRLQSVNQFKSLEVPVLICTDLASRGLDIPKIEVV 540

Query: 500 INFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           IN+ +P S +I++HRVGRTARAG  G + + V
Sbjct: 541 INYDMPKSYEIYLHRVGRTARAGREGRSVTFV 572

>KNAG0H02520 Chr8 complement(463527..465791) [2265 bp, 754 aa] {ON}
           Anc_5.208 YLL008W
          Length = 754

 Score =  219 bits (559), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 133/393 (33%), Positives = 211/393 (53%), Gaps = 57/393 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  ++  G+ +P+PIQ  TIP+ LQ +D++  A TGSGKTAAF +P+IE+L    +K+ 
Sbjct: 250 VLKGLAHLGYTKPSPIQSATIPVALQGKDVIAGAVTGSGKTAAFMIPIIERLLFKPSKVA 309

Query: 205 V-RAVILSPSRELAMQTYKVFKEFSR-GSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATP 262
           + R ++L+P+RELA+Q   V K+  +  S L   L  GG +L +Q   +   PD+VIATP
Sbjct: 310 MTRVIVLTPTRELAIQISDVAKKIGQFVSGLTFGLAVGGLNLRQQEQALKARPDIVIATP 369

Query: 263 GRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           GRF+ H++   + ++ +VE +V DEADR+ E GFQ++L E++  LP  RQ LLFSAT+  
Sbjct: 370 GRFIDHIRNSASFNVDSVEILVLDEADRMLEEGFQDELKEIMTMLPSKRQNLLFSATMNS 429

Query: 322 SLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAE 381
            +       L  PV + +D   + +  L   F+  +  +R+     LL  +IR   + A+
Sbjct: 430 KIKSLVSLSLRRPVRIMIDPPKQAASKLTQEFVRIR--KRDNLKPALLFNLIRKLDSNAQ 487

Query: 382 QLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVP---TRH 438
                                                         K  ++FV    T H
Sbjct: 488 ----------------------------------------------KRIVVFVARKETAH 501

Query: 439 HVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLAN 498
            +  +  LL   G  V+ ++G+L Q  R + +  F+S    +L+ TD+A+RG+DIP +  
Sbjct: 502 RLRIILGLL---GMAVAELHGSLTQEQRLESVTRFKSLDVPVLICTDLASRGLDIPKIEV 558

Query: 499 VINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           VIN+ +P S +I++HRVGRTARAG  G + ++V
Sbjct: 559 VINYDMPKSHEIYLHRVGRTARAGREGRSVTLV 591

>KLLA0F15752g Chr6 (1454735..1456981) [2247 bp, 748 aa] {ON} similar
           to uniprot|P32892 Saccharomyces cerevisiae YLL008W DRS1
           Nucleolar DEAD-box protein required for ribosome
           assembly and function
          Length = 748

 Score =  219 bits (557), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 138/393 (35%), Positives = 206/393 (52%), Gaps = 57/393 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +   G+  P+PIQ   IP+ L  +DI+  A TGSGKTAAF +P+IE+L    A I 
Sbjct: 244 VLKGLGSLGYTSPSPIQSAAIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAHIA 303

Query: 205 -VRAVILSPSRELAMQTYKVFKEFSRGSD-LRSVLLTGGDSLEEQFGMMMGNPDVVIATP 262
             R V+L+P+RELA+Q   V K   +  + L   L  GG +L +Q   +   PD+VIATP
Sbjct: 304 STRVVVLTPTRELAIQVADVGKNIGKFVNGLTFGLAVGGLNLRQQEQALKTRPDIVIATP 363

Query: 263 GRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           GRF+ HL+   +  + +VE +V DEADR+ E GFQE+L E+++ +P  RQTLLFSAT+  
Sbjct: 364 GRFIDHLRNSASFSVDSVEILVIDEADRMLEEGFQEELQEIMSLIPSKRQTLLFSATMNS 423

Query: 322 SLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAE 381
            +       L  PV + +D   + ++ L   F+  +  +R+     LL ++IR    T++
Sbjct: 424 KIKQLISLSLKKPVRIMIDPPKQAADKLTQEFIRIR--KRDHLKPALLYQLIRKLDNTSQ 481

Query: 382 QLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVP---TRH 438
                                                         K  ++FV    T H
Sbjct: 482 ----------------------------------------------KRIVVFVARKETAH 495

Query: 439 HVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLAN 498
            +  V  LL   G  V  ++G+L Q  R Q + NF+S    +L+ TD+A+RG+DIP +  
Sbjct: 496 KLRIVLGLL---GMQVGELHGSLTQEQRLQSVNNFKSLQVPVLICTDLASRGLDIPKIEV 552

Query: 499 VINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           VINF +P + +I++HRVGRTARAG  G + + V
Sbjct: 553 VINFDMPKTYEIYLHRVGRTARAGREGRSVTFV 585

>NDAI0C02490 Chr3 complement(570276..572591) [2316 bp, 771 aa] {ON}
           Anc_5.208
          Length = 771

 Score =  218 bits (555), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 131/392 (33%), Positives = 212/392 (54%), Gaps = 55/392 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF +P+IE+L    AK+ 
Sbjct: 260 VLKGLANLGYNKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLFKPAKVS 319

Query: 205 -VRAVILSPSRELAMQTYKVFKEFSRGSD-LRSVLLTGGDSLEEQFGMMMGNPDVVIATP 262
             R ++L+P+RELA+Q   V K+  +  + L   L  GG +L +Q  ++   PD+VIATP
Sbjct: 320 STRVIVLTPTRELAIQIADVAKKIGKFVNGLTFGLAVGGLNLRQQEQILKQRPDIVIATP 379

Query: 263 GRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           GRF+ H++   + ++ +VE +V DEADR+ E GFQE+LNE++  LP  RQT+LFSAT+  
Sbjct: 380 GRFIDHVRNSASFNVDSVEILVMDEADRMLEEGFQEELNEIMQLLPTKRQTMLFSATMNS 439

Query: 322 SLVDFAKAGLTNPVLVRLDAESKVSENL--EMLFLTTKNGEREANLLYLLQEVIRIPVAT 379
            +       L  PV + ++   + +  L  E + + T++  + A L  L++++       
Sbjct: 440 KIKQLINLSLKKPVRIMINPPKQAASKLTQEFVRIRTRDHLKPALLFNLIKKL------- 492

Query: 380 AEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHH 439
            ++  Q R                                           ++FV  +  
Sbjct: 493 -DEYSQKR------------------------------------------MVVFVARKET 509

Query: 440 VEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANV 499
              +  +L   G  V+ ++G+L Q  R + +  F+S    +L+ TD+A+RG+DIP +  V
Sbjct: 510 AHKLRIILGLLGMNVAELHGSLTQEQRLESVTKFKSLEIPVLICTDLASRGLDIPKIEVV 569

Query: 500 INFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           IN+ +P S  I++HRVGRTARAG  G + S+V
Sbjct: 570 INYDMPKSYDIYLHRVGRTARAGREGRSVSLV 601

>AAL164C Chr1 complement(55223..57427) [2205 bp, 734 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL008W
           (DRS1)
          Length = 734

 Score =  217 bits (553), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 134/391 (34%), Positives = 206/391 (52%), Gaps = 53/391 (13%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  ++  G+ +P+PIQ  TIP+ L  +D++  A TGSGKTAAF +P+IE+L    AKI 
Sbjct: 230 VLKGLAALGYTKPSPIQGATIPIALLGKDVIAGAVTGSGKTAAFMIPIIERLLYKPAKIA 289

Query: 205 -VRAVILSPSRELAMQTYKVFKEFSR-GSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATP 262
             R ++L+P+RELA+Q   V K+  +  S L   L  GG +L +Q   +   PD+VIATP
Sbjct: 290 STRVLVLTPTRELAIQVADVGKKLGKFVSGLTFGLAVGGLNLRQQEQALKLRPDIVIATP 349

Query: 263 GRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           GR + H++   +  + +VE +V DEADR+ E GFQ++LNE+++ +P  RQTLLFSAT+  
Sbjct: 350 GRIIDHIRNSASFSVDSVEVLVIDEADRMLEDGFQDELNEIMSLIPSKRQTLLFSATMNS 409

Query: 322 SLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGER-EANLLYLLQEVIRIPVATA 380
            +       L  PV + +D   + +  L   F+  +  E  +  LLY L           
Sbjct: 410 RIKQLISLSLKKPVRIMIDPPKQAANKLTQEFVRLRKREHLKPALLYHL----------- 458

Query: 381 EQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHV 440
                LR L                                     +K  ++FV  +   
Sbjct: 459 -----LRKLDST---------------------------------GQKRIVVFVARKEVA 480

Query: 441 EYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVI 500
             +  +L   G     ++G+L Q  R Q + NF+S    +LV TD+A+RG+DIP +  VI
Sbjct: 481 HRLRVILGLLGMKAGELHGSLTQEQRLQSVNNFKSLDVPVLVCTDLASRGLDIPKIEVVI 540

Query: 501 NFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           N+ +P + +I++HRVGRTARAG  G + ++V
Sbjct: 541 NYDMPKTYEIYLHRVGRTARAGREGKSVTLV 571

>KAFR0C06420 Chr3 complement(1286002..1288221) [2220 bp, 739 aa]
           {ON} Anc_5.208 YLL008W
          Length = 739

 Score =  216 bits (549), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 137/392 (34%), Positives = 206/392 (52%), Gaps = 55/392 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +S  GF +P+PIQ  TIP+ L  +DIV  A TGSGKTAAF +P+IE+L    AK+ 
Sbjct: 225 VLKGLSSLGFTKPSPIQSATIPIALLGKDIVAGAVTGSGKTAAFMIPIIERLLYKPAKVA 284

Query: 205 -VRAVILSPSRELAMQTYKVFKE---FSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIA 260
             R VIL+P+RELA+Q   V K+   F  G  L   L  GG +L +Q  ++   PD+VIA
Sbjct: 285 STRVVILTPTRELAIQISDVAKKIGHFVNG--LTFGLAVGGLNLRQQEQILKSRPDIVIA 342

Query: 261 TPGRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATL 319
           TPGRF+ H++   +  +  VE +V DEADR+ E GFQ++L+E++  LP  RQ LLFSAT+
Sbjct: 343 TPGRFIDHVRNSASFSVDRVEILVLDEADRMLEEGFQDELSEIMTLLPTRRQNLLFSATM 402

Query: 320 PHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVAT 379
              +       L  PV + +D   + ++ L   F+  +  +R+     LL  +IR   +T
Sbjct: 403 NSKIKQLVSLSLKKPVRIMIDPPKQAADRLVQEFVRIR--KRDHLKPALLYNLIRKLDST 460

Query: 380 AEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHH 439
                                                          +K  ++FV  +  
Sbjct: 461 G----------------------------------------------QKRIVVFVSRKEV 474

Query: 440 VEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANV 499
              +  +L   G  V+ ++G+L Q  R   +  F+S    +L+ TD+A+RG+DIP +  V
Sbjct: 475 AHRLRIILGLLGMGVAELHGSLSQEQRLDSVNKFKSLDVPVLICTDLASRGLDIPKIEIV 534

Query: 500 INFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           IN+ +P S +I++HRVGRTARAG  G + + V
Sbjct: 535 INYDMPKSYEIYLHRVGRTARAGREGRSVTFV 566

>SAKL0G12760g Chr7 complement(1088344..1090557) [2214 bp, 737 aa]
           {ON} similar to uniprot|P32892 Saccharomyces cerevisiae
           YLL008W DRS1 Nucleolar DEAD-box protein required for
           ribosome assembly and function including synthesis of
           60S ribosomal subunits
          Length = 737

 Score =  216 bits (549), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 129/392 (32%), Positives = 209/392 (53%), Gaps = 55/392 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAA+ +P+IE+L    A++ 
Sbjct: 234 VLKGLGALGYVKPSPIQGATIPIALLGKDIIAGAVTGSGKTAAYMIPIIERLLYKPAQVA 293

Query: 205 -VRAVILSPSRELAMQTYKVFKEFSRGSD-LRSVLLTGGDSLEEQFGMMMGNPDVVIATP 262
             R V+L+P+RELA+Q   V K+  +  + L   L  GG +L +Q   +   PD+VIATP
Sbjct: 294 STRVVVLAPTRELAIQVADVGKKIGKFVNGLTFGLAVGGLNLRQQEQTLKLRPDIVIATP 353

Query: 263 GRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           GRF+ H++   +  + +VE +V DEADR+ E GF ++LNE+++ +P  RQTLLFSAT+  
Sbjct: 354 GRFIDHIRNSASFSVDSVEVLVIDEADRMLEEGFHDELNEIMSLIPSKRQTLLFSATMNS 413

Query: 322 SLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGE--REANLLYLLQEVIRIPVAT 379
            +       L  PV + +D   + +  L   F+  +  +  + A L +L++++       
Sbjct: 414 KIKQLVSLSLKKPVRIMIDPPKQAAAKLTQEFVRIRKRDHLKPALLFHLIRKI------- 466

Query: 380 AEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHH 439
                                                      +  S+K  ++FV  +  
Sbjct: 467 -------------------------------------------DETSQKRIVVFVSRKEM 483

Query: 440 VEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANV 499
              +  +L   G  V+ ++G+L Q  R Q + +F+S    +L+ TD+A+RG+DIP +  V
Sbjct: 484 AHRLRIILGLLGMKVAELHGSLTQEQRLQSVNSFKSLDVPVLICTDLASRGLDIPKIEVV 543

Query: 500 INFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           INF +P + +I++HRVGRTARAG  G + S V
Sbjct: 544 INFDMPKTYEIYLHRVGRTARAGREGRSVSFV 575

>Skud_12.59 Chr12 (122973..125249) [2277 bp, 758 aa] {ON} YLL008W
           (REAL)
          Length = 758

 Score =  216 bits (550), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 132/397 (33%), Positives = 206/397 (51%), Gaps = 65/397 (16%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  ++  G+  P+PIQ  TIP+ L  +DI+  A TGSGKTAAF +P+IE+L    AKI 
Sbjct: 248 VLKGLANLGYVTPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKIA 307

Query: 205 -VRAVILSPSRELAMQTYKVFKEFSR-GSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATP 262
             R ++L P+RELA+Q   V K+ +R    +   L  GG +L +Q  M+   PD+VIATP
Sbjct: 308 STRVIVLLPTRELALQVADVGKQIARFVPSITFGLAVGGLNLRQQEQMLKSRPDIVIATP 367

Query: 263 GRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           GRF+ H++   + ++ +VE +V DEADR+ E GFQ++LNE++  LP +RQ LLFSAT+  
Sbjct: 368 GRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIMGLLPSSRQNLLFSATMNS 427

Query: 322 SLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRI------ 375
            +       L  PV + +D   K +         TK          L QE +RI      
Sbjct: 428 KIKSLVSLSLKRPVRIMIDPPKKAA---------TK----------LTQEFVRIRKRDHL 468

Query: 376 -PVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFV 434
            P      +++L  +                                    ++K  ++FV
Sbjct: 469 KPALIFNLIRKLDPM------------------------------------AQKRIVVFV 492

Query: 435 PTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIP 494
             +     +  ++   G  V  ++G+L Q  R   +  F++    +L+ TD+A+RG+DIP
Sbjct: 493 ARKESAHRLRIIMGLLGMSVGELHGSLTQEQRLDSVSKFKNLEVPVLICTDLASRGLDIP 552

Query: 495 MLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
            +  VIN+ +P S ++++HRVGRTARAG  G + + V
Sbjct: 553 KIEVVINYDMPKSHEVYLHRVGRTARAGREGRSVTFV 589

>TBLA0C06160 Chr3 (1494579..1496852) [2274 bp, 757 aa] {ON}
           Anc_5.208 YLL008W
          Length = 757

 Score =  213 bits (542), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 131/393 (33%), Positives = 206/393 (52%), Gaps = 57/393 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKI- 203
           +L  ++  G+ +P+PIQ   IP+ L  +DI+  A TGSGKTAAF +P+IE+L    AK+ 
Sbjct: 247 VLKGLAALGYSKPSPIQSAAIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKVT 306

Query: 204 GVRAVILSPSRELAMQTYKVFKEFSRGSDLRSV---LLTGGDSLEEQFGMMMGNPDVVIA 260
             R ++L+P+RELA+Q   V K+   G  +  V   L  GG +L +Q   +   PD+V+A
Sbjct: 307 STRVIVLTPTRELAIQVSDVGKKV--GKFVNGVTFGLAVGGLNLRQQEQQLKSRPDIVVA 364

Query: 261 TPGRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATL 319
           TPGRF+ H++   + ++ +VE +V DEADR+ E GFQ++LNE+++ LP  RQTLLFSAT+
Sbjct: 365 TPGRFIDHIRNSASFNVDSVEILVIDEADRMLEDGFQDELNEIMSLLPSKRQTLLFSATM 424

Query: 320 PHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGER-EANLLYLLQEVIRIPVA 378
              +       L  PV + +D   + +  L   F+  +  +  +  LLY L         
Sbjct: 425 NSKIKQLISLSLKKPVRIMIDPPKQAAAKLVQEFVRIRKRDNLKPALLYTL--------- 475

Query: 379 TAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRH 438
                  +R L                                 +   +K  ++FV  + 
Sbjct: 476 -------IRKL---------------------------------DGAGQKRIVVFVARKE 495

Query: 439 HVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLAN 498
               +  +L   G  V  ++G+L Q  R   +  F+S    +L+ TD+A+RG+DIP +  
Sbjct: 496 TAHKLRIILGLLGQSVGELHGSLTQEQRLDSVNKFKSLEVPVLLCTDLASRGLDIPKIEV 555

Query: 499 VINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           VIN+ +P S +I++HRVGRTARAG  G + + V
Sbjct: 556 VINYDMPKSYEIYLHRVGRTARAGREGRSVTFV 588

>KLTH0B03278g Chr2 complement(257395..259614) [2220 bp, 739 aa] {ON}
           similar to uniprot|P32892 Saccharomyces cerevisiae
           YLL008W DRS1 Nucleolar DEAD-box protein required for
           ribosome assembly and function including synthesis of
           60S ribosomal subunits
          Length = 739

 Score =  212 bits (540), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 130/391 (33%), Positives = 207/391 (52%), Gaps = 53/391 (13%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +    + +P+PIQ  TIP+ L  +DI+  A TGSGKTAA+ +P+IE+L    A+I 
Sbjct: 234 VLKGLGALNYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAYMIPIIERLLYKPAQIA 293

Query: 205 -VRAVILSPSRELAMQTYKVFKEFSRGSDLRSV-LLTGGDSLEEQFGMMMGNPDVVIATP 262
             R ++L+P+RELA+Q   V  + ++  +  S  L  GG +L +Q   +   PD+VIATP
Sbjct: 294 STRVIVLTPTRELAIQVSDVGAKLAKFVNGISFGLAVGGLNLRQQEQTLRSRPDIVIATP 353

Query: 263 GRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           GR + H++   + ++ +VE +V DEADR+ E GFQ++LNE+++ +P  RQTLLFSAT+  
Sbjct: 354 GRLIDHIRNSASFNVDSVEILVIDEADRMLEEGFQDELNEIMSLIPSKRQTLLFSATMNS 413

Query: 322 SLVDFAKAGLTNPVLVRLDAESKVSENLEMLFL-TTKNGEREANLLYLLQEVIRIPVATA 380
            +       L  PV + +D   + +  L   F+   K  E +  LL+ L           
Sbjct: 414 KINQLISLSLKKPVKIMIDPPRQAAAKLTQEFVRVRKRDELKPALLFHL----------- 462

Query: 381 EQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHV 440
             +++L  L                                    S+K  ++FV  +   
Sbjct: 463 --IRKLDDL------------------------------------SQKRVVVFVARKEVA 484

Query: 441 EYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVI 500
             +  +L   G  V+ ++G+L Q  R Q +  F+S    +L+ TD+A+RG+DIP +  VI
Sbjct: 485 HKLRIILGLLGMKVAELHGSLSQEQRLQAVNGFKSLQVPVLICTDLASRGLDIPKIEFVI 544

Query: 501 NFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           N+ +P +  I++HRVGRTARAG  G + S V
Sbjct: 545 NYDMPKTYDIYLHRVGRTARAGREGRSISFV 575

>Kwal_33.15165 s33 (987878..990073) [2196 bp, 731 aa] {ON} YLL008W
           (DRS1) - putative ATP dependent RNA helicase [contig 94]
           FULL
          Length = 731

 Score =  211 bits (538), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 126/392 (32%), Positives = 208/392 (53%), Gaps = 55/392 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +    + +P+PIQ  TIP+ L  +DI+  A TGSGKTAA+ +P+IE+L    A++ 
Sbjct: 226 VLKGLGALNYVKPSPIQSATIPIALTGKDIIAGAVTGSGKTAAYMIPIIERLLYKPAQVS 285

Query: 205 -VRAVILSPSRELAMQTYKVFKEFSRGSD-LRSVLLTGGDSLEEQFGMMMGNPDVVIATP 262
             R ++L+P+RELA+Q   V  + ++  + +   L  GG +L +Q   +   PDVVIATP
Sbjct: 286 STRVIVLAPTRELAIQVSDVGTKLAKYVNGINFGLAVGGLNLRQQEQALRARPDVVIATP 345

Query: 263 GRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           GR + H++   + ++ +VE +V DEADR+ E GFQ++LNE+++ +P  RQTLLFSAT+  
Sbjct: 346 GRLIDHIRNSASFNVDSVEILVIDEADRMLEDGFQDELNEIMSLIPSKRQTLLFSATMNS 405

Query: 322 SLVDFAKAGLTNPVLVRLDAESKVSENL--EMLFLTTKNGEREANLLYLLQEVIRIPVAT 379
            +       L  PV + +D   + +  L  E + +  ++  + A L +L++++       
Sbjct: 406 KINQLISLSLKKPVRIMIDPPKQAAAKLVQEFVRVRKRDDLKPALLFHLIRKL------- 458

Query: 380 AEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHH 439
                                                      +  S+K  ++FV  +  
Sbjct: 459 -------------------------------------------DDASQKRVVVFVARKEM 475

Query: 440 VEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANV 499
              +  +L   G  V+ ++G+L Q  R Q +  F+S    +L+ TD+A+RG+DIP +  V
Sbjct: 476 AHKLRIILGLLGMKVAELHGSLSQEQRLQAVNGFKSLQIPVLICTDLASRGLDIPKIEFV 535

Query: 500 INFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           INF +P +  I++HRVGRTARAG  G + S V
Sbjct: 536 INFDMPKTYDIYLHRVGRTARAGREGRSISFV 567

>NDAI0F02010 Chr6 (492540..495206) [2667 bp, 888 aa] {ON} Anc_6.148
          Length = 888

 Score =  213 bits (543), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 122/388 (31%), Positives = 210/388 (54%), Gaps = 42/388 (10%)

Query: 153 GFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSA----KIGVRAV 208
           GFR  TPIQ + IP I+   D++G+++TGSGKT ++ LP+I  +K  +     + G   +
Sbjct: 306 GFRSLTPIQSQAIPAIMDGHDVIGISKTGSGKTISYLLPLIRHIKAQNPLMKNETGPLGL 365

Query: 209 ILSPSRELAMQTYK-VFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLH 267
           IL+P+RELA+Q ++ + K  S  + + S+  TGG  L++Q   +     +V+ATPGR + 
Sbjct: 366 ILAPTRELALQIHQEIIKFISTDTAITSICCTGGSELKQQINSLKKGVHIVVATPGRLID 425

Query: 268 LKVEMN---LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
           L    N   + +K V +V+ DEADRLF++GF+ Q+ +++  + P +Q +LFSAT P+ L 
Sbjct: 426 LLTLNNGRLMSIKRVTFVIMDEADRLFDLGFEPQITQIMKTIRPDKQCVLFSATFPNKLR 485

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREAN-LLYLLQEVIRIPVATAEQL 383
           +FA   L +P+ + ++++S V+E ++  F    N E + + LL +++E    P+ T +  
Sbjct: 486 NFAMRILRDPLSITINSQSLVNERVQQRFHICANDEEKFDELLAMIEENSSEPIETTDLG 545

Query: 384 KQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYV 443
           K+                                       P ++ TI+FV ++   +++
Sbjct: 546 KE---------------------------------EEEEHTPQDRKTIIFVASQQICDFI 572

Query: 444 SQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFS 503
              L++ GY    I+       R Q L NF+S   SILV T+V +RG++I  ++ VI F+
Sbjct: 573 GTKLENEGYQPFSIHAGKSYQERVQNLENFKSTKNSILVATEVLSRGLNITEVSLVIIFN 632

Query: 504 LPSSSKIFIHRVGRTARAGNSGWAYSIV 531
              +   ++H  GRTAR  +SG A S++
Sbjct: 633 AVKTFAQYVHTTGRTARGNHSGVAISLI 660

>TDEL0G01420 Chr7 (287165..288703) [1539 bp, 512 aa] {ON} Anc_6.204
           YGL078C
          Length = 512

 Score =  203 bits (516), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 125/383 (32%), Positives = 196/383 (51%), Gaps = 53/383 (13%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKI-GVRAVILSP 212
           F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I KL     K  GV+ +++SP
Sbjct: 120 FPKPTPIQSVSWPYLLAGKDVIGVAETGSGKTFAFGVPAINKLVTEDGKKKGVQVLVISP 179

Query: 213 SRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEM 272
           +RELA Q Y         +DL    + GG    EQ    +    VV+ATPGR L L  E 
Sbjct: 180 TRELASQIYDNMILLIEKADLECCCVYGGVPKYEQ-REKLKKAQVVVATPGRLLDLMQEG 238

Query: 273 NLDLKTVEYVVFDEADRLFEMGFQEQLNELLAAL-PPTRQTLLFSATLPHSLVDFAKAGL 331
           ++DL  V Y+V DEADR+ E GF+E +  ++ +    +RQTL+F+AT P  + + A   +
Sbjct: 239 SVDLSNVSYLVLDEADRMLEKGFEEDIKNIIRSTNTSSRQTLMFTATWPKEVRELASTFM 298

Query: 332 TNPVLVRLDAESKVSEN--LEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLKQLRAL 389
           ++PV V +    ++S N  +  +       ++E  LL LL++    P             
Sbjct: 299 SDPVKVSIGNRDELSANKRITQVVEVIDQFQKERKLLELLKKYQSGP------------- 345

Query: 390 XXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVSQLLKD 449
                                                ++  ++F   +     V + LK 
Sbjct: 346 -----------------------------------KKDEKVLIFALYKKEATRVERNLKY 370

Query: 450 SGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSLPSSSK 509
           +GY V+ I+G L Q  R Q L  F++G +++L+ TDVAARG+DIP +  VIN + P + +
Sbjct: 371 NGYNVAAIHGDLSQQQRSQALNEFKTGASNLLLATDVAARGLDIPNVKTVINLTFPLTVE 430

Query: 510 IFIHRVGRTARAGNSGWAYSIVS 532
            ++HR+GRT RAG +G A+++ +
Sbjct: 431 DYVHRIGRTGRAGQTGTAHTLFT 453

>NCAS0G02560 Chr7 (457574..458852,459621..460012) [1671 bp, 556 aa]
           {ON} Anc_2.164
          Length = 556

 Score =  203 bits (517), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 124/392 (31%), Positives = 198/392 (50%), Gaps = 54/392 (13%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH---SA 201
           +LN +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  +      + 
Sbjct: 126 VLNEVKAEGFDKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLAP 185

Query: 202 KIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIAT 261
             G   ++L+P+RELA+Q  K   +F   S +R+  + GG    +Q   +    ++VIAT
Sbjct: 186 GDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPRGQQIRDLSRGSEIVIAT 245

Query: 262 PGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           PGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  + P RQTL++SAT P 
Sbjct: 246 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 305

Query: 322 SLVDFAKAGLTNPVLVRLDA-ESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATA 380
            +   A   L +P+ V++ + E   S N+  L       E+   LL  L+        TA
Sbjct: 306 EVKQLASDYLNDPIQVQIGSLELSASHNITQLVEVVSEFEKRDRLLKHLE--------TA 357

Query: 381 EQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHV 440
            Q +                                          E   ++F  T+   
Sbjct: 358 SQDQ------------------------------------------ESKILIFASTKRTC 375

Query: 441 EYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVI 500
           + V++ L++ G+    I+G  DQ  R   L  FRSG + I+V TDVAARG+D+  +  VI
Sbjct: 376 DEVTKYLREDGWPALAIHGDKDQRERDWVLEEFRSGRSPIMVATDVAARGIDVKGINYVI 435

Query: 501 NFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           N+ +P + + ++HR+GRT RAG +G A S  +
Sbjct: 436 NYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 467

>Smik_7.205 Chr7 complement(354693..356261) [1569 bp, 522 aa] {ON}
           YGL078C (REAL)
          Length = 522

 Score =  202 bits (514), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 123/380 (32%), Positives = 195/380 (51%), Gaps = 48/380 (12%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPS 213
           F +PTPIQ    P +L  +D+VG+A TGSGKT AF +P I  L     K G++ +++SP+
Sbjct: 131 FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAISHLMNDQKKRGIQVLVISPT 190

Query: 214 RELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMN 273
           RELA Q Y      +    ++   + GG   +EQ   +  +  VV+ATPGR L L  E +
Sbjct: 191 RELASQIYDNLIILTDKVGMQCCCVYGGVPKDEQRNQLKKS-QVVVATPGRLLDLLQEGS 249

Query: 274 LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAGLT 332
           +DL  V Y+V DEADR+ E GF+E +  ++     + RQTL+F+AT P  + + A   + 
Sbjct: 250 VDLSQVNYLVLDEADRMLEKGFEEDIKNIIRETNVSKRQTLMFTATWPKEVRELASTFMK 309

Query: 333 NPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLKQLRALXXX 392
           NP+ V +    +++ N +                  + +++ +    A++ K L  L   
Sbjct: 310 NPIKVSIGNTDQLTANKK------------------ITQIVEVVDPRAKERKLLELLKKY 351

Query: 393 XXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVSQLLKDSGY 452
                                     P  NE       ++F   +     V + LK +GY
Sbjct: 352 HSG-----------------------PKKNE-----KVLIFALYKKEAARVERNLKYNGY 383

Query: 453 LVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSLPSSSKIFI 512
            V+ I+G L Q  R Q L  F+SG +++L+ TDVAARG+DIP +  VIN + P + + ++
Sbjct: 384 SVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYV 443

Query: 513 HRVGRTARAGNSGWAYSIVS 532
           HR+GRT RAG +G A+++ +
Sbjct: 444 HRIGRTGRAGQTGTAHTLFT 463

>CAGL0L03846g Chr12 complement(443677..444047,445148..446411) [1635
           bp, 544 aa] {ON} highly similar to uniprot|P24783
           Saccharomyces cerevisiae YNL112w DBP2 ATP-dependent RNA
           helicase of DEAD box family
          Length = 544

 Score =  202 bits (515), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 122/392 (31%), Positives = 197/392 (50%), Gaps = 54/392 (13%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH---SA 201
           +L  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  +      S 
Sbjct: 121 VLKEVKAEGFDKPTSIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLSP 180

Query: 202 KIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIAT 261
             G   ++L+P+RELA+Q  K   +F + S +R+  + GG    +Q   ++   ++VIAT
Sbjct: 181 GDGPIVLVLAPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPRGQQIRELIRGAEIVIAT 240

Query: 262 PGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           PGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  + P RQTL++SAT P 
Sbjct: 241 PGRLIDMLEAGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 300

Query: 322 SLVDFAKAGLTNPVLVRLDA-ESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATA 380
            +   A+  L +P+ V++ + E   S N+  L       E+   L+  L         TA
Sbjct: 301 EVQQLARDYLNDPIQVQIGSLELAASHNITQLVEVVSEFEKRDRLVKHLD--------TA 352

Query: 381 EQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHV 440
            Q K                                          E   ++F  T+   
Sbjct: 353 SQDK------------------------------------------ESKILIFASTKRTC 370

Query: 441 EYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVI 500
           + ++  L+  G+    I+G  DQ  R   L  FR+G + I+V TDVAARG+D+  +  V+
Sbjct: 371 DEITSYLRQDGWPALAIHGDKDQRERDWVLNEFRTGNSPIMVATDVAARGIDVKGINFVV 430

Query: 501 NFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           N+ +P + + ++HR+GRT RAG +G A S  +
Sbjct: 431 NYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 462

>Suva_7.192 Chr7 complement(353138..354694) [1557 bp, 518 aa] {ON}
           YGL078C (REAL)
          Length = 518

 Score =  202 bits (513), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 128/386 (33%), Positives = 197/386 (51%), Gaps = 60/386 (15%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPS 213
           F +PTPIQ    P +L  +D+VG+A TGSGKT AF +P I  L     K G++ +++SP+
Sbjct: 127 FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAISHLMNDQKKRGIQVLVISPT 186

Query: 214 RELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMN 273
           RELA Q Y      +    L+   + GG   +EQ   +  +  VV+ATPGR L L  E +
Sbjct: 187 RELASQIYDNLIILTDKVGLQCCCVYGGVPKDEQRNQLKKS-QVVVATPGRLLDLLQEGS 245

Query: 274 LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAGLT 332
           +DL  V Y+V DE DR+ E GF+E +  ++     + RQTL+F+AT P  + + A + + 
Sbjct: 246 VDLSQVNYLVLDEGDRMLEKGFEEDIKNIIRETDASKRQTLMFTATWPKEVRELASSFMK 305

Query: 333 NPVLV------RLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLKQL 386
           NP+ V      +L A  K+++ +E++    K    E  LL LL++               
Sbjct: 306 NPIRVSIGNTDQLTANKKITQIVEVVDPRGK----ERKLLELLKKY-------------- 347

Query: 387 RALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVSQL 446
                                           P  NE       ++F   +     V + 
Sbjct: 348 -----------------------------HSGPKKNE-----KVLIFALYKKEATRVERN 373

Query: 447 LKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSLPS 506
           LK +GY V+ I+G L Q  R Q L  F+SG +++L+ TDVAARG+DIP +  VIN + P 
Sbjct: 374 LKYNGYNVAAIHGDLSQQQRTQALSEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPL 433

Query: 507 SSKIFIHRVGRTARAGNSGWAYSIVS 532
           + + ++HR+GRT RAG +G A+++ +
Sbjct: 434 TVEDYVHRIGRTGRAGQTGTAHTLFT 459

>YGL078C Chr7 complement(360288..361859) [1572 bp, 523 aa] {ON}
           DBP3RNA-Dependent ATPase, member of DExD/H-box family;
           involved in cleavage of site A3 within the ITS1 spacer
           during rRNA processing; not essential for growth, but
           deletion causes severe slow-growth phenotype
          Length = 523

 Score =  202 bits (513), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 125/383 (32%), Positives = 196/383 (51%), Gaps = 54/383 (14%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPS 213
           F +PTPIQ    P +L  +D+VG+A TGSGKT AF +P I  L     K G++ +++SP+
Sbjct: 132 FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAISHLMNDQKKRGIQVLVISPT 191

Query: 214 RELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMN 273
           RELA Q Y      +    ++   + GG   +EQ  + +    VV+ATPGR L L  E +
Sbjct: 192 RELASQIYDNLIVLTDKVGMQCCCVYGGVPKDEQ-RIQLKKSQVVVATPGRLLDLLQEGS 250

Query: 274 LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAGLT 332
           +DL  V Y+V DEADR+ E GF+E +  ++     + RQTL+F+AT P  + + A   + 
Sbjct: 251 VDLSQVNYLVLDEADRMLEKGFEEDIKNIIRETDASKRQTLMFTATWPKEVRELASTFMN 310

Query: 333 NPVLVRLDAESKVSEN---LEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLKQLRAL 389
           NP+ V +    +++ N    +++ +    G +E  LL LL++                  
Sbjct: 311 NPIKVSIGNTDQLTANKRITQIVEVVDPRG-KERKLLELLKKY----------------- 352

Query: 390 XXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVSQLLKD 449
                                        P  NE       ++F   +     V + LK 
Sbjct: 353 --------------------------HSGPKKNE-----KVLIFALYKKEAARVERNLKY 381

Query: 450 SGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSLPSSSK 509
           +GY V+ I+G L Q  R Q L  F+SG +++L+ TDVAARG+DIP +  VIN + P + +
Sbjct: 382 NGYNVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVE 441

Query: 510 IFIHRVGRTARAGNSGWAYSIVS 532
            ++HR+GRT RAG +G A+++ +
Sbjct: 442 DYVHRIGRTGRAGQTGTAHTLFT 464

>TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 540
           aa] {ON} Anc_2.164 YNL112W
          Length = 540

 Score =  202 bits (513), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 120/392 (30%), Positives = 200/392 (51%), Gaps = 54/392 (13%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH---SA 201
           +LN +  +GF  PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  +      + 
Sbjct: 124 VLNEVKAEGFANPTAIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLAP 183

Query: 202 KIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIAT 261
             G   ++LSP+RELA+Q  K   +F + S +R+  + GG    +Q   +    ++VIAT
Sbjct: 184 GDGPIVLVLSPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPKGQQIRDLSRGSEIVIAT 243

Query: 262 PGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           PGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  + P RQTL++SAT P 
Sbjct: 244 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 303

Query: 322 SLVDFAKAGLTNPVLVRLDA-ESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATA 380
            + + A+  L +P+ V++ + E   S  +  L     + E+   ++  L+      VA+ 
Sbjct: 304 EVQNLARDYLNDPIQVQIGSLELAASHTITQLVEVITDFEKRDRMVKHLE------VASQ 357

Query: 381 EQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHV 440
           ++                                            E   ++F  T+   
Sbjct: 358 DK--------------------------------------------ESKILVFASTKRTC 373

Query: 441 EYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVI 500
           + +++ L++ G+    I+G  DQ  R   L  FR G + I+V TDVAARG+D+  +  VI
Sbjct: 374 DEITKYLREDGWPALAIHGDKDQRERDWVLAEFREGRSPIMVATDVAARGIDVKGINYVI 433

Query: 501 NFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           N+ +P + + ++HR+GRT RAG +G A S  +
Sbjct: 434 NYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 465

>CAGL0L02915g Chr12 complement(342831..344684) [1854 bp, 617 aa]
           {ON} highly similar to uniprot|P06634 Saccharomyces
           cerevisiae YOR204w DED1 ATP-dependent RNA helicase
          Length = 617

 Score =  203 bits (517), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 127/400 (31%), Positives = 201/400 (50%), Gaps = 70/400 (17%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEK--LKGHSAK 202
           +L NI    F +PTP+Q+ ++P++ + RD++  A+TGSGKT  F  P++ +  L G + K
Sbjct: 156 LLENIKLARFTKPTPVQKYSVPIVSKGRDLMACAQTGSGKTGGFLFPVLSESFLTGPAEK 215

Query: 203 IG-----------VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMM 251
                          AV+++P+RELA Q +   K+F   S ++  ++ GG  +  Q   M
Sbjct: 216 AANDGYSYQRKAFPTAVVMAPTRELATQIFDEAKKFCYRSWVKPCVVYGGAPIGNQMREM 275

Query: 252 MGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELL--AALPPT 309
               D+++ATPGR   L     + L  V+Y+V DEADR+ +MGF+ Q+  ++    +PPT
Sbjct: 276 DHGCDLLVATPGRLNDLLERGKVSLSNVKYLVLDEADRMLDMGFEPQIRHIVEDCDMPPT 335

Query: 310 --RQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLY 367
             RQTL+FSAT PH +   A+  L + + + +      SEN+    L  +N ++ + LL 
Sbjct: 336 GERQTLMFSATFPHDIQHLARDFLHDYIFLSVGRVGSTSENITQRILYVENRDKNSALLD 395

Query: 368 LLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSE 427
           LL        A+ + L                                            
Sbjct: 396 LL-------AASNDNL-------------------------------------------- 404

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
             T++FV T+   + ++  L    +  + I+G   Q  R++ L  FRSG  +ILV T VA
Sbjct: 405 --TLIFVETKRMADQLTDFLIMQNFSATAIHGDRSQAERERALAAFRSGRANILVATAVA 462

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWA 527
           ARG+DIP + +VIN+ LPS    ++HR+GRT RAGN+G A
Sbjct: 463 ARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGVA 502

>Skud_7.204 Chr7 complement(363553..365103) [1551 bp, 516 aa] {ON}
           YGL078C (REAL)
          Length = 516

 Score =  200 bits (509), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 128/386 (33%), Positives = 195/386 (50%), Gaps = 60/386 (15%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPS 213
           F  PTPIQ    P +L  +D+VG+A TGSGKT AF +P I  L     K G++ +++SP+
Sbjct: 125 FPTPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAISHLMNDQGKRGIQVLVISPT 184

Query: 214 RELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMN 273
           RELA Q Y      +    ++   + GG   +EQ   +     VV+ATPGR L L  E +
Sbjct: 185 RELASQIYDNLIILTDKVGMQCCCVYGGVPKDEQRNQLK-RSQVVVATPGRLLDLLQEGS 243

Query: 274 LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAGLT 332
           +DL  V Y+V DEADR+ E GF+E +  ++     + RQTL+F+AT P  + + A   + 
Sbjct: 244 VDLSQVNYLVLDEADRMLEKGFEEDIRNIIRETDASKRQTLMFTATWPKEVRELASTFMK 303

Query: 333 NPVLV------RLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLKQL 386
           NP+ V      +L A  K+++ +E++    K    E  LL LL++               
Sbjct: 304 NPIKVSIGNTDQLTANKKITQIVEVVDPRGK----ERKLLELLKK--------------- 344

Query: 387 RALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVSQL 446
                                           P  NE       ++F   +     V + 
Sbjct: 345 ----------------------------YHSGPKKNE-----KVLIFALYKKEATRVERN 371

Query: 447 LKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSLPS 506
           LK +GY V+ I+G L Q  R Q L  F+SG +++L+ TDVAARG+DIP +  VIN + P 
Sbjct: 372 LKYNGYDVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPL 431

Query: 507 SSKIFIHRVGRTARAGNSGWAYSIVS 532
           + + ++HR+GRT RAG +G A+++ +
Sbjct: 432 TVEDYVHRIGRTGRAGQTGTAHTLFT 457

>YNL112W Chr14 (413639..414911,415914..416281) [1641 bp, 546 aa]
           {ON}  DBP2Essential ATP-dependent RNA helicase of the
           DEAD-box protein family, involved in nonsense-mediated
           mRNA decay and rRNA processing
          Length = 546

 Score =  201 bits (510), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 121/392 (30%), Positives = 198/392 (50%), Gaps = 54/392 (13%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH---SA 201
           +LN +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  +      + 
Sbjct: 124 VLNEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLAP 183

Query: 202 KIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIAT 261
             G   ++L+P+RELA+Q      +F   S +R+  + GG    +Q   +    ++VIAT
Sbjct: 184 GDGPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDLSRGSEIVIAT 243

Query: 262 PGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           PGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  + P RQTL++SAT P 
Sbjct: 244 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 303

Query: 322 SLVDFAKAGLTNPVLVRLDA-ESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATA 380
            +   A   L +P+ V++ + E   S N+  +     + E+   L   L+        TA
Sbjct: 304 EVKQLAADYLNDPIQVQVGSLELSASHNITQIVEVVSDFEKRDRLNKYLE--------TA 355

Query: 381 EQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHV 440
            Q                                           +E  T++F  T+   
Sbjct: 356 SQ------------------------------------------DNEYKTLIFASTKRMC 373

Query: 441 EYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVI 500
           + +++ L++ G+    I+G  DQ  R   L  FR+G + I+V TDVAARG+D+  +  VI
Sbjct: 374 DDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAARGIDVKGINYVI 433

Query: 501 NFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           N+ +P + + ++HR+GRT RAG +G A S  +
Sbjct: 434 NYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 465

>ZYRO0B09856g Chr2 complement(769104..769462,770138..771401) [1623
           bp, 540 aa] {ON} similar to uniprot|P24783 Saccharomyces
           cerevisiae YNL112W DBP2 Essential ATP-dependent RNA
           helicase of the DEAD-box protein family involved in
           nonsense-mediated mRNA decay and rRNA processing
          Length = 540

 Score =  198 bits (504), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 121/393 (30%), Positives = 201/393 (51%), Gaps = 56/393 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH---SA 201
           +L  +  +GF  PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  +      + 
Sbjct: 121 VLKEVKAEGFAAPTGIQCQGWPMALSGRDMVGVAATGSGKTLSYCLPAIVHINAQPLLAP 180

Query: 202 KIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIAT 261
             G   ++L+P+RELA+Q  K   +F R S +R+  + GG    +Q   +    ++VIAT
Sbjct: 181 GDGPVVLVLAPTRELAVQIQKECSKFGRSSRIRNTCVYGGVPRGQQIRDLARGAEIVIAT 240

Query: 262 PGRFLHLKVEMN-LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLP 320
           PGR + + +E+N  +LK V Y+V DEADR+ +MGF+ Q+ +++  + P RQTL++SAT P
Sbjct: 241 PGRLIDM-LEINKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWP 299

Query: 321 HSLVDFAKAGLTNPVLVRLDA-ESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVAT 379
             +   A+  LT+P+ V++ + E   S  ++ +       E+   L   L+      +A+
Sbjct: 300 KEVKQLARDYLTDPIQVQIGSLELSASHTIKQVVEVISEFEKRDRLSKHLE------IAS 353

Query: 380 AEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHH 439
            +Q                                            +   ++F  T+  
Sbjct: 354 EDQ--------------------------------------------DSKVLVFASTKRT 369

Query: 440 VEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANV 499
            + ++Q L+  G+    I+G  DQ  R   L  F++G + I+V TDVAARG+D+  +  V
Sbjct: 370 CDDITQYLRQDGWSALAIHGDKDQRERDWVLEEFKNGRSPIMVATDVAARGIDVKGINYV 429

Query: 500 INFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           IN+ +P + + ++HR+GRT RAG  G A S  +
Sbjct: 430 INYDMPGNIEDYVHRIGRTGRAGAKGTAISFFT 462

>NDAI0F02740 Chr6 complement(670654..671051,672039..673326) [1686
           bp, 561 aa] {ON} 
          Length = 561

 Score =  198 bits (504), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 122/392 (31%), Positives = 196/392 (50%), Gaps = 54/392 (13%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH---SA 201
           +L  +  +GF  PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  +      S 
Sbjct: 129 VLKEVKAEGFDAPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLSP 188

Query: 202 KIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIAT 261
             G   ++L+P+RELA+Q  K   +F   S +R+  + GG    +Q   +    ++VIAT
Sbjct: 189 GDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPRGQQIRDLSRGSEIVIAT 248

Query: 262 PGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           PGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  + P RQTL++SAT P 
Sbjct: 249 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 308

Query: 322 SLVDFAKAGLTNPVLVRLDA-ESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATA 380
            +   A   L +P+ V++ + E   S N+  L       E+   LL  L+        TA
Sbjct: 309 EVQQLASDYLNDPIQVQVGSLELSASHNIAQLVEVLSEFEKRDRLLKHLE--------TA 360

Query: 381 EQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHV 440
            + K                                          E   ++F  T+   
Sbjct: 361 SEDK------------------------------------------ESKILIFASTKRMC 378

Query: 441 EYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVI 500
           + ++++L++ G+    I+G  DQ  R   L  FR+G + I+V TDVAARG+D+  +  VI
Sbjct: 379 DEITKMLREDGWPALAIHGDKDQRERDWVLGEFRAGNSPIMVATDVAARGIDVKGINFVI 438

Query: 501 NFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           N+ +P + + ++HR+GRT RAG  G A S  +
Sbjct: 439 NYDMPGNIEDYVHRIGRTGRAGAKGTAISFFT 470

>Smik_14.215 Chr14 (393283..394555,395537..395907) [1644 bp, 547 aa]
           {ON} YNL112W (REAL)
          Length = 547

 Score =  197 bits (502), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 120/392 (30%), Positives = 198/392 (50%), Gaps = 54/392 (13%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH---SA 201
           +L+ +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  +      + 
Sbjct: 124 VLSEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLAP 183

Query: 202 KIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIAT 261
             G   ++L+P+RELA+Q      +F   S +R+  + GG    +Q   +    ++VIAT
Sbjct: 184 GDGPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDLSRGSEIVIAT 243

Query: 262 PGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           PGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  + P RQTL++SAT P 
Sbjct: 244 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 303

Query: 322 SLVDFAKAGLTNPVLVRLDA-ESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATA 380
            +   A   L +P+ V++ + E   S N+  +     + E+   L   L+        TA
Sbjct: 304 EVKQLAADYLNDPIQVQVGSLELSASHNITQIVEVVSDFEKRDRLNKYLE--------TA 355

Query: 381 EQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHV 440
            Q                                           +E  T++F  T+   
Sbjct: 356 SQ------------------------------------------DNEYKTLVFASTKRMC 373

Query: 441 EYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVI 500
           + +++ L++ G+    I+G  DQ  R   L  FR+G + I+V TDVAARG+D+  +  VI
Sbjct: 374 DDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAARGIDVKGINYVI 433

Query: 501 NFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           N+ +P + + ++HR+GRT RAG +G A S  +
Sbjct: 434 NYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 465

>KAFR0B04560 Chr2 complement(947248..947615,948264..949527) [1632
           bp, 543 aa] {ON} Anc_2.164 YNL112W
          Length = 543

 Score =  197 bits (501), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 120/392 (30%), Positives = 196/392 (50%), Gaps = 54/392 (13%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH---SA 201
           +L  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  +      S 
Sbjct: 121 VLKEVKAEGFDKPTSIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLSP 180

Query: 202 KIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIAT 261
             G   ++LSP+RELA+Q  K   +F   S +R+  + GG    +Q   ++   ++VIAT
Sbjct: 181 GDGPIVLVLSPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPKGQQIRDLVRGAEIVIAT 240

Query: 262 PGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           PGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  + P RQTL++SAT P 
Sbjct: 241 PGRLIDMMEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 300

Query: 322 SLVDFAKAGLTNPVLVRLDA-ESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATA 380
            +   A   L +P+ V++ + E   S N+  L     + E+   L   L+      +A+ 
Sbjct: 301 EVRQLAADYLNDPIQVQVGSLELSASHNITQLVEVLSDFEKRDRLSKHLE------IASE 354

Query: 381 EQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHV 440
           ++                                            +   ++F  T+   
Sbjct: 355 DK--------------------------------------------DSKILVFASTKRTC 370

Query: 441 EYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVI 500
           + +++ L+  G+    I+G  DQ  R   L  FR G + I+V TDVAARG+D+  +  VI
Sbjct: 371 DDITKYLRADGWPALAIHGDKDQKERDWVLNEFRCGRSPIMVATDVAARGIDVKGINFVI 430

Query: 501 NFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           N+ +P + + ++HR+GRT RAG  G A S  +
Sbjct: 431 NYDMPGNIEDYVHRIGRTGRAGAKGTAISFFT 462

>TDEL0F01190 Chr6 (211677..212937,213454..213842) [1650 bp, 549 aa]
           {ON} Anc_2.164 YNL112W
          Length = 549

 Score =  197 bits (501), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 119/392 (30%), Positives = 198/392 (50%), Gaps = 54/392 (13%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH---SA 201
           +L  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  +      + 
Sbjct: 120 VLKEVKAEGFDKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPSIVHINAQPLLAP 179

Query: 202 KIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIAT 261
             G   ++L+P+RELA+Q  K   +F + S +R+  + GG    +Q   +    ++VIAT
Sbjct: 180 GDGPIVLVLAPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPRGQQIRDLARGAEIVIAT 239

Query: 262 PGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           PGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  + P RQTL++SAT P 
Sbjct: 240 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 299

Query: 322 SLVDFAKAGLTNPVLVRLDA-ESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATA 380
            +   A   L +P+ V++ + E   S N++ +     + E+   L   +          A
Sbjct: 300 EVKQLASDYLHDPIQVQIGSLELAASHNIKQVVEVITDFEKRDRLTKHMD--------IA 351

Query: 381 EQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHV 440
            Q K+ + L                                          +F  T+   
Sbjct: 352 SQDKESKIL------------------------------------------VFASTKRTC 369

Query: 441 EYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVI 500
           + +++ L+D G+    I+G  DQ  R   L  FR+G + I+V TDVAARG+D+  +  VI
Sbjct: 370 DEITKYLRDDGWPALAIHGDKDQRERDWVLNEFRTGRSPIMVATDVAARGIDVKGINYVI 429

Query: 501 NFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           N+ +P + + ++HR+GRT RAG +G A S  +
Sbjct: 430 NYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 461

>KLLA0F01034g Chr6 (93422..95305) [1884 bp, 627 aa] {ON} similar to
           uniprot|P06634 Saccharomyces cerevisiae YOR204W DED1
           ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase
           required for translation initiation of all yeast mRNAs
          Length = 627

 Score =  199 bits (505), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 127/400 (31%), Positives = 203/400 (50%), Gaps = 70/400 (17%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEK--------- 195
           +L+NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F  P++ +         
Sbjct: 170 LLDNIKLARFTKPTPVQKYSVPIVAAGRDLMACAQTGSGKTGGFLFPVLSESFSSGPAST 229

Query: 196 --LKGHS--AKIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMM 251
               G+S   K+   AVIL+P+RELA Q Y   K+F+  S ++ +++ GG S++ Q   M
Sbjct: 230 PEAAGNSYIKKVYPTAVILAPTRELATQIYDEAKKFTYRSWVKPMVVYGGASIDNQIKQM 289

Query: 252 MGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELL--AALPPT 309
               ++++ATPGR   L     + L  V+Y+V DEADR+ +MGF+ Q+  ++  + +P  
Sbjct: 290 RYGCNLLVATPGRLTDLLERRYISLANVKYLVLDEADRMLDMGFEPQIRRIVEGSDMPSV 349

Query: 310 --RQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLY 367
             RQTL+FSAT P  +   A   L + V + +      SEN+    L  ++ ++   LL 
Sbjct: 350 DNRQTLMFSATFPSEIQHLASDFLKDYVFLSVGRVGSTSENITQKILYVEDFDKNDTLLD 409

Query: 368 LLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSE 427
           LL        A+ E L                                            
Sbjct: 410 LL-------AASNEGL-------------------------------------------- 418

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
             T++FV T+   + ++  L   G+  + I+G   Q  R++ L  F++G  +ILV T VA
Sbjct: 419 --TLIFVETKRAADSLTDFLIMEGFKATAIHGDRTQGERERALSAFKTGRATILVATAVA 476

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWA 527
           ARG+DIP + +VINF LP+    ++HR+GRT RAGN+G A
Sbjct: 477 ARGLDIPNVTHVINFDLPNDIDDYVHRIGRTGRAGNTGVA 516

>CAGL0H03377g Chr8 complement(313755..315377) [1623 bp, 540 aa] {ON}
           highly similar to uniprot|P20447 Saccharomyces
           cerevisiae YGL078c DBP3
          Length = 540

 Score =  196 bits (499), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 124/392 (31%), Positives = 200/392 (51%), Gaps = 55/392 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKI- 203
           + N I++  F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I  L   S+K  
Sbjct: 141 VQNEIAK--FPKPTPIQAVSWPYLLSGKDVIGVAETGSGKTFAFGVPAINNLLTSSSKPK 198

Query: 204 GVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPG 263
           G++ +++SP+RELA Q Y      ++   +   ++ GG   ++Q    +   +VV+ATPG
Sbjct: 199 GIKVLVISPTRELASQIYDNLVLLTQKVGIDCCVVYGGVPKDDQ-RRQIAKSNVVVATPG 257

Query: 264 RFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHS 322
           R L L  E ++DL  V+Y+V DEADR+ E GF+E +  ++       RQTL+F+AT P  
Sbjct: 258 RLLDLIEEGSVDLSPVDYMVLDEADRMLEKGFEEDIKRIIGQTKSKDRQTLMFTATWPKE 317

Query: 323 LVDFAKAGLTNPVLVRLDAESKVSEN--LEMLFLTTKNGEREANLLYLLQEVIRIPVATA 380
           + + A   +  PV V +    ++S N  +  +        +E  LL LL++         
Sbjct: 318 VRELASTFMKEPVKVSIGNRDELSANKRITQIVEVVDPRSKERKLLDLLKKY-------- 369

Query: 381 EQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHV 440
                                                 P  N+       ++F   +   
Sbjct: 370 -----------------------------------QSGPKKND-----KVLIFALYKKEA 389

Query: 441 EYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVI 500
             V + L  +GY V+ I+G L Q  R Q L  F+SG +++L+ TDVAARG+DIP +  VI
Sbjct: 390 SRVERNLNYNGYKVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVI 449

Query: 501 NFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           N + P + + ++HR+GRT RAG +G A+++ +
Sbjct: 450 NLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFT 481

>KLTH0D09328g Chr4 complement(773449..773837,774557..775823) [1656
           bp, 551 aa] {ON} similar to uniprot|P24783 Saccharomyces
           cerevisiae YNL112W DBP2 Essential ATP-dependent RNA
           helicase of the DEAD-box protein family involved in
           nonsense-mediated mRNA decay and rRNA processing
          Length = 551

 Score =  196 bits (497), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 120/392 (30%), Positives = 197/392 (50%), Gaps = 54/392 (13%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH---SA 201
           +L+ +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  +      S 
Sbjct: 122 VLSEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLSP 181

Query: 202 KIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIAT 261
             G   ++L+P+RELA+Q      +F + S +R+  + GG     Q   +    ++VIAT
Sbjct: 182 GDGPIVLVLAPTRELAVQIQTECSKFGKSSRIRNTCVYGGVPRGHQIRELTRGAEIVIAT 241

Query: 262 PGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           PGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  + P RQTL++SAT P 
Sbjct: 242 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 301

Query: 322 SLVDFAKAGLTNPVLVRLDA-ESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATA 380
            +   A+  L +P+ V + + E   S N+  +     + E+   LL  L+        TA
Sbjct: 302 EVQQLARDYLHDPIQVNVGSLELAASHNIAQIVEVVSDMEKRDRLLKHLE--------TA 353

Query: 381 EQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHV 440
            + K  + L                                          +F  T+   
Sbjct: 354 SEDKDSKIL------------------------------------------IFASTKRTC 371

Query: 441 EYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVI 500
           + +++ L+  G+    I+G   QN R   L  FR+G + I+V TDVAARG+D+  +  VI
Sbjct: 372 DEITRYLRQDGWPALAIHGDKAQNERDWVLQEFRTGNSPIMVATDVAARGIDVKGINFVI 431

Query: 501 NFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           N+ +P + + ++HR+GRT RAG +G A S  +
Sbjct: 432 NYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 463

>TDEL0B04060 Chr2 complement(724075..726618) [2544 bp, 847 aa] {ON}
           Anc_6.148 YBR237W
          Length = 847

 Score =  201 bits (511), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 123/399 (30%), Positives = 221/399 (55%), Gaps = 54/399 (13%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH----S 200
           I++N+    +  PTPIQ + IP I+  RD++G++RTGSGKT ++ LP++ ++K      +
Sbjct: 272 IMHNLK---YDSPTPIQSQAIPAIMSGRDVIGISRTGSGKTISYLLPLLRQIKAQRPLAT 328

Query: 201 AKIGVRAVILSPSRELAMQTYKVFKEFSRGS-DLRSVLLTGGDSLEEQFGMMMGNPDVVI 259
            + G   +IL+P+RELA+Q ++  + F++    + S+  TGG  L++Q  M+    ++V+
Sbjct: 329 NETGPLGLILAPTRELALQIHEEVELFTKNDLAVNSLCCTGGSELKQQINMLKRGTEIVV 388

Query: 260 ATPGRFLHLKVEMN----LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLF 315
           ATPGRF+ L + +N    L  K + +VV DEADRLF++GF+ Q+ +++  + P +Q +LF
Sbjct: 389 ATPGRFIDL-LTLNTGKLLTTKRITFVVLDEADRLFDLGFEPQITQIMKTIRPDKQCVLF 447

Query: 316 SATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEM---LFLTTKNGEREANLLYLLQEV 372
           SAT P+ L  FA   L  P+ + +++++ V+EN++    +F T +N  R   LL +L + 
Sbjct: 448 SATFPNKLRSFAMRVLRLPLSITINSKNLVNENVKQRFEIFPTDENKYRA--LLSILDK- 504

Query: 373 IRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATIL 432
            R+      +  +L                                 + +E+  +KA I+
Sbjct: 505 -RMKEEDENEESEL---------------------------------ADDEVNDDKA-II 529

Query: 433 FVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVD 492
           FV ++   +++   L++ GY +  I+       R   L NFR    SIL+ T+V +RG++
Sbjct: 530 FVSSQQICDFLGTRLENEGYSIHTIHAGKPYQERVNNLQNFRHTRNSILLCTEVLSRGLN 589

Query: 493 IPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           +P ++ VI ++   +   ++H  GRTAR  NSG A +++
Sbjct: 590 VPEVSLVIIYNAVKTFAQYVHTAGRTARGTNSGEAITLL 628

>Suva_14.226 Chr14 (410416..411691,412742..413097) [1632 bp, 543 aa]
           {ON} YNL112W (REAL)
          Length = 543

 Score =  195 bits (496), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 121/392 (30%), Positives = 197/392 (50%), Gaps = 54/392 (13%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH---SA 201
           +L+ +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  +      + 
Sbjct: 125 VLSEVKAEGFAKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLAP 184

Query: 202 KIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIAT 261
             G   ++LSP+RELA+Q      +F + S +R+  + GG    +Q   +    ++VIAT
Sbjct: 185 GDGPIVLVLSPTRELAVQIQTECSKFGQSSRIRNTCVYGGVPKSQQIRDLSRGSEIVIAT 244

Query: 262 PGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           PGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  + P RQTL++SAT P 
Sbjct: 245 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 304

Query: 322 SLVDFAKAGLTNPVLVRLDA-ESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATA 380
            +   A   L +P+ V++ + E   S  +  L     + E+   L   L+        TA
Sbjct: 305 EVKQLAADYLNDPIQVQVGSLELAASHTITQLVEVVSDFEKRDRLNKHLE--------TA 356

Query: 381 EQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHV 440
            Q                                            E  T++F  T+   
Sbjct: 357 SQ------------------------------------------DDEYKTLIFASTKRMC 374

Query: 441 EYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVI 500
           + +++ L++ G+    I+G  DQ  R   L  FR+G + I+V TDVAARG+D+  +  VI
Sbjct: 375 DDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGGSPIMVATDVAARGIDVKGINYVI 434

Query: 501 NFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           N+ +P + + ++HR+GRT RAG +G A S  +
Sbjct: 435 NYDMPGNIEDYVHRIGRTGRAGATGTAVSFFT 466

>KLLA0F23716g Chr6 complement(2215454..2215845,2216857..2218129)
           [1665 bp, 554 aa] {ON} similar to uniprot|P24783
           Saccharomyces cerevisiae YNL112W DBP2 Essential
           ATP-dependent RNA helicase of the DEAD-box protein
           family involved in nonsense-mediated mRNA decay and rRNA
           processing
          Length = 554

 Score =  195 bits (495), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 119/392 (30%), Positives = 197/392 (50%), Gaps = 54/392 (13%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH---SA 201
           +L+ + ++GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  +      S 
Sbjct: 124 VLDEVKQEGFAKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLSP 183

Query: 202 KIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIAT 261
             G   ++L+P+RELA+Q  K   +F   S +R+  + GG    +Q   +    +++IAT
Sbjct: 184 GDGPIVLVLAPTRELAVQIQKECSKFGASSRIRNTCVYGGVPKSQQIRDLQRGVEILIAT 243

Query: 262 PGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           PGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  + P RQTL++SAT P 
Sbjct: 244 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 303

Query: 322 SLVDFAKAGLTNPVLVRLDA-ESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATA 380
            +   A   L +P+ V++ + E   S  +  +     + E+   L   L+        TA
Sbjct: 304 EVKQLASDYLHDPIQVQIGSLELSASHTITQIVEVLTDFEKRDRLAKHLE--------TA 355

Query: 381 EQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHV 440
            Q +                                          +   I+F  T+   
Sbjct: 356 SQDQ------------------------------------------DSKIIIFASTKRTC 373

Query: 441 EYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVI 500
           + ++  L+  G+    I+G   QN R   L  FRSG + I+V TDVAARG+D+  +  VI
Sbjct: 374 DEITSYLRTEGWPALAIHGDKAQNERDWVLAEFRSGRSPIMVATDVAARGIDVKGINYVI 433

Query: 501 NFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           N+ +P + + ++HR+GRT RAG++G A S  +
Sbjct: 434 NYDMPGNIEDYVHRIGRTGRAGSTGTAISFFT 465

>Suva_16.191 Chr16 complement(333913..335769) [1857 bp, 618 aa] {ON}
           YPL119C (REAL)
          Length = 618

 Score =  194 bits (493), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 123/405 (30%), Positives = 200/405 (49%), Gaps = 70/405 (17%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL-------- 196
           +L NI   GF +PTP+Q+ ++P++   RD++  A+TGSGKT  F  P+  +L        
Sbjct: 163 LLENIKLAGFNKPTPVQKYSVPIVTNNRDLMACAQTGSGKTGGFLFPVFTELFHSGPSPA 222

Query: 197 -----KGHSAKIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMM 251
                  +S K    A++L+P+RELA Q ++  ++F+  S +R  ++ GG  +  Q   +
Sbjct: 223 PEKAQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGAPIGNQMREV 282

Query: 252 MGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELL--AALPP- 308
               D+++ATPGR   L     + L  ++Y+V DEADR+ +MGF+ Q+  ++    +P  
Sbjct: 283 DRGCDLLVATPGRLNDLLERGKISLANIKYLVLDEADRMLDMGFEPQIRHIVEECDMPSV 342

Query: 309 -TRQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLY 367
             RQTL+FSAT P  +   A+  L N + + +      SEN+    L   + ++++ LL 
Sbjct: 343 GNRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVGSTSENITQRILYVDDMDKKSALLD 402

Query: 368 LLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSE 427
           LL         +AE                                             E
Sbjct: 403 LL---------SAEH--------------------------------------------E 409

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
             T++FV T+   + ++  L    +  + I+G   Q  R++ L  F+S +  ILV T VA
Sbjct: 410 GLTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQAERERALSAFKSNVADILVATAVA 469

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           ARG+DIP + +VIN+ LPS    ++HR+GRT RAGN+G A S  +
Sbjct: 470 ARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATSFFN 514

>Ecym_5422 Chr5 complement(868686..869065,869897..871199) [1683 bp,
           560 aa] {ON} similar to Ashbya gossypii AFL221C
          Length = 560

 Score =  192 bits (489), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 116/392 (29%), Positives = 190/392 (48%), Gaps = 54/392 (13%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH---SA 201
           +L  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  +      S 
Sbjct: 134 VLKEVKEEGFDKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLSP 193

Query: 202 KIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIAT 261
             G   ++L+P+RELA+Q  K   +F   S +R+  + GG    +Q   +    +++IAT
Sbjct: 194 GDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPKSQQIRDLQRGVEILIAT 253

Query: 262 PGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           PGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  + P RQTL++SAT P 
Sbjct: 254 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 313

Query: 322 SLVDFAKAGLTNPVLVRLDA-ESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATA 380
            +   A+  L +P+ V + + E   S  +  +     + E+   L+  L    + P    
Sbjct: 314 EVQQLARDYLHDPIQVNIGSLELAASHTITQIVEVISDFEKRDRLVKHLDIASKDP---- 369

Query: 381 EQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHV 440
                                                         E   I+F  T+   
Sbjct: 370 ----------------------------------------------ESKIIIFASTKRTC 383

Query: 441 EYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVI 500
           + ++  L+  G+    I+G   Q  R   L  FR G + I+V TDVAARG+D+  +  VI
Sbjct: 384 DDITSYLRQDGWPALAIHGDKQQQERDWVLNEFRCGRSPIMVATDVAARGIDVKGINFVI 443

Query: 501 NFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           N+ +P + + ++HR+GRT RAG +G A S  +
Sbjct: 444 NYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 475

>Kwal_14.1653 s14 complement(406891..408957) [2067 bp, 688 aa] {ON}
           YBR237W (PRP5) - 1:1 [contig 238] PARTIAL
          Length = 688

 Score =  194 bits (493), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 121/397 (30%), Positives = 210/397 (52%), Gaps = 53/397 (13%)

Query: 145 ILNNISRK-GFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKG----H 199
           I+N I+    F  PTPIQ + IP I+  RD++G+++TGSGKT +F LPM+ ++K      
Sbjct: 118 IMNLITNDFKFESPTPIQAQAIPAIMTGRDVIGISKTGSGKTVSFLLPMLRQIKALRPLA 177

Query: 200 SAKIGVRAVILSPSRELAMQTYKVFKEFSRGSD-LRSVLLTGGDSLEEQFGMMMGNPDVV 258
             + G   +IL+P+RELA+Q ++   +F +G+  LRS+  TGG  L++Q   +    ++V
Sbjct: 178 REESGPLGLILAPTRELAVQIHEESMKFLKGNTRLRSICCTGGSELKQQINDLKKGVEIV 237

Query: 259 IATPGRFLHLKVEMN----LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLL 314
           +ATPGRF+ L + +N    ++ + + +VV DEADRLF++GF+ Q+ E++  + P +Q +L
Sbjct: 238 VATPGRFIDL-LTLNSGKLINTERITFVVMDEADRLFDLGFEPQITEIMKTVRPDKQCVL 296

Query: 315 FSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIR 374
           FSAT P  L  FA   L  PV + ++++S ++EN+E      +N E + N L    EV++
Sbjct: 297 FSATFPSKLKSFASRILHTPVSITINSKSLINENIEQKLQIHENDEEKFNSLL---EVLK 353

Query: 375 IPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFV 434
             +    +                                      +++   EK TI+FV
Sbjct: 354 AQINREAE--------------------------------------SHDDKDEK-TIIFV 374

Query: 435 PTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIP 494
            ++   + +   L D  Y    I+     + R   L  F++    IL+ T+V +RG+++P
Sbjct: 375 SSQQICDLIYLKLLDHNYTTYAIHAGKPYHERASNLEKFKNTRNGILLCTEVLSRGLNVP 434

Query: 495 MLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
            ++ V+ ++   +   ++H  GRTAR    G A S++
Sbjct: 435 EVSLVVIYNAVKTFAQYVHTTGRTARGDKKGTAISLL 471

>NCAS0C01720 Chr3 complement(317951..319873) [1923 bp, 640 aa] {ON}
           Anc_2.164 YNL112W
          Length = 640

 Score =  193 bits (490), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 124/405 (30%), Positives = 202/405 (49%), Gaps = 70/405 (17%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMI----------- 193
           +L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F  P++           
Sbjct: 180 LLENIKLARFTKPTPVQKYSVPIVENGRDLMACAQTGSGKTGGFLFPVLSESFKTGPSKT 239

Query: 194 -EKLKGHSAKIGV-RAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMM 251
            E+ +   +K G   A+IL+P+RELA Q +   K+F+  S +R  ++ GG  +  Q   +
Sbjct: 240 PEQGRNFYSKKGYPTALILAPTRELATQIFDEAKKFTYRSWVRPCVVYGGAPIGNQMREV 299

Query: 252 MGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELL--AALPPT 309
               D+++ATPGR   L     + L  + Y+V DEADR+ +MGF+ Q+ +++  + +P  
Sbjct: 300 DHGCDLLVATPGRLTDLIDRGKISLANIRYLVLDEADRMLDMGFEPQIRQIVEGSDMPQV 359

Query: 310 --RQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLY 367
             RQTL+FSAT P  +   A+  L + + + +      SEN+  + L  ++ ++ + LL 
Sbjct: 360 GDRQTLMFSATFPVDIQQLARDFLNDYIFLSVGRVGSTSENITQVILYVEDQDKYSALLD 419

Query: 368 LLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSE 427
           LL        AT + L                                            
Sbjct: 420 LL-------AATTDGL-------------------------------------------- 428

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
             T++FV T+   + ++  L    +  + I+G   Q  R++ L  FR+G  +ILV T VA
Sbjct: 429 --TLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQQERERALSAFRAGTATILVATAVA 486

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           ARG+DIP + +VINF LP     ++HR+GRT RAGN+G A S  +
Sbjct: 487 ARGLDIPNVTHVINFDLPGDIDDYVHRIGRTGRAGNTGVATSFFN 531

>CAGL0J06908g Chr10 complement(662041..663855) [1815 bp, 604 aa]
           {ON} similar to uniprot|P24784 Saccharomyces cerevisiae
           YPL119c DBP1 or uniprot|P06634 Saccharomyces cerevisiae
           YOR204w
          Length = 604

 Score =  192 bits (488), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 119/405 (29%), Positives = 203/405 (50%), Gaps = 70/405 (17%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL-------- 196
           +L N+    F +PTP+Q+ +IP++ + RD++  A+TGSGKT  F  P++ +L        
Sbjct: 149 LLENVELANFSKPTPVQKYSIPIVTKNRDLMACAQTGSGKTGGFLFPVLSELFLNGPAPL 208

Query: 197 -----KGHSAKIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMM 251
                  +  K    A++L+P+RELA+Q +   K+++  S ++  ++ GG  + +Q   M
Sbjct: 209 PEHTRHSYMRKCYPSALVLAPTRELAIQIFDEAKKYTYRSWVKPYVVYGGAPIGQQMRDM 268

Query: 252 MGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELL--AALPPT 309
               ++++ATPGR   L     + L  V+Y+V DEADR+ +MGF+ Q+  ++    +P  
Sbjct: 269 DRGCNLLVATPGRLNDLLERGKISLVNVKYLVLDEADRMLDMGFEPQIRHIVEDCDMPSV 328

Query: 310 --RQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLY 367
             RQTL+FSAT P  +   A+  L + + + +      SEN++   L  ++ ++ + LL 
Sbjct: 329 NDRQTLMFSATFPREIQHLARDFLKDYIFLSVGRVGSTSENIQQKVLFVEDYDKNSALLD 388

Query: 368 LLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSE 427
           +L                                                    NE+  +
Sbjct: 389 IL---------------------------------------------------INEI--D 395

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
             T++FV T+   + ++  L    +  + I+G   Q  R++ L  FR+G+ +ILV T VA
Sbjct: 396 GLTLVFVETKRMADQLTDFLIVQNFKATAIHGDRTQAERERALHAFRNGIANILVATAVA 455

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           ARG+DIP + NVIN+ LP+    ++HR+GRT RAGN G A S  +
Sbjct: 456 ARGLDIPNVTNVINYDLPTDIDDYVHRIGRTGRAGNVGVATSFFN 500

>KAFR0G02030 Chr7 complement(428516..430336) [1821 bp, 606 aa] {ON}
           Anc_8.614 YOR204W
          Length = 606

 Score =  192 bits (488), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 124/400 (31%), Positives = 198/400 (49%), Gaps = 70/400 (17%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMI-EKLKG----- 198
           +L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F  P++ E  K      
Sbjct: 149 LLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKNGPTPL 208

Query: 199 -------HSAKIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMM 251
                  +  K    AVI++P+REL  Q +   K+F+  S ++  ++ GG  +  Q   M
Sbjct: 209 PENSGSHYQRKAYPTAVIMAPTRELVSQIFDEAKKFTYRSWVKPCVVYGGAPIANQMREM 268

Query: 252 MGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-- 309
               D+++ATPGR   L     + L  V+Y+V DEADR+ +MGF+ Q+  ++     T  
Sbjct: 269 DRGCDLLVATPGRLSDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHIVEGCDMTPV 328

Query: 310 --RQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLY 367
             RQTL+FSAT P  +   A+  L++ + + +      SEN+    L  ++ ++++ LL 
Sbjct: 329 GERQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQRVLYVEDEDKKSALLD 388

Query: 368 LLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSE 427
           LL        A+ E L                                            
Sbjct: 389 LL-------AASDEGL-------------------------------------------- 397

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
             T++FV T+   + ++  L    +  + I+G   Q+ R++ L  FRSG  ++LV T VA
Sbjct: 398 --TLIFVETKRLADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAANLLVATAVA 455

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWA 527
           ARG+DIP + +VINF LPS    ++HR+GRT RAGN+G A
Sbjct: 456 ARGLDIPNVTHVINFDLPSDIDDYVHRIGRTGRAGNTGVA 495

>TDEL0A05590 Chr1 (980392..982185) [1794 bp, 597 aa] {ON} Anc_8.614
           YOR204W
          Length = 597

 Score =  191 bits (486), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 118/398 (29%), Positives = 197/398 (49%), Gaps = 70/398 (17%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEK--------- 195
           +L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F  P++ +         
Sbjct: 151 LLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFSTGPSEI 210

Query: 196 ----LKGHSAKIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMM 251
                 G+  K    AV+L+P+RELA Q +   K+F+  S +R+ ++ GG  +  Q   +
Sbjct: 211 PENARGGYMRKAFPTAVVLAPTRELATQIFDEAKKFTYRSWVRATVVYGGADVGSQMREL 270

Query: 252 MGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELL--AALPPT 309
               D+++ATPGR   L     + L  V+Y+V DEADR+ +MGF+ Q+  ++    +P  
Sbjct: 271 DRGCDLLVATPGRLNDLLERGKISLAKVKYLVLDEADRMLDMGFEPQIRHIVEGCDMPGV 330

Query: 310 --RQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLY 367
             RQTL+FSAT P  +   A+  L++ + + +      SEN+    L  ++ ++++ LL 
Sbjct: 331 EDRQTLMFSATFPVDIQHLARDFLSDYIFLSVGRVGSTSENITQHVLYVEDEDKKSALLD 390

Query: 368 LLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSE 427
           L+                                                        ++
Sbjct: 391 LISSA-----------------------------------------------------TD 397

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
             T++FV T+   + ++  L    +  + I+G   Q  R++ L  FRSG  ++LV T VA
Sbjct: 398 GLTLIFVETKRMADQLTDFLIMQNFAATAIHGDRTQGERERALAAFRSGKANLLVATAVA 457

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSG 525
           ARG+DIP + +VIN+ LPS    ++HR+GRT RAGN+G
Sbjct: 458 ARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTG 495

>NDAI0E01590 Chr5 complement(315658..317484) [1827 bp, 608 aa] {ON} 
          Length = 608

 Score =  191 bits (484), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 126/399 (31%), Positives = 199/399 (49%), Gaps = 69/399 (17%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMI-EKLK-GHSA- 201
           +L NI    F +PTP+Q+ +IP++   RD++  A+TGSGKT  F  P++ E  K G +A 
Sbjct: 146 LLENIQLARFTKPTPVQKYSIPIVAAGRDLMACAQTGSGKTGGFLFPVLSESFKTGPTAT 205

Query: 202 ---------KIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMM 252
                    K    AV+++P+RELA Q +   K+F   S ++  +  GG  +  Q   M 
Sbjct: 206 HDQGSYYQKKAFPTAVVMAPTRELATQIFDEAKKFCYRSWVQPCVAYGGAPIGNQMREMD 265

Query: 253 GNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELL--AALPPT- 309
              D+++ATPGR   L     + L  V+Y+V DEADR+ +MGF+ Q+  ++  A + P  
Sbjct: 266 RGCDLLVATPGRLSDLIDRGKISLSNVKYLVLDEADRMLDMGFEPQIRAIVEGADMTPVG 325

Query: 310 -RQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYL 368
            RQTL+FSAT P  +   A+  L + + + +      SEN+    L  +N ++++ LL L
Sbjct: 326 ERQTLMFSATFPADIQHLARDFLADYIFLSVGRVGSTSENITQRVLYVENQDKKSALLDL 385

Query: 369 LQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEK 428
           L                                                  SA+E   + 
Sbjct: 386 L--------------------------------------------------SASE---DG 392

Query: 429 ATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAA 488
            T++FV T+   + ++  L    +  + I+G   Q  R++ L  F+SG  ++LV T VAA
Sbjct: 393 LTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQAERERALAAFKSGAATLLVATAVAA 452

Query: 489 RGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWA 527
           RG+DIP + +VIN+ LP     ++HR+GRT RAGN+G A
Sbjct: 453 RGLDIPNVTHVINYDLPGDIDDYVHRIGRTGRAGNTGIA 491

>Ecym_2269 Chr2 complement(527849..530482) [2634 bp, 877 aa] {ON}
           similar to Ashbya gossypii AFL027C
          Length = 877

 Score =  195 bits (495), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 117/393 (29%), Positives = 210/393 (53%), Gaps = 70/393 (17%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLK-------GHSAKIGVR 206
           F  PTPIQ + IP I+  RDI+G+++TGSGKT +F LP++ ++K       G +  IG+ 
Sbjct: 318 FNFPTPIQSQAIPAIMSGRDIIGISKTGSGKTVSFLLPLLRQIKSQRPLRVGETGPIGL- 376

Query: 207 AVILSPSRELAMQTYKVFKEFSRGSD-LRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRF 265
             +L+P+RELA+Q ++   +F+  +  ++S+  TGG  +++Q   +    ++++ATPGRF
Sbjct: 377 --LLAPTRELAVQIHEEVVKFTAANPRIKSICCTGGSEIKKQINDIKRGIEIIVATPGRF 434

Query: 266 LHLKVEMN----LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           + L + +N    ++ K + +VV DEADRLF++GF+ Q+N+++  + P +Q +LFSAT P 
Sbjct: 435 IDL-LSLNSGNLVNPKRIVFVVLDEADRLFDLGFEPQVNQIMKCIRPDKQCVLFSATFPT 493

Query: 322 SLVDFAKAGLTNPVLVRLDAESKVSENLEM---LFLTTKNGEREANLLYLLQEVIRIPVA 378
            L  FA   L NP+ + ++++S ++EN+E    +F     G+ E+    LL  +  +P  
Sbjct: 494 KLKSFASKILHNPIHITINSKSLINENIEQRVEIF-----GDEESKFKSLLHWL--VPTQ 546

Query: 379 TAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRH 438
           T E                                             ++ TI+FV ++ 
Sbjct: 547 TRE--------------------------------------------VDEKTIIFVSSQQ 562

Query: 439 HVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLAN 498
             +++S  L+ +G     I+     N R   L +F+     IL+ T+V +RG+++P ++ 
Sbjct: 563 ICDFLSNRLEVNGLGTFSIHAGKPFNERTWNLRSFKETKNGILICTEVLSRGLNVPEVSL 622

Query: 499 VINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           V+ ++   S   ++H  GRTAR  N G A +++
Sbjct: 623 VLIYNAAKSFAQYVHTTGRTARGTNKGMAVTLL 655

>SAKL0E10670g Chr5 complement(888829..889205,889934..891281) [1725
           bp, 574 aa] {ON} similar to uniprot|P24783 Saccharomyces
           cerevisiae YNL112W DBP2 Essential ATP-dependent RNA
           helicase of the DEAD-box protein family involved in
           nonsense-mediated mRNA decay and rRNA processing
          Length = 574

 Score =  189 bits (481), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 116/392 (29%), Positives = 195/392 (49%), Gaps = 54/392 (13%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH---SA 201
           +L+ +  +GF  PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  +        
Sbjct: 149 VLSEVKAQGFPSPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLGP 208

Query: 202 KIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIAT 261
             G   ++L+P+RELA+Q  K   +F + S +R+  + GG    +Q   +    ++ IAT
Sbjct: 209 GDGPIVLVLAPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPRGQQIRDLQRGAEICIAT 268

Query: 262 PGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           PGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  + P RQTL++SAT P 
Sbjct: 269 PGRLIDMLEMGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 328

Query: 322 SLVDFAKAGLTNPVLVRLDA-ESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATA 380
            +   A+  L + + V + + E   S N+  +     + ++   L      V  + VA+ 
Sbjct: 329 EVQQLAQDYLHDYIQVNVGSLELAASHNITQVIEVVSDFDKRDRL------VKHMEVASQ 382

Query: 381 EQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHV 440
           +                                            +E   ++F  T+   
Sbjct: 383 D--------------------------------------------AESKILVFASTKRMC 398

Query: 441 EYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVI 500
           + +++ L++ G+    I+G   Q  R   L  FRSG + I+V TDVAARG+D+  +  VI
Sbjct: 399 DEITKYLREDGWPALAIHGDKQQQERDWVLEEFRSGRSPIMVATDVAARGIDVKGINFVI 458

Query: 501 NFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           N+ +P + + ++HR+GRT RAG +G A S  S
Sbjct: 459 NYDMPGNIEDYVHRIGRTGRAGATGTAISFFS 490

>NDAI0E02430 Chr5 complement(503901..505886) [1986 bp, 661 aa] {ON}
           Anc_8.614
          Length = 661

 Score =  191 bits (485), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 123/403 (30%), Positives = 204/403 (50%), Gaps = 70/403 (17%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMI----------- 193
           +L NI+   F +PTP+Q+ +IP+I   RD++  A+TGSGKT  F  P++           
Sbjct: 196 LLENINLARFSKPTPVQKYSIPIIANGRDLMACAQTGSGKTGGFLFPVLSEAFKSGPSPT 255

Query: 194 -EKLKGHSAKIGV-RAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMM 251
            E+ +   +K G   ++IL+P+RELA Q ++  K+F+  S ++  ++ GG  +  Q   +
Sbjct: 256 PEQGRNFYSKKGYPTSLILAPTRELATQIFEEAKKFTYRSWVKPCVVYGGAPIGNQMREI 315

Query: 252 MGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAA--LPPT 309
               D+++ATPGR   L     + L+ ++Y+V DEADR+ +MGF+ Q+  ++    +P  
Sbjct: 316 DHGCDLLVATPGRLSDLLERGKISLQNIKYLVLDEADRMLDMGFEPQIRHIVEGVDMPQV 375

Query: 310 --RQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLY 367
             RQTL+FSAT P  +   A+  L + V + +      S+N+    L  ++ ++ + LL 
Sbjct: 376 GERQTLMFSATFPIDIQQLARDFLNDYVFLSVGRVGSTSDNITQKILYVEDQDKYSALLD 435

Query: 368 LLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSE 427
           LL        AT++ L                                            
Sbjct: 436 LLS-------ATSDGL-------------------------------------------- 444

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
             T++FV T+   + ++  L    +  + I+G   Q  R++ L  F++G  ++LV T VA
Sbjct: 445 --TLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQAERERALSAFKAGTANLLVATAVA 502

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSI 530
           ARG+DIP + +VINF LPS    ++HR+GRT RAGN+G A S 
Sbjct: 503 ARGLDIPNVTHVINFDLPSDIDDYVHRIGRTGRAGNTGVATSF 545

>ZYRO0G14960g Chr7 (1201495..1203990) [2496 bp, 831 aa] {ON} similar
           to uniprot|P21372 Saccharomyces cerevisiae YBR237W PRP5
           RNA helicase in the DEAD-box family
          Length = 831

 Score =  192 bits (488), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 118/387 (30%), Positives = 204/387 (52%), Gaps = 44/387 (11%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH----SAKIGVRAVI 209
           F  PT IQ + IP I+  RD++G+++TGSGKT ++ LP+I  +K      S + G   ++
Sbjct: 261 FENPTSIQAQAIPAIMCGRDVIGISKTGSGKTISYLLPLIRHIKAQRHLASDESGPLGLV 320

Query: 210 LSPSRELAMQTYKVFKEFS-RGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHL 268
           L+P+RELA+Q  +   +F+ +   + SV  TGG  L+EQ   +    ++V+ATPGRF+ L
Sbjct: 321 LAPTRELAIQINEEVTKFTAKDKSVNSVCCTGGSELKEQIRKLKKGIEIVVATPGRFIDL 380

Query: 269 KVEMN----LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
            + +N    L  + + +V+ DEADRLF+MGF+ Q+ +++  + P +Q +LFSAT P+ L 
Sbjct: 381 -LTLNTGKLLSTRRITFVIMDEADRLFDMGFEPQITQIMKTIRPDKQCVLFSATFPNKLR 439

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
           +FA   L  P+ + ++++S V+EN+   F    + E + N L                  
Sbjct: 440 NFAMRVLHRPLSITINSKSLVNENVTQRFDIANSDEEKFNTL------------------ 481

Query: 385 QLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVS 444
            LR L                              + +E   EKA I+FV ++   + + 
Sbjct: 482 -LRILEKHEESSNGVPMQQDW--------------NDSENKDEKA-IIFVSSQQICDLLH 525

Query: 445 QLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSL 504
             L++ GY +  I+       R   L NF+S   SIL+ T+V +RG+++P ++ V+ ++ 
Sbjct: 526 IKLENEGYTIYSIHAGKPYQERLNNLENFKSTPNSILLCTEVLSRGLNVPEVSLVLIYNA 585

Query: 505 PSSSKIFIHRVGRTARAGNSGWAYSIV 531
             +   ++H  GRTAR  ++G A +++
Sbjct: 586 VKTFAQYVHTTGRTARGTHTGVAMTLL 612

>KLTH0H05852g Chr8 complement(514352..516787) [2436 bp, 811 aa] {ON}
           similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237W PRP5 RNA helicase in the DEAD-box family
          Length = 811

 Score =  192 bits (487), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 121/398 (30%), Positives = 213/398 (53%), Gaps = 57/398 (14%)

Query: 145 ILNNISRK-GFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKG----H 199
           I++ I+++  F  PTPIQ + IP I+  RD++G+++TGSGKT +F LP++ ++K      
Sbjct: 243 IMDLITKEFAFVSPTPIQAQAIPAIMAGRDVIGISKTGSGKTVSFLLPLLRQIKALRPLT 302

Query: 200 SAKIGVRAVILSPSRELAMQTYKVFKEF-SRGSDLRSVLLTGGDSLEEQFGMMMGNPDVV 258
           S + G   +IL+P+RELA+Q ++  ++F +  S LRS+  TGG  L++Q   +    ++V
Sbjct: 303 SGETGPMGLILAPTRELAVQIHEETEKFLNPVSKLRSICCTGGSELKQQIKELKKGVEIV 362

Query: 259 IATPGRFLHLKVEMN----LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLL 314
           +ATPGRF+ L + +N    L+ + V +VV DEADRLF++GF+ Q+ E++  + P +Q +L
Sbjct: 363 VATPGRFIDL-LTLNSGKLLNTERVTFVVMDEADRLFDLGFEPQITEIMKTIRPDKQCVL 421

Query: 315 FSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGERE-ANLLYLLQEVI 373
           FSAT P  L  FA   L  P+ + ++++S ++EN+E       N E +   LL +L+   
Sbjct: 422 FSATFPTKLKSFASRILDRPISITINSKSLINENIEQQLRIYDNDESKFEGLLDILR--- 478

Query: 374 RIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILF 433
                     KQ +                              M S +E   ++  I+F
Sbjct: 479 ----------KQTQ------------------------------MSSDDE--RDEKIIVF 496

Query: 434 VPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDI 493
           + ++   + +   L++  Y    I+     N R   L  F++    IL+ T+V +RG+++
Sbjct: 497 LSSQQICDLIYYRLQEQNYTTYAIHAGKPYNERASSLEKFKNTKNGILLCTEVLSRGLNV 556

Query: 494 PMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           P ++ VI ++   +   ++H  GRTAR    G A +++
Sbjct: 557 PEVSLVIIYNAVKTFAQYVHTTGRTARGDKHGTAVTLL 594

>NDAI0B00900 Chr2 complement(209012..210322) [1311 bp, 436 aa] {ON}
           Anc_5.69
          Length = 436

 Score =  184 bits (467), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 131/400 (32%), Positives = 183/400 (45%), Gaps = 65/400 (16%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +  ++S     QPT IQ   IP IL+ RD +G A+TGSGKT AF  PM+ K        G
Sbjct: 18  LYESLSAMKITQPTAIQSACIPEILKGRDCIGGAKTGSGKTIAFAGPMLTKWSEDPC--G 75

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
           +  V+L+P+RELAMQ  + F       ++R  ++ GG S+ EQ   +   P  +IATPGR
Sbjct: 76  MFGVVLTPTRELAMQIAEQFTALGSSMNIRVAIVVGGQSIVEQAIQLQNKPHFIIATPGR 135

Query: 265 FLHLKVEMNLD----LKTVEYVVFDEADRLFEMGFQEQLNELLAALPP--TRQTLLFSAT 318
             H  +    D    LK  +++V DEAD L    F   L   + ALPP   RQTLLF+AT
Sbjct: 136 LAHHIMNSGEDTVGGLKRTKFLVLDEADSLLTDSFAGDLATCIGALPPKHKRQTLLFTAT 195

Query: 319 LPHSL--VDFAKAGLTNPVLVRLDAES----KVSENLEMLFLTTKNGEREANLLYLLQEV 372
           +   +  ++ A A    P +     ES     +   L+  ++      +EA L  LL   
Sbjct: 196 ITDQVRTLENAPAQDGKPSVFTYQVESVDKVAIPSTLKTEYILVPEHVKEAYLYQLL--- 252

Query: 373 IRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATIL 432
                 T E  K                                          + + I+
Sbjct: 253 ------TCETYK------------------------------------------DSSAII 264

Query: 433 FVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVD 492
           FV      E + + L      V+ ++  + Q  R   L  FR+    +LV TDVAARG+D
Sbjct: 265 FVNRAMTAEVLRRTLYHLDVRVASLHSYMPQQERTNSLHRFRANAARVLVATDVAARGLD 324

Query: 493 IPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           IP++  VIN+ +PS    FIHR GRTARAG SG A S V+
Sbjct: 325 IPIVELVINYDIPSDPDTFIHRAGRTARAGRSGDAISFVT 364

>Kpol_534.31 s534 complement(73551..76169) [2619 bp, 872 aa] {ON}
           complement(73551..76169) [2619 nt, 873 aa]
          Length = 872

 Score =  192 bits (488), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 115/401 (28%), Positives = 214/401 (53%), Gaps = 51/401 (12%)

Query: 145 ILNNISRK-GFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSA-- 201
           I+N I+++  + +PT IQ + IP I+  RD++G+++TGSGKT ++ LPM+ ++K      
Sbjct: 287 IMNLITKELKYDEPTAIQSQAIPAIMSGRDLIGISKTGSGKTISYILPMLRQIKAQRTLS 346

Query: 202 --KIGVRAVILSPSRELAMQTYKVFKEFSRGS-DLRSVLLTGGDSLEEQFGMMMGNPDVV 258
             + G   +IL+P+RELA+Q  +  ++F++    +R++  TGG  +++Q   +    ++V
Sbjct: 347 KNETGPLGLILAPTRELALQINEEVEKFTKQDRSIRTICCTGGSEMKKQINDLKRGVEIV 406

Query: 259 IATPGRFLHLKVEMN----LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLL 314
           +ATPGR + + + +N    +  K + +VV DEADRLF+MGF+ Q+ +++  + P +Q +L
Sbjct: 407 VATPGRLIDI-LTLNSGKLISTKRITFVVMDEADRLFDMGFEPQITQIMKTVRPDKQCVL 465

Query: 315 FSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNG----EREANLLYLLQ 370
           FSAT P+ L  FA   LT+P+ V +++ + V+EN+   F    N      R  N+L    
Sbjct: 466 FSATFPNKLRSFAARILTDPLTVTINSNNLVNENVNQSFYIEDNENDKFNRLVNILDGFY 525

Query: 371 EVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKAT 430
           +V +   + +E+ +                                     +E  S+K  
Sbjct: 526 KVNKNITSNSEERE------------------------------------IDEEVSDKKI 549

Query: 431 ILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARG 490
           I+FV ++   + +   L++ GY    I+       R   L  F++   SIL+ T+V +RG
Sbjct: 550 IIFVSSQQFCDLLYSKLENFGYFPYTIHAGKPYQERVMNLEKFKTTTNSILLCTEVLSRG 609

Query: 491 VDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           +++P ++ VI ++   +   ++H  GRTAR  + G A +++
Sbjct: 610 LNVPEVSLVIIYNAAKTFAQYVHTTGRTARGTHKGDAITLL 650

>Smik_8.253 Chr8 (419155..420468) [1314 bp, 437 aa] {ON} YHR169W
           (REAL)
          Length = 437

 Score =  182 bits (463), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 131/390 (33%), Positives = 181/390 (46%), Gaps = 67/390 (17%)

Query: 156 QPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPSRE 215
           QPT IQR  IP IL+ RD +G A+TGSGKT AF  PM+ K        G+  V+L+P+RE
Sbjct: 30  QPTAIQRACIPKILEGRDCIGGAKTGSGKTIAFAGPMLTKWSEDPC--GMFGVVLTPTRE 87

Query: 216 LAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMNLD 275
           LAMQ  + F       ++R  ++ GG+S+ +Q   +   P  +IATPGR  H  +    D
Sbjct: 88  LAMQIAEQFTALGSSMNIRVSVVVGGESIVQQALDLQRKPHFIIATPGRLAHHIMSSGDD 147

Query: 276 ----LKTVEYVVFDEADRLFEMGFQEQLNELLAALPP--TRQTLLFSATLP---HSLVDF 326
               L   +Y+V DEAD L    F   L   + ALPP   RQTLLF+AT+     SL D 
Sbjct: 148 TVGGLMRTKYLVLDEADILLTSTFAGHLATCIGALPPKDKRQTLLFTATITDQVRSLQD- 206

Query: 327 AKAGLTNPVLVRLDAES----KVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQ 382
           A A    P L     ES     +   L+  ++      +EA L  LL         T E+
Sbjct: 207 APAQEAKPPLFAYQVESVDNVAIPSTLKTEYILVPEHVKEAYLYQLL---------TCEE 257

Query: 383 LKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEY 442
            +                                           K  I+FV      E 
Sbjct: 258 YEN------------------------------------------KTAIIFVNRTMTAEI 275

Query: 443 VSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINF 502
           + + LK     V+ ++  + Q  R   L  FR+    +L+ TDVA+RG+DIP +  V+N+
Sbjct: 276 LRRTLKQLEVRVASLHSQMPQQERTNSLHRFRANAARVLIATDVASRGLDIPTVELVVNY 335

Query: 503 SLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
            +PS   +FIHR GRTARAG +G A S V+
Sbjct: 336 DIPSDPDVFIHRAGRTARAGRNGDAISFVT 365

>YHR169W Chr8 (442181..443476) [1296 bp, 431 aa] {ON}  DBP8ATPase,
           putative RNA helicase of the DEAD-box family; component
           of 90S preribosome complex involved in production of 18S
           rRNA and assembly of 40S small ribosomal subunit; ATPase
           activity stimulated by association with Esf2p
          Length = 431

 Score =  182 bits (462), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 127/389 (32%), Positives = 182/389 (46%), Gaps = 65/389 (16%)

Query: 156 QPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPSRE 215
           QPT IQ+  IP IL+ RD +G A+TGSGKT AF  PM+ K     +  G+  V+L+P+RE
Sbjct: 24  QPTAIQKACIPKILEGRDCIGGAKTGSGKTIAFAGPMLTKWSEDPS--GMFGVVLTPTRE 81

Query: 216 LAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMNLD 275
           LAMQ  + F       ++R  ++ GG+S+ +Q   +   P  +IATPGR  H  +    D
Sbjct: 82  LAMQIAEQFTALGSSMNIRVSVIVGGESIVQQALDLQRKPHFIIATPGRLAHHIMSSGDD 141

Query: 276 ----LKTVEYVVFDEADRLFEMGFQEQLNELLAALPP--TRQTLLFSATLPHSLVDFAKA 329
               L   +Y+V DEAD L    F + L   ++ALPP   RQTLLF+AT+   +     A
Sbjct: 142 TVGGLMRAKYLVLDEADILLTSTFADHLATCISALPPKDKRQTLLFTATITDQVKSLQNA 201

Query: 330 GLT--NPVLVRLDAES----KVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQL 383
            +    P L     ES     +   L++ ++      +EA L  LL         T E+ 
Sbjct: 202 PVQKGKPPLFAYQVESVDNVAIPSTLKIEYILVPEHVKEAYLYQLL---------TCEEY 252

Query: 384 KQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYV 443
           +                                           K  I+FV      E +
Sbjct: 253 E------------------------------------------NKTAIIFVNRTMTAEIL 270

Query: 444 SQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFS 503
            + LK     V+ ++  + Q  R   L  FR+    IL+ TDVA+RG+DIP +  V+N+ 
Sbjct: 271 RRTLKQLEVRVASLHSQMPQQERTNSLHRFRANAARILIATDVASRGLDIPTVELVVNYD 330

Query: 504 LPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           +PS   +FIHR GRTARAG  G A S V+
Sbjct: 331 IPSDPDVFIHRSGRTARAGRIGDAISFVT 359

>TBLA0D03520 Chr4 (873710..876379) [2670 bp, 889 aa] {ON} Anc_6.148
           YBR237W
          Length = 889

 Score =  190 bits (482), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 115/388 (29%), Positives = 200/388 (51%), Gaps = 46/388 (11%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSA----KIGVRAVI 209
           F  PTPIQ + IP I+  +DI+G+++TGSGKT A+ LP++  ++        + G  A++
Sbjct: 310 FETPTPIQAQAIPAIMSGKDIIGISKTGSGKTIAYILPLLRHVRAQKPLSRNETGPIALV 369

Query: 210 LSPSRELAMQTYKVFKEFSRGSD--LRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLH 267
           L+P+RELA+Q       F    +  L S+   GG  L  Q  ++     +++ATPGR++ 
Sbjct: 370 LAPTRELAIQINDEINNFLSNDNYQLNSICCAGGSDLRGQINIIKKGVSIIVATPGRYID 429

Query: 268 LKVEMNLDL---KTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
           L      +L   K + ++V DEADRLF++GF+ Q+++++  + P +  +LFSAT P  L 
Sbjct: 430 LLTLNGGNLLNTKRISFIVMDEADRLFDLGFEPQISQIMKTIRPDKHGVLFSATFPKKLR 489

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTK-NGEREANLLYLLQEVIRIPVATAEQL 383
            FA   L +P+ + +D+E+ ++EN+E  F   K + E+  NLL +L +     + ++   
Sbjct: 490 SFALKALNSPITITIDSENMINENIEQKFKICKSDNEKFNNLLDILNKHDYENIQSSASR 549

Query: 384 KQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYV 443
             +                                  +NE  ++K  I+FV ++   E +
Sbjct: 550 DGI----------------------------------SNE--NDKKIIIFVSSQQISELI 573

Query: 444 SQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFS 503
              L+++G+    I+     N R Q L NFR    SIL+ T+V +RG+++P  + VI ++
Sbjct: 574 YNKLENNGFSPFLIHAGKPYNERVQNLENFRRAKNSILLCTEVLSRGLNVPETSLVIIYN 633

Query: 504 LPSSSKIFIHRVGRTARAGNSGWAYSIV 531
              +   ++H  GRT R    G A S++
Sbjct: 634 AVKAFAQYVHTTGRTGRGIYRGVAISLL 661

>Smik_2.380 Chr2 (678057..680609) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score =  189 bits (480), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 109/388 (28%), Positives = 210/388 (54%), Gaps = 44/388 (11%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH----SAKIGVRAVI 209
           F   TPIQ + +P I+  RD++G+++TGSGKT ++ LP++ ++K        + G   +I
Sbjct: 276 FESLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVKAQRPLSKHETGPLGLI 335

Query: 210 LSPSRELAMQTYKVFKEFSRGSDL-RSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHL 268
           L+P+RELA+Q ++  ++F+    L RSV  TGG  +++Q   +    ++V+ATPGRF+ +
Sbjct: 336 LAPTRELALQIHEEVRKFTGAEALIRSVCCTGGSEMKKQITDLKRGAEIVVATPGRFIDI 395

Query: 269 KVEMN----LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
            + +N    L  K + +V+ DEADRLF++GF+ Q+ +++  + P +Q +LFSAT P+ L 
Sbjct: 396 -LTLNDGKLLSTKRITFVIMDEADRLFDLGFEPQITQIMKTVRPDKQCVLFSATFPNKLR 454

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLF-LTTKNGEREANLLYLLQEVIRIPVATAEQL 383
            FA   L +P+ + ++++  V+EN++  F +   + E+  NL+ ++          AE  
Sbjct: 455 SFAVRVLRSPISITINSKGLVNENVKQKFKICNSDDEKFDNLVQIVH-------GRAEFF 507

Query: 384 KQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYV 443
            ++                                 S++   ++   I+FV ++   +++
Sbjct: 508 NEI--------------------------LTEADGESSDFEEADAKAIIFVSSQQICDFI 541

Query: 444 SQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFS 503
           S+ L+++G +   I+       R   L  F+    S+L+ T+V +RG+++P ++ VI ++
Sbjct: 542 SKKLQNAGIITCAIHAGKPYQERLMNLEKFKREKNSVLLCTEVLSRGLNVPEVSLVIIYN 601

Query: 504 LPSSSKIFIHRVGRTARAGNSGWAYSIV 531
              +   ++H  GRTAR   SG A +++
Sbjct: 602 AVKTFAQYVHTTGRTARGSRSGTAITLL 629

>YBR237W Chr2 (691969..694518) [2550 bp, 849 aa] {ON}  PRP5RNA
           helicase in the DEAD-box family, necessary for
           prespliceosome formation, bridges U1 and U2 snRNPs and
           enables stable U2 snRNP association with intron RNA
          Length = 849

 Score =  189 bits (480), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 111/388 (28%), Positives = 211/388 (54%), Gaps = 44/388 (11%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH----SAKIGVRAVI 209
           F   TPIQ + +P I+  RD++G+++TGSGKT ++ LP++ ++K        + G   +I
Sbjct: 276 FGSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVKAQRPLSKHETGPMGLI 335

Query: 210 LSPSRELAMQTYKVFKEFSRG-SDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHL 268
           L+P+RELA+Q ++   +F+   + +RSV  TGG  +++Q   +    ++V+ATPGRF+ +
Sbjct: 336 LAPTRELALQIHEEVTKFTEADTSIRSVCCTGGSEMKKQITDLKRGTEIVVATPGRFIDI 395

Query: 269 KVEMN----LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
            + +N    L  K + +VV DEADRLF++GF+ Q+ +++  + P +Q +LFSAT P+ L 
Sbjct: 396 -LTLNDGKLLSTKRITFVVMDEADRLFDLGFEPQITQIMKTVRPDKQCVLFSATFPNKLR 454

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLF-LTTKNGEREANLLYLLQEVIRIPVATAEQL 383
            FA   L +P+ + ++++  V+EN++  F +     E+  NL+ L+ E        +E  
Sbjct: 455 SFAVRVLHSPISITINSKGMVNENVKQKFRICHSEDEKFDNLVQLIHE-------RSEFF 507

Query: 384 KQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYV 443
            ++++                               S++    +   I+FV +++  +++
Sbjct: 508 DEVQS--------------------------ENDGQSSDVEEVDAKAIIFVSSQNICDFI 541

Query: 444 SQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFS 503
           S+ L ++G +   I+       R   L  F+    SIL+ T+V +RG+++P ++ VI ++
Sbjct: 542 SKKLLNAGIVTCAIHAGKPYQERLMNLEKFKREKNSILLCTEVLSRGLNVPEVSLVIIYN 601

Query: 504 LPSSSKIFIHRVGRTARAGNSGWAYSIV 531
              +   ++H  GRTAR   SG A +++
Sbjct: 602 AVKTFAQYVHTTGRTARGSRSGTAITLL 629

>KLTH0H00638g Chr8 complement(64621..65922) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P38719 Saccharomyces
           cerevisiae YHR169W DBP8 Putative ATP-dependent RNA
           helicase of the DEAD-box family involved in biogenesis
           of the 40S ribosomal subunit
          Length = 433

 Score =  181 bits (459), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 125/389 (32%), Positives = 181/389 (46%), Gaps = 65/389 (16%)

Query: 156 QPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPSRE 215
           QPT IQ+  IP ILQ +D +G A+TGSGKT AF  PM+ K     +  G+  V+L+P+RE
Sbjct: 25  QPTAIQKACIPQILQGKDCIGGAKTGSGKTIAFGAPMLTKWSEDPS--GMFGVVLTPTRE 82

Query: 216 LAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMNLD 275
           LAMQ  + F       ++R  L+ GG+S+ +Q   +   P  ++ATPGR  H  +    D
Sbjct: 83  LAMQIAEQFTALGSSMNIRVALVVGGESIVDQAINLQRKPHFIVATPGRMAHHIMNSGED 142

Query: 276 ----LKTVEYVVFDEADRLFEMGFQEQLNELLAALPP--TRQTLLFSATLPHSL--VDFA 327
               LK  +++V DEAD L    F E L   ++ LPP   RQTLLF+AT+   +  +  A
Sbjct: 143 TIGGLKRAKFLVLDEADILLTDTFSEHLATCISILPPKEKRQTLLFTATVTDQVKALQNA 202

Query: 328 KAGLTNPVLVRLDAES----KVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQL 383
            A    P L   + ES     +   L+  +L      +EA L  +L              
Sbjct: 203 PAAEGKPPLFSYEVESMDKVAIPSTLKTTYLLVPEQVKEAYLYQIL-------------- 248

Query: 384 KQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYV 443
                                                 N   +E + I+FV      E +
Sbjct: 249 -------------------------------------TNATYNESSAIIFVNRTVTAEIL 271

Query: 444 SQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFS 503
            + LK     V+ ++  + Q  R   L  FR+    +L+ TDVA+RG+DIP +  VIN+ 
Sbjct: 272 RRTLKQLDVRVASLHSQMPQQERTNSLHRFRANAARVLIATDVASRGLDIPTVQLVINYD 331

Query: 504 LPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           + S+   FIHR GRTARAG SG +   V+
Sbjct: 332 ISSNPDTFIHRAGRTARAGRSGESICFVA 360

>Suva_15.369 Chr15 (648232..649545) [1314 bp, 437 aa] {ON} YHR169W
           (REAL)
          Length = 437

 Score =  180 bits (457), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 129/390 (33%), Positives = 179/390 (45%), Gaps = 67/390 (17%)

Query: 156 QPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPSRE 215
           QPT IQ+  IP IL+ RD +G A+TGSGKT AF  PM+ K        G+  V+L+P+RE
Sbjct: 30  QPTAIQKACIPKILEGRDCIGGAKTGSGKTIAFAGPMLTKWSEDPC--GMFGVVLTPTRE 87

Query: 216 LAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMNLD 275
           LAMQ  + F       ++R  ++ GG+S+ +Q   +   P  +IATPGR  H  +    D
Sbjct: 88  LAMQIAEQFTALGSNMNIRVSVVVGGESIVKQALDLQRKPHFIIATPGRLAHHIMSSGED 147

Query: 276 ----LKTVEYVVFDEADRLFEMGFQEQLNELLAALPP--TRQTLLFSATLP---HSLVDF 326
               L   +Y+V DEAD L    F   L   + ALPP   RQTLLF+AT+     SL D 
Sbjct: 148 TVGGLMRAKYLVLDEADILLTSTFANHLATCIGALPPKDKRQTLLFTATITDQVRSLQDA 207

Query: 327 AKAGLTNPVLVRLDAES----KVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQ 382
              G   P L     ES     +   L+  ++      +EA L  LL         T E+
Sbjct: 208 PVQG-NKPPLFAYQVESVDDVAIPSTLKTEYILVPEHVKEAYLYQLL---------TCEE 257

Query: 383 LKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEY 442
            +                                           K  I+FV      E 
Sbjct: 258 YEN------------------------------------------KTAIVFVNRTMSAEI 275

Query: 443 VSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINF 502
           + + LK     V+ ++  + Q  R   L  FR+    +L+ TDVA+RG+DIP +  V+N+
Sbjct: 276 LRRTLKQLEVRVASLHSQMPQQERTNSLHRFRANAARVLIATDVASRGLDIPTVELVVNY 335

Query: 503 SLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
            +PS   +FIHR GRTARAG  G A S V+
Sbjct: 336 DIPSDPDVFIHRSGRTARAGRDGDAISFVT 365

>CAGL0K07029g Chr11 complement(690501..692951) [2451 bp, 816 aa]
           {ON} similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237w Pre-mRNA processing RNA helicase PRP5
          Length = 816

 Score =  187 bits (475), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 115/388 (29%), Positives = 198/388 (51%), Gaps = 59/388 (15%)

Query: 153 GFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH----SAKIGVRAV 208
            ++  TPIQ +TIP I+  RD++G+++TGSGKT ++ LPMI  +K      + + G  AV
Sbjct: 271 SYKSLTPIQTQTIPAIMSGRDVIGISKTGSGKTISYLLPMIRHVKAQKKLRNGETGPIAV 330

Query: 209 ILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHL 268
           I +P+RELA+Q  +  ++     D+ S+  TGG  L++Q   +    ++ IATPGRF+ L
Sbjct: 331 IFAPTRELAVQINEEVQKLISDLDISSICCTGGSDLKKQIDKLKTGVEIAIATPGRFIDL 390

Query: 269 KVEMN----LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
            + +N    +    + +VV DEADRLF+ GF+ Q+  +L  + P RQ +LFSAT P  + 
Sbjct: 391 -LSLNGGNLVSTLRISFVVMDEADRLFDFGFEPQIASVLRTVRPDRQCVLFSATFPSKVS 449

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLF-LTTKNGEREANLLYLLQEVIRIPVATAEQL 383
           +FA   L +P+ + ++AE  V+E +   F + +   ++   LL LL+      V  +E +
Sbjct: 450 NFASRFLDSPLQITVNAEGMVNERINQKFTICSDESDKFKELLSLLK------VFNSETV 503

Query: 384 KQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYV 443
                                                      ++ TI+FV ++   + +
Sbjct: 504 -------------------------------------------DEKTIIFVSSQQICDII 520

Query: 444 SQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFS 503
            + L D    +  I+     N R+Q L  F+    SIL+ T+V +RG+++P ++ VI ++
Sbjct: 521 EKRLTDYSEKLYSIHAGRPYNERRQNLELFKKTSNSILLCTEVMSRGLNVPEVSRVILYN 580

Query: 504 LPSSSKIFIHRVGRTARAGNSGWAYSIV 531
              +   ++H  GRTAR    G + S++
Sbjct: 581 SAKTFAQYVHSTGRTARGTREGTSISLL 608

>NCAS0E03920 Chr5 complement(769305..770618) [1314 bp, 437 aa] {ON} 
          Length = 437

 Score =  180 bits (456), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 126/389 (32%), Positives = 179/389 (46%), Gaps = 65/389 (16%)

Query: 156 QPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPSRE 215
           QPT IQ+  IP IL+ RD +G A+TGSGKT AF  PM+ K     +  G+  V+L+P+RE
Sbjct: 29  QPTAIQKACIPEILKGRDCIGGAKTGSGKTVAFAAPMLTKWSEDPS--GMFGVVLTPTRE 86

Query: 216 LAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMNLD 275
           LAMQ  + F       ++R  L+ GG+S+ +Q   +   P  +IATPGR  H  +    D
Sbjct: 87  LAMQIAEQFTALGSSMNIRVALVVGGESIVDQAIQLQKKPHFIIATPGRLAHHIMSSGED 146

Query: 276 ----LKTVEYVVFDEADRLFEMGFQEQLNELLAALPP--TRQTLLFSATLPHSLVDFAKA 329
               LK  +++V DEAD L    F   L   + ALP    RQTLLF+AT+   +     A
Sbjct: 147 TIGGLKRAKFLVLDEADSLLTDTFASDLATCIGALPSKDKRQTLLFTATITDQVRALEDA 206

Query: 330 GLT--NPVLVRLDAES----KVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQL 383
            +    P L     ES     +   L+  ++      +EA L  LL         T E  
Sbjct: 207 PIQEGKPPLFTYQVESVDKVAIPSTLKTEYILVPEHVKEAYLYQLL---------TCETY 257

Query: 384 KQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYV 443
           K                                          + + I+FV      E +
Sbjct: 258 K------------------------------------------DSSAIIFVNRTMTAEIL 275

Query: 444 SQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFS 503
            + L      V+ ++  + Q  R   L  FR+ +  +L+ TDVA+RG+DIP +  VIN+ 
Sbjct: 276 RRTLYHLEVRVASLHSQMPQQERTNSLHRFRANVARVLIATDVASRGLDIPTVELVINYD 335

Query: 504 LPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           +P+    FIHR GRTARAG SG A S V+
Sbjct: 336 IPADPDTFIHRAGRTARAGRSGDAISFVT 364

>Kpol_1062.5 s1062 complement(10370..11665) [1296 bp, 431 aa] {ON}
           complement(10370..11665) [1296 nt, 432 aa]
          Length = 431

 Score =  179 bits (455), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 127/389 (32%), Positives = 185/389 (47%), Gaps = 65/389 (16%)

Query: 156 QPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPSRE 215
            PT IQ+  IP IL+ RD +G A+TGSGKT AF  PM+ +     +  G+  V+L+P+RE
Sbjct: 24  HPTAIQKHCIPEILKGRDCIGGAKTGSGKTIAFAGPMLSQWSDDPS--GMFGVVLTPTRE 81

Query: 216 LAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKV----E 271
           LA+Q  + F       ++R  L+ GG+S+ +Q   +   P  +IATPGR  H  +    E
Sbjct: 82  LAIQIAEQFTALGSSMNIRVCLVVGGESIVKQALELQKKPHFIIATPGRLAHHILSSGEE 141

Query: 272 MNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPP--TRQTLLFSATLPHSL--VDFA 327
           +   L  V+Y+V DEAD +    F   L+  +A LPP   RQTLLF+AT+   +  +  A
Sbjct: 142 VVGGLSRVKYLVLDEADLILTQTFAADLSTCIAKLPPKQKRQTLLFTATITDQVRALQNA 201

Query: 328 KAGLTNPVLVRLDAES----KVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQL 383
            A  + P L   + E+     V   L++ +L      +EA L  LL         T E  
Sbjct: 202 PAQDSKPPLFAYEVENVDNVAVPSTLKLEYLLVPEHVKEAYLYQLL---------TCEDY 252

Query: 384 KQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYV 443
           K                                          + + I+FV      E +
Sbjct: 253 K------------------------------------------DSSVIVFVNRTTAAEVL 270

Query: 444 SQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFS 503
            + L+     V+ ++  + Q+ R   L  FR+    +L+ TDVAARG+DIP +  VIN+ 
Sbjct: 271 RRTLRSLEVRVASLHSQMPQSERINSLQRFRANAARVLIATDVAARGLDIPTVELVINYD 330

Query: 504 LPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           +P     FIHR GRTARAG SG A S V+
Sbjct: 331 IPQDPDTFIHRSGRTARAGRSGDAISFVT 359

>Skud_8.233 Chr8 (413556..414869) [1314 bp, 437 aa] {ON} YHR169W
           (REAL)
          Length = 437

 Score =  178 bits (452), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 125/389 (32%), Positives = 179/389 (46%), Gaps = 65/389 (16%)

Query: 156 QPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPSRE 215
           QPT IQ+  IP IL+ RD +G A+TGSGKT AF  PM+ K        G+  V+L+P+RE
Sbjct: 30  QPTAIQKACIPKILEGRDCIGGAKTGSGKTIAFAGPMLTKWSEDPC--GMFGVVLTPTRE 87

Query: 216 LAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMNLD 275
           LAMQ  + F       ++R  ++ GG+S+ +Q   +   P  +IATPGR  H  +    D
Sbjct: 88  LAMQIAEQFTALGSSMNIRVSVVVGGESIIQQALALQRKPHFIIATPGRLAHHIMSSGED 147

Query: 276 ----LKTVEYVVFDEADRLFEMGFQEQLNELLAALPP--TRQTLLFSATLPHSLVDFAKA 329
               L   +Y+V DEAD L    F + L   + ALP    RQTLLF+AT+   +     A
Sbjct: 148 TVGGLMRAKYLVLDEADILLTSTFADHLATCIGALPAKDKRQTLLFTATITDQVRSLQDA 207

Query: 330 GLT--NPVLVRLDAES----KVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQL 383
            +    P L     ES     +   L+  ++      +EA L  LL         T E+ 
Sbjct: 208 PVQEGKPPLFAYQVESVDNVAIPSTLKTEYILVPEHVKEAYLYQLL---------TCEEY 258

Query: 384 KQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYV 443
           +                                           K  I+FV      E +
Sbjct: 259 EN------------------------------------------KTAIIFVNRTMTAEIL 276

Query: 444 SQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFS 503
            + LK     V+ ++  + Q  R   L  FR+    +L+ TDVA+RG+DIP +  V+N+ 
Sbjct: 277 RRTLKQLEVRVASLHSQMPQQERTNSLHRFRANAARVLIATDVASRGLDIPTVELVVNYD 336

Query: 504 LPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           +PS   +FIHR GRTARAG +G A S V+
Sbjct: 337 IPSDPDVFIHRSGRTARAGRNGDAISFVT 365

>TDEL0G00930 Chr7 complement(186836..188146) [1311 bp, 436 aa] {ON}
           Anc_5.69 YHR169W
          Length = 436

 Score =  178 bits (451), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 123/400 (30%), Positives = 193/400 (48%), Gaps = 65/400 (16%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +++ +S     QPT IQ+  IP I++  D +G A+TGSGKT AF  PM+ K     +  G
Sbjct: 18  LVDALSAMRITQPTSIQKGCIPAIMKGGDCIGGAKTGSGKTIAFAAPMLTKWSEDPS--G 75

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
           +  V+L+P+RELAMQ  + F       ++R  ++ GG+S+ +Q   +   P  +IATPGR
Sbjct: 76  MFGVVLTPTRELAMQIAEQFTALGSSMNIRVSIVVGGESIVKQALELQRKPHFIIATPGR 135

Query: 265 FLHLKVEMNLD----LKTVEYVVFDEADRLFEMGFQEQLNELLAALPP--TRQTLLFSAT 318
             H  +    D    L   +++V DEAD L    F + LN  ++ALPP   RQTLLF+AT
Sbjct: 136 LAHHILNSGEDTVGGLMRAKFLVLDEADSLLTSTFAKDLNVCVSALPPKDKRQTLLFTAT 195

Query: 319 LPHSL--VDFAKAGLTNPVLVRLDAES----KVSENLEMLFLTTKNGEREANLLYLLQEV 372
           +   +  +  A +    P L   + E+     V   L+  ++      +EA L +LL   
Sbjct: 196 ITDQVRALQDAPSQENKPPLYCYEVENVDNVAVPSTLKTEYILIPEYVKEAYLYHLL--- 252

Query: 373 IRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATIL 432
                 T+E+ K                                          + + I+
Sbjct: 253 ------TSEEYK------------------------------------------DSSAII 264

Query: 433 FVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVD 492
           FV      E + + LK+    V+ ++  + Q  R   L  FR+    +L+ TDVA+RG+D
Sbjct: 265 FVNRTMTAEIMRRTLKNLDIRVASLHSQMPQQERTNSLQRFRANAARVLIATDVASRGLD 324

Query: 493 IPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           IP++  V+N+ +PS   ++IHR GRTARAG  G A S ++
Sbjct: 325 IPVVELVVNYDIPSDPDVYIHRSGRTARAGRRGDAISFIT 364

>KLLA0C15433g Chr3 complement(1339439..1341058) [1620 bp, 539 aa]
           {ON} similar to uniprot|P23394 Saccharomyces cerevisiae
           YDR243C PRP28 RNA helicase in the DEAD-box family
           involved in RNA isomerization at the 5' splice site
          Length = 539

 Score =  179 bits (454), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 124/402 (30%), Positives = 197/402 (49%), Gaps = 70/402 (17%)

Query: 145 ILNNISRK-GFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKG----- 198
           +LN I+    + +PT IQR TIP ++  RD +G+A TGSGKT AF LP++ KL G     
Sbjct: 148 LLNIITNDLHYNEPTSIQRSTIPNVINNRDFIGVASTGSGKTLAFLLPILIKLHGIPPLN 207

Query: 199 -HSAKIGVRAVILSPSRELAMQTYK----VFKEFSRGSDLRSVLLTGGDSLEEQFGMMMG 253
             +   G  A++L+P+RELA Q       + K + R  ++ S++  GG SLEE    +  
Sbjct: 208 SITKHDGPLALVLAPTRELAQQIQHEGQSITKLWKRPCNIVSIV--GGHSLEEISANLRD 265

Query: 254 NPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALP--PTRQ 311
             D+++ATPGR L       L LK V  +V DEAD++ + GF++QL  +LA       RQ
Sbjct: 266 GCDILVATPGRLLDCLDSHLLFLKQVNTLVLDEADKMIDFGFEDQLTTILAKTETISNRQ 325

Query: 312 TLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQE 371
           T++F+AT   ++   A   L  P  V +  E    +                     +++
Sbjct: 326 TMMFTATFSPTIEKVANGYLKKPSYVTVGGEESKPK---------------------IKQ 364

Query: 372 VIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKA-T 430
           ++R      E+LK L                                   + LP+ KA  
Sbjct: 365 IVRYVPDEEEKLKIL---------------------------------VKDFLPNYKAPI 391

Query: 431 ILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARG 490
           I+F+  +   +++   L+++ +  + ++G+  Q  R+  L   R+G   IL+ TDVA RG
Sbjct: 392 IIFINYKRTADWLFDKLREARFRATTLHGSKSQEQREHSLSLLRNGKVDILIATDVAGRG 451

Query: 491 VDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           +DIP ++ V+N   P S   F+HRVGRT RAG +G A + ++
Sbjct: 452 IDIPNVSLVVNLQFPKSFDSFVHRVGRTGRAGKTGTALTFLT 493

>KNAG0M00660 Chr13 complement(107772..110426) [2655 bp, 884 aa] {ON}
           Anc_6.148 YBR237W
          Length = 884

 Score =  184 bits (467), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 110/387 (28%), Positives = 197/387 (50%), Gaps = 54/387 (13%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH----SAKIGVRAVI 209
           F   TPIQ + +P I+  RD++G+++TGSGKT ++ LP++  +K        + G  A+I
Sbjct: 325 FDSLTPIQAQALPAIMSGRDVIGISKTGSGKTISYLLPLLRHIKAQRPLSKNETGPLALI 384

Query: 210 LSPSRELAMQTYK-VFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHL 268
           ++P+RELA+Q Y+   +       LR++  TGG  L+ Q   +    ++V+ATPGRF+ L
Sbjct: 385 IAPTRELALQIYQETLRFLDSDKSLRAICCTGGSQLKTQINDLKRGTEIVVATPGRFIDL 444

Query: 269 KVEMN----LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
            + MN    +  K + +VV DEADRLF+MGF+ Q+ +++  + P +Q +LFSAT P+ L 
Sbjct: 445 -LTMNSGKLISSKKISFVVLDEADRLFDMGFEPQVTQIMKTIRPDKQCVLFSATFPNKLR 503

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
           +FA   L +P+ + +++ + V+EN+        N   + ++L  L E  +  + + EQ  
Sbjct: 504 NFAMRVLKSPLSITINSNTMVNENVTQKVELCNNELDKFDILLSLLEKHQAKLVSPEQ-- 561

Query: 385 QLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVS 444
                                                     ++  I+FV ++   + + 
Sbjct: 562 ------------------------------------------DEKVIIFVASQQICDTLY 579

Query: 445 QLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSL 504
             L++  Y +  I+       R   L  F+    SIL+ T+V +RG+++P ++ V+ F+ 
Sbjct: 580 AKLENYDYDLFAIHAGKSYQERITNLNKFKETANSILICTEVLSRGLNVPEVSLVVIFNA 639

Query: 505 PSSSKIFIHRVGRTARAGNSGWAYSIV 531
             +   ++H  GRTAR  N G A +++
Sbjct: 640 IKTFAQYVHTTGRTARGNNHGDAITLL 666

>Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score =  184 bits (466), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 109/388 (28%), Positives = 210/388 (54%), Gaps = 44/388 (11%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH----SAKIGVRAVI 209
           F   TPIQ + +P I+  RD++G+++TGSGKT ++ LP++ ++K        + G   +I
Sbjct: 276 FDSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVKAQRPLSKHETGPLGLI 335

Query: 210 LSPSRELAMQTYKVFKEFSR-GSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHL 268
           L+P+RELA+Q ++   +F+   + +RSV  TGG  +++Q   +    ++V+ATPGRF+ +
Sbjct: 336 LAPTRELALQIHEEVNKFTETDAGIRSVCCTGGSEMKKQITDLKRGAEIVVATPGRFIDI 395

Query: 269 KVEMN----LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
            + +N    L  K + +V+ DEADRLF++GF+ Q+ +++  + P +Q +LFSAT P+ L 
Sbjct: 396 -LTLNDGKLLSTKRITFVIMDEADRLFDLGFEPQITQIMKTVRPDKQFVLFSATFPNKLR 454

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLF-LTTKNGEREANLLYLLQEVIRIPVATAEQL 383
            FA   L +P+ + ++++  V+EN++  F +     E+  NL+ +L++         E L
Sbjct: 455 SFAVRVLRSPISITINSKGMVNENVKQKFKICHSEDEKFDNLMQILRK-------RNELL 507

Query: 384 KQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYV 443
            ++++                               +++    +   I+FV ++   +++
Sbjct: 508 DEVQS--------------------------DVDGETSDLEEVDAKAIIFVSSQQICDFI 541

Query: 444 SQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFS 503
           S+ L + G +   I+       R   L  F+    SIL+ T+V +RG+++P ++ VI ++
Sbjct: 542 SKKLANVGVVTYAIHAGKPYQERVMNLEKFKREKNSILLCTEVLSRGLNVPEVSLVIIYN 601

Query: 504 LPSSSKIFIHRVGRTARAGNSGWAYSIV 531
              +   ++H  GRTAR   SG A +++
Sbjct: 602 SVKTFAQYVHTTGRTARGSRSGTAITLL 629

>KLLA0A05203g Chr1 complement(462167..463474) [1308 bp, 435 aa] {ON}
           highly similar to uniprot|P38719 Saccharomyces
           cerevisiae YHR169W DBP8 Putative ATP-dependent RNA
           helicase of the DEAD-box family involved in biogenesis
           of the 40S ribosomal subunit
          Length = 435

 Score =  176 bits (446), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 121/389 (31%), Positives = 184/389 (47%), Gaps = 65/389 (16%)

Query: 156 QPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPSRE 215
           QPT IQ+  IP IL+ RD +G A TGSGKT AF  PM+ K        G+  ++L+P+RE
Sbjct: 26  QPTAIQKACIPEILKGRDCIGGANTGSGKTIAFAAPMLTKWSEDPQ--GMFGIVLTPTRE 83

Query: 216 LAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMNLD 275
           LAMQ  + F  F    ++R  ++ GG+S+ +Q   +   P  +IATPGR  H  +    D
Sbjct: 84  LAMQIAEQFTAFGSAMNIRVAIVVGGESIVQQAIELQKRPHFIIATPGRLAHHVLNSGED 143

Query: 276 ----LKTVEYVVFDEADRLFEMGFQEQLNELLAALPP--TRQTLLFSATLPHSLVDFAKA 329
               LK V+++V DEAD L    F + L   ++ LPP   RQ LLF+AT+   +   + A
Sbjct: 144 TIGGLKRVKFLVLDEADILLTETFSKDLATCVSILPPKNKRQNLLFTATMTDQVKALSDA 203

Query: 330 GLT--NPVLVRLDAES----KVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQL 383
             T   P +   + ES     + + LE  +L      +E+   YL Q      + T+E+ 
Sbjct: 204 PQTEGKPPVFTFEVESVDNVAIPKTLETTYLLVPEHVKES---YLYQ------ILTSEKY 254

Query: 384 KQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYV 443
                                                      + + I+FV      E +
Sbjct: 255 ------------------------------------------VKSSCIIFVNRTVTAEIL 272

Query: 444 SQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFS 503
            + LK     V+ ++  + Q  R   +  FR+    +L+ TDVA+RG+DIP++  V+N+ 
Sbjct: 273 RRTLKSLDVRVTSLHSQMPQQERTNSVQRFRAQAARVLIATDVASRGLDIPIVELVVNYD 332

Query: 504 LPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           +P +   FIHR GRTARAG  G +   V+
Sbjct: 333 IPGNPDTFIHRAGRTARAGRHGESLCFVT 361

>AER301C Chr5 complement(1188485..1189792) [1308 bp, 435 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR169W
           (DBP8)
          Length = 435

 Score =  176 bits (446), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 127/407 (31%), Positives = 185/407 (45%), Gaps = 65/407 (15%)

Query: 156 QPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPSRE 215
           QPT IQ+  IP IL  RD +G A+TGSGKT AF  PM+ K        G+  ++L+P+RE
Sbjct: 28  QPTTIQKACIPEILAGRDCIGGAKTGSGKTIAFAAPMLTKWSADPC--GMFGIVLTPTRE 85

Query: 216 LAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMNLD 275
           LAMQ  + F       ++R  L+ GG+ +  Q   +   P  +IATPGR  H  +    D
Sbjct: 86  LAMQIAEQFTALGSVMNIRVALVVGGEDIVSQALELQRKPHFIIATPGRLAHHIMHSGED 145

Query: 276 ----LKTVEYVVFDEADRLFEMGFQEQLNELLAALPP--TRQTLLFSATLPHSLVDFAKA 329
               LK V Y+V DEAD L    F + L   +  LPP   RQ LLF+AT+   ++    A
Sbjct: 146 TIGGLKRVRYLVLDEADILLTDTFSDALATCVQILPPKEKRQNLLFTATMTDQVLALKDA 205

Query: 330 GLTN--PVLVRLDAES----KVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQL 383
             T+  P L     E+     V  +L+  +L      +EA   YL Q      V ++E+ 
Sbjct: 206 PPTSGKPPLFSFHVENLDDLAVPASLQTTYLLVPEHVKEA---YLYQ------VLSSEEY 256

Query: 384 KQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYV 443
           K                                           K+ I+FV      E +
Sbjct: 257 K------------------------------------------SKSAIVFVNRTISAEIL 274

Query: 444 SQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFS 503
            ++L      V+ ++  + Q  R   L  FR+    +L+ TDVA+RG+DIP +  V+N+ 
Sbjct: 275 RRMLMQLEIRVTSLHSQMPQRERTNSLQRFRANAARVLIATDVASRGLDIPAVQLVVNYD 334

Query: 504 LPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXGKKI 550
           +P++   +IHR GRTARAG  G A S ++              GKK+
Sbjct: 335 IPANPDTYIHRAGRTARAGRGGEALSFIAPKDVSRIQAIEERIGKKM 381

>TBLA0E04100 Chr5 (1032727..1035327) [2601 bp, 866 aa] {ON}
           Anc_8.614 YOR204W
          Length = 866

 Score =  182 bits (463), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 117/416 (28%), Positives = 202/416 (48%), Gaps = 79/416 (18%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL-------- 196
           ++ NI    F +PTPIQ+ +IP++ Q RD++  A+TGSGKT AF  P++ K         
Sbjct: 368 LVENIKLARFNKPTPIQKYSIPIVNQGRDLMACAQTGSGKTDAFLFPILSKAFSLGPSIN 427

Query: 197 ----------------KGHSAKIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTG 240
                           K  +  I    +IL+P+RELA Q ++  ++FS  S +R  ++ G
Sbjct: 428 NNNDNDNDANQYNKISKYRAKNIKPIILILAPTRELANQIFEEARKFSYRSWIRPCVVYG 487

Query: 241 GDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLN 300
           G ++  Q   +     +++ATPGR   L     + L  ++Y++ DEADR+ +MGF+ Q+ 
Sbjct: 488 GTNIFTQMKNLENGSQLLVATPGRLNDLMERGKISLSNIKYLILDEADRMLDMGFELQIR 547

Query: 301 ELL----AALPPTRQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTT 356
           +++      +  +RQTL+FSAT P ++ + A   L + + + +      ++N+       
Sbjct: 548 QIVEHYDMPIATSRQTLMFSATFPSNIQNLAGDFLNDYIFLSVGKIGSTTDNIIQHIYYV 607

Query: 357 KNGEREANLLYLLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXX 416
           +  E++  LL LL          ++  K+ + L                           
Sbjct: 608 RQEEKDNTLLDLLD---------SKNYKKKQTL--------------------------- 631

Query: 417 XMPSANELPSEKATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSG 476
                          +FV T+   + ++ LL   GY  + I+G   Q  R++ L  F++ 
Sbjct: 632 ---------------IFVETKRSADALTDLLIIEGYKATAIHGDRTQLERERALTAFKTK 676

Query: 477 LTSILVVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
             ++LV T VAARG+DIP +A+V+N+ LP++   ++HR+GRT R GN G A S  +
Sbjct: 677 RANVLVATSVAARGLDIPNVAHVLNYDLPNNIDDYVHRIGRTGRVGNIGMATSFFN 732

>Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}
           similar to Ashbya gossypii AFR452C
          Length = 565

 Score =  176 bits (447), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 124/386 (32%), Positives = 189/386 (48%), Gaps = 68/386 (17%)

Query: 153 GFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEK------LKGHSAKIGVR 206
           G+ +PTPIQR TIP +   RD +G+A TGSGKT AF +P+  K      L   + + G +
Sbjct: 182 GYEEPTPIQRATIPNVQNNRDFMGVASTGSGKTLAFLIPIFMKFTKLPPLNVITRQDGPQ 241

Query: 207 AVILSPSRELAMQTYKVFKEFSRGSDLRSVLLT---GGDSLEEQFGMMMGNPDVVIATPG 263
           A+IL+P+RELA Q     K+F      R  L+T   GG +LEE    +    ++++ATPG
Sbjct: 242 ALILAPTRELAQQIEAEAKKFCAHWK-RPCLVTSIVGGHTLEEIIFNLQDGCNILVATPG 300

Query: 264 RFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT--RQTLLFSATLPH 321
           R +       L LK V  +V DEADR+ + GF++QL  +LA       +QTL+F+AT+  
Sbjct: 301 RLIDCLENHVLVLKQVYTLVLDEADRMVDFGFEDQLTTILARTDDILEKQTLMFTATMSS 360

Query: 322 SLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAE 381
           S+   A   L NP  V +       +                     +Q++I   VAT E
Sbjct: 361 SIERIANGYLRNPGFVTIGGSGSAPQ---------------------IQQIIEY-VATDE 398

Query: 382 QLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEK-ATILFVPTRHHV 440
           Q                                   M + + LP+ +   I+F+  +   
Sbjct: 399 Q--------------------------------RFKMLTQDILPNYRPPVIIFINYKVTA 426

Query: 441 EY-VSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANV 499
           ++ + +  ++S + V+ ++G+  Q  R+  L  FR G   I+V TDVA RG+DIP ++ V
Sbjct: 427 DWLLRKFQEESKFRVTILHGSKSQTQREHSLKAFREGKVDIMVATDVAGRGIDIPNVSLV 486

Query: 500 INFSLPSSSKIFIHRVGRTARAGNSG 525
           +NF +PS    +IHR+GRT RA   G
Sbjct: 487 VNFQMPSKLDDYIHRIGRTGRANQKG 512

>TDEL0E03850 Chr5 complement(723551..725836) [2286 bp, 761 aa] {ON}
           Anc_5.241 YJL033W
          Length = 761

 Score =  179 bits (455), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 121/385 (31%), Positives = 194/385 (50%), Gaps = 52/385 (13%)

Query: 146 LNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL--KGHSAKI 203
           L  +    F + T IQR++IP+ L+  D++G A+TGSGKT AF +P++EKL  +  +   
Sbjct: 53  LKGLKEAAFVKLTEIQRESIPVSLKGHDLLGAAKTGSGKTLAFLIPVLEKLYREKWTEFD 112

Query: 204 GVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPG 263
           G+ A+I+SP+RELAMQ Y+V  +    +   + L+ GG  ++ +   +    ++++ TPG
Sbjct: 113 GLGALIISPTRELAMQIYEVLTKIGGHTSFSAGLVIGGKDVKFELERI-SRINILVGTPG 171

Query: 264 RFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHS 322
           R L H+   + L+   ++ +V DEADR  +MGF++ L+ +++ LPP+RQTLLFSAT   S
Sbjct: 172 RILQHMDQAVGLNADNLQMLVLDEADRCLDMGFKKTLDAIVSNLPPSRQTLLFSATQSQS 231

Query: 323 LVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQ 382
           L D A+  LT       D +S  + +      T   G+ E +    LQ+   I V  A++
Sbjct: 232 LADLARLSLT-------DYKSVGTAD------TVNGGDSEVSTPETLQQSY-IVVELADK 277

Query: 383 LKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEY 442
           L  L +                                   L S+   I+F+ +   V +
Sbjct: 278 LDTLFSFIK------------------------------THLKSK--MIVFLSSSKQVHF 305

Query: 443 VSQLLK--DSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVI 500
           V +  +    G  + +++G   Q AR + L  F       L+ TDV ARG+D P +  V+
Sbjct: 306 VYETFRKMQPGISLMHLHGRQKQTARTETLDKFSRAQQVCLIATDVVARGIDFPAVDWVV 365

Query: 501 NFSLPSSSKIFIHRVGRTARAGNSG 525
               P     +IHRVGR+AR G  G
Sbjct: 366 QVDCPEDVDTYIHRVGRSARYGKQG 390

>KAFR0B04480 Chr2 complement(929008..930315) [1308 bp, 435 aa] {ON}
           Anc_5.69 YHR169W
          Length = 435

 Score =  172 bits (437), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 128/395 (32%), Positives = 185/395 (46%), Gaps = 55/395 (13%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L+++      QPT IQ   IP IL+ RD +G A+TGSGKT  F  PM+ +        G
Sbjct: 16  LLDSLRAMKITQPTTIQSHCIPEILKGRDCIGGAKTGSGKTITFAAPMLARWSEDPC--G 73

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
           +  V+L+P+RELAMQ  + F       ++R  L+ GG+S+  Q   +   P  +IATPGR
Sbjct: 74  MFGVVLTPTRELAMQIAEQFTALGSSMNIRVALIVGGESIVNQAIELQRKPHFIIATPGR 133

Query: 265 FLHLKVEMNLD----LKTVEYVVFDEADRLFEMGFQEQLNELLAALPP--TRQTLLFSAT 318
             H  +    D    LK  +Y+V DEAD L    F + L+  + ALP    RQTLLF+  
Sbjct: 134 LAHHILNSGEDTVGGLKRAKYLVLDEADFLLNDTFAKDLSTCIGALPDKNARQTLLFT-- 191

Query: 319 LPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVA 378
                     A +T+ V    +A +K    L +     ++ ++ A    L  E I IP  
Sbjct: 192 ----------ATITDQVRALQNAPAK-GGKLPIFAYQVESVDKVAIPSTLKVEYILIPEH 240

Query: 379 TAEQ-LKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTR 437
             E  L QL                               +   N + S    I+FV   
Sbjct: 241 VKEAYLYQL-------------------------------LTCENYINSN--VIIFVNRT 267

Query: 438 HHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLA 497
              E + + LK     V+ ++  + Q  R   L  FR+    IL+ TDVA+RG+DIP + 
Sbjct: 268 ATAEVLRKTLKHLDLRVASLHSQMSQQERTNSLHRFRANAARILIATDVASRGLDIPTVE 327

Query: 498 NVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
            V+N+ +PS    +IHR GRTARAG SG A S ++
Sbjct: 328 LVVNYDIPSDPDTYIHRSGRTARAGKSGDAISFIT 362

>Kwal_56.24760 s56 (1136947..1138248) [1302 bp, 433 aa] {ON} YHR169W
           (DBP8) - DEAD-box protein [contig 160] FULL
          Length = 433

 Score =  172 bits (435), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 120/389 (30%), Positives = 177/389 (45%), Gaps = 65/389 (16%)

Query: 156 QPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPSRE 215
            PT IQ+  IP IL+ +D +G A+TGSGKT AF  PM+ K     +  G+  V+L+P+RE
Sbjct: 25  HPTAIQKACIPQILKGKDCIGGAKTGSGKTIAFAAPMLTKWSEDPS--GMFGVVLTPTRE 82

Query: 216 LAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMNLD 275
           LAMQ  + F       ++R  L+ GG+S+ +Q   +   P  +IATPGR  H  +    D
Sbjct: 83  LAMQIAEQFTALGSSMNIRVALVVGGESIVDQAIALQRKPHFIIATPGRLAHHVMNSGED 142

Query: 276 ----LKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT--RQTLLFSATLPHS--LVDFA 327
               LK V+++V DEAD L    F E L   +  LPP   RQ LLF+AT+     ++  A
Sbjct: 143 TIGGLKRVKFLVLDEADILLTDTFTEHLAICIGILPPKERRQNLLFTATVTDQVKMLQNA 202

Query: 328 KAGLTNPVLVRLDAES----KVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQL 383
            A    P L   + ES     +   L+  +L      +EA L  +L     I        
Sbjct: 203 PATEGKPPLFSYEVESMDKVAIPSTLKTSYLLVPEQVKEAYLYQILTSAAYI-------- 254

Query: 384 KQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYV 443
                                                      + + I+FV      E +
Sbjct: 255 -------------------------------------------DSSAIIFVNRTVTAEIL 271

Query: 444 SQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFS 503
            + LK     V+ ++  + Q  R   L  FR+    +L+ TDVA+RG+DIP +  V+N+ 
Sbjct: 272 RRTLKQLDVRVASLHSQMPQQERTNSLHRFRANAARVLIATDVASRGLDIPTVQLVVNYD 331

Query: 504 LPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           + ++   FIHR GRTARAG  G +   V+
Sbjct: 332 ISANPDTFIHRAGRTARAGRKGESICFVA 360

>KAFR0G03480 Chr7 (718012..720570) [2559 bp, 852 aa] {ON} Anc_6.148
           YBR237W
          Length = 852

 Score =  179 bits (454), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 115/398 (28%), Positives = 210/398 (52%), Gaps = 49/398 (12%)

Query: 145 ILNNISR-KGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH---- 199
           I+N+I     F++ TPIQ + +P I+  RD++G+++TGSGKT ++ LP++ ++K      
Sbjct: 269 IMNSIKNVMKFQELTPIQAQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVKSQRDLS 328

Query: 200 SAKIGVRAVILSPSRELAMQTYK-VFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVV 258
           +++ G   ++L+P+RELA+Q ++ + K  +  + L  +  TGG  L++Q   +     +V
Sbjct: 329 NSETGPIGLVLAPTRELALQIHEEINKLINDDASLNCICCTGGSELKDQISSVKRGVKIV 388

Query: 259 IATPGRFLHLKVEMN----LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLL 314
           +ATPGRF+ L + +N    L    + +VV DEADRLF+MGF+ Q+ +++ A+ P +Q +L
Sbjct: 389 VATPGRFIDL-LTINSGKLLSTGRITFVVMDEADRLFDMGFEPQVTQIMKAIRPDKQCVL 447

Query: 315 FSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLF-LTTKNGEREANLLYLLQEVI 373
           FSAT  + +  FA   L NP+ + +++ + V+EN+   F +   + ++   L+ LL+E  
Sbjct: 448 FSATFSNKIRSFAMRVLKNPITITINSNNIVNENVSQNFRVCESDTQKFDELISLLKE-- 505

Query: 374 RIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILF 433
           R     A++                                      ++ L   K TI+F
Sbjct: 506 RNDKHEAQE----------------------------------GFEESDNLQDNK-TIIF 530

Query: 434 VPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDI 493
           V ++   + +   L  SG+ +  I+       R   L  +R    S+L+ T+V +RG+++
Sbjct: 531 VASQQICDILETNLVSSGFEIFSIHAGKPYQERVLNLEKYRRTRNSLLLCTEVLSRGLNV 590

Query: 494 PMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           P ++ VI ++   +   +IH  GRTAR  + G A S +
Sbjct: 591 PEVSLVIIYNAVKTFAQYIHTTGRTARGNSKGKAVSFL 628

>Ecym_4775 Chr4 (1507889..1509391) [1503 bp, 500 aa] {ON} similar to
           Ashbya gossypii AGR333C
          Length = 500

 Score =  174 bits (440), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 121/395 (30%), Positives = 195/395 (49%), Gaps = 65/395 (16%)

Query: 146 LNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKI-- 203
           L  I + GF   T +Q KTIP ++  RD++G A+TGSGKT AF +P IE L  HS K   
Sbjct: 48  LKAIEKMGFTTMTQVQAKTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIEML--HSLKFKP 105

Query: 204 --GVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIAT 261
             G   ++++P+RELA+Q + V +E          ++ GG +  ++   +    +++IAT
Sbjct: 106 RNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKLSKGVNLIIAT 165

Query: 262 PGRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALP-PTRQTLLFSATL 319
           PGR L HL+       K ++ ++ DEADR+ E+GF++++ +++  LP   RQ++LFSAT 
Sbjct: 166 PGRLLDHLQNTKGFIFKNLKALIIDEADRILEIGFEDEMKQIIKILPNEDRQSMLFSATQ 225

Query: 320 PHSLVDFAKAGL-TNPVLVRLDAESKVS--ENLEMLFLTTKNGEREANLLYLLQEVIRIP 376
              + D A+  L   P+ + +D+E + S  + LE  ++  ++ +R   L   L++     
Sbjct: 226 TTKVEDLARISLRPGPLFINVDSEKETSTVDGLEQGYVVCESDKRFLLLFTFLKKF---- 281

Query: 377 VATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPT 436
                Q K++                                            I+F+ +
Sbjct: 282 -----QTKKI--------------------------------------------IVFLSS 292

Query: 437 RHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPML 496
            + V Y ++LL      V  ++G   Q  R    F F +    ILV TDVAARG+DIP +
Sbjct: 293 CNSVRYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAQRGILVCTDVAARGLDIPAV 352

Query: 497 ANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
             +I F  P   + +IHRVGRTAR G  G   S++
Sbjct: 353 DWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 386

>NCAS0H01280 Chr8 complement(243749..246412) [2664 bp, 887 aa] {ON}
           Anc_6.148
          Length = 887

 Score =  179 bits (454), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 110/384 (28%), Positives = 198/384 (51%), Gaps = 44/384 (11%)

Query: 158 TPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH----SAKIGVRAVILSPS 213
           TPIQ + IP I+  RD++G+++TGSGKT ++ LP++  +K        + G   +IL+P+
Sbjct: 315 TPIQSQAIPAIMSGRDVIGISKTGSGKTISYLLPLLRHIKAQRPLSKNETGPLGLILAPT 374

Query: 214 RELAMQTYKVFKEF-SRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEM 272
           RELA+Q +   + F     ++RS+  TGG  L++Q   +     +V+ATPGRF+ L + +
Sbjct: 375 RELALQIHDEIERFIVHDENIRSICCTGGSELKKQINDLKRGVQIVVATPGRFIDL-LTL 433

Query: 273 N----LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLVDFAK 328
           N    +  + + +V+ DEADRLF++GF+ Q+ +++  + P +Q +LFSAT P+ L +FA 
Sbjct: 434 NTGKLVSTERITFVIMDEADRLFDLGFEPQITQIMKTIRPDKQCVLFSATFPNKLRNFAM 493

Query: 329 AGLTNPVLVRLDAESKVSENLEM-LFLTTKNGEREANLLYLLQEVIRIPVATAEQLKQLR 387
             L +P+ + +++ + V+EN+E  + +   +  +   LL +LQ           Q KQ  
Sbjct: 494 RILNSPLSITINSNNLVNENVEQKVAICETDSAKFQELLTILQ----------NQNKQQD 543

Query: 388 ALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVSQLL 447
                                                  +K TI+FV ++   + +   L
Sbjct: 544 QCENDEDEEREDETTL-----------------------DKKTIIFVASQQICDLLYSQL 580

Query: 448 KDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSLPSS 507
            + GY +  I+       R   L  F++   SIL+ T+V +RG+++P ++ VI ++   +
Sbjct: 581 VNFGYSLFAIHAGKPYQERITNLEGFKNTKNSILICTEVLSRGLNVPEVSLVIIYNAVKT 640

Query: 508 SKIFIHRVGRTARAGNSGWAYSIV 531
              ++H  GRTAR    G A +++
Sbjct: 641 FAQYVHTTGRTARGNLHGIAITLL 664

>YDR243C Chr4 complement(948518..950284) [1767 bp, 588 aa] {ON}
           PRP28RNA helicase in the DEAD-box family, involved in
           RNA isomerization at the 5' splice site
          Length = 588

 Score =  175 bits (443), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 122/402 (30%), Positives = 197/402 (49%), Gaps = 76/402 (18%)

Query: 154 FRQPTPIQRKTIPLIL---QTRDIVGMARTGSGKTAAFTLPMIEKL-----KGHSAKI-- 203
           F  PTPIQR TIP +    Q RD +G+A TGSGKT AF +P++ K+     +  S KI  
Sbjct: 194 FPSPTPIQRITIPNVCNMKQYRDFLGVASTGSGKTLAFVIPILIKMSRSPPRPPSLKIID 253

Query: 204 GVRAVILSPSRELAMQ----TYKVFKEFSRGS--DLRSVLLTGGDSLEEQFGMMMGNPDV 257
           G +A+IL+P+REL  Q    T KV K +S+ S  D + + + GG SLEE    +    D+
Sbjct: 254 GPKALILAPTRELVQQIQKETQKVTKIWSKESNYDCKVISIVGGHSLEEISFSLSEGCDI 313

Query: 258 VIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAAL------PPTRQ 311
           ++ATPGR +       L +K VE +V DEAD++ ++GF++Q+  +L  +         RQ
Sbjct: 314 LVATPGRLIDSLENHLLVMKQVETLVLDEADKMIDLGFEDQVTNILTKVDINADSAVNRQ 373

Query: 312 TLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQE 371
           TL+F+AT+   +   A   +  PV   +  E+                        L+Q+
Sbjct: 374 TLMFTATMTPVIEKIAAGYMQKPVYATIGVETGSEP--------------------LIQQ 413

Query: 372 VIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATI 431
           V+       ++ K+L+ +                                     +   I
Sbjct: 414 VVEYADNDEDKFKKLKPIVAKY---------------------------------DPPII 440

Query: 432 LFVPTRHHVEYVSQ-LLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARG 490
           +F+  +   +++++   K++   V+ ++G+  Q  R+  L  FR+    I++ T+VAARG
Sbjct: 441 IFINYKQTADWLAEKFQKETNMKVTILHGSKSQEQREHSLQLFRTNKVQIMIATNVAARG 500

Query: 491 VDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           +DIP ++ V+NF +      +IHR+GRT RA N G A S VS
Sbjct: 501 LDIPNVSLVVNFQISKKMDDYIHRIGRTGRAANEGTAVSFVS 542

>CAGL0K11198g Chr11 complement(1087381..1089129) [1749 bp, 582 aa]
           {ON} similar to uniprot|P23394 Saccharomyces cerevisiae
           YDR243c PRP28
          Length = 582

 Score =  175 bits (443), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 118/400 (29%), Positives = 202/400 (50%), Gaps = 73/400 (18%)

Query: 153 GFRQPTPIQRKTIPLILQT-----RDIVGMARTGSGKTAAFTLPMIEKLKGHSAKI---- 203
           GF +PT IQR TIP  + +     RDI+G+A TGSGKT AF++P++ +L    A+     
Sbjct: 190 GFDEPTAIQRITIPNAISSNKSVPRDILGIASTGSGKTLAFSIPILARLDALPARPVNLK 249

Query: 204 ---GVRAVILSPSRELAMQTY----KVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPD 256
              G  A++L P+RELA Q      ++   +    +L +V + GG S+ +    +    D
Sbjct: 250 TLDGPLALVLVPTRELAQQISQEINRLLSAWENKKNLNAVSIVGGHSMSDISHTLRNGCD 309

Query: 257 VVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALP----PTRQT 312
           ++IATPGR L +     + L  ++ +V DEADR+ ++GF++Q+  +L+ L       RQT
Sbjct: 310 ILIATPGRLLDVLDNHLVVLNKIQSLVLDEADRMIDLGFEDQMKSILSHLMADELAARQT 369

Query: 313 LLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEV 372
           +LF+ATL  S+   AK  L NP+ V + +     + L +  +    G+ +  L +L  ++
Sbjct: 370 MLFTATLSSSVESIAKGYLKNPLHVSVGSRWDSDKPL-ITQVVRHTGDDDKKLSFLKDDL 428

Query: 373 IRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATIL 432
           I+                                               N LP+    I+
Sbjct: 429 IK-----------------------------------------------NGLPA----II 437

Query: 433 FVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVD 492
           F+  +   ++++  L D   +V+ ++G+  Q+ R+  +   +SG  ++L+ T+VAARG+D
Sbjct: 438 FINYKETADWLTLRLSDRFNIVT-LHGSKSQSQRESAIQKLKSGTANVLIATNVAARGLD 496

Query: 493 IPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           IP +A V+NF +      +IHR+GRT RAG +G A + ++
Sbjct: 497 IPDVALVVNFQMSKKFDDYIHRIGRTGRAGKTGIAVTYLT 536

>Suva_2.409 Chr2 complement(727948..729717) [1770 bp, 589 aa] {ON}
           YDR243C (REAL)
          Length = 589

 Score =  174 bits (440), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 120/401 (29%), Positives = 197/401 (49%), Gaps = 76/401 (18%)

Query: 154 FRQPTPIQRKTIPLIL---QTRDIVGMARTGSGKTAAFTLPMIEKL-----KGHSAKI-- 203
           F  PTPIQR TIP +    Q RD +G+A TGSGKT AF +P++ ++     +  S KI  
Sbjct: 195 FHLPTPIQRITIPNVCRKKQYRDFLGVASTGSGKTLAFIVPILIRMSRSSPRPRSLKIMD 254

Query: 204 GVRAVILSPSRELAMQTY----KVFKEFS--RGSDLRSVLLTGGDSLEEQFGMMMGNPDV 257
           G +A+IL+P+REL  Q      KV K++S     D + V + GG SLEE    +    D+
Sbjct: 255 GPKALILAPTRELVQQIQAEAEKVTKKWSIENNYDCKVVSIVGGHSLEEISFSLSEGCDI 314

Query: 258 VIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT------RQ 311
           ++ATPGR +       L +K VE +V DEAD++ ++GF++Q+  +L  +  +      RQ
Sbjct: 315 LVATPGRLIDSLDNHLLVMKQVETLVLDEADKMIDLGFEDQVTNILTKVDVSADSSINRQ 374

Query: 312 TLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQE 371
           T++F+AT+   +   A   +  PV   +  ++                        L+Q+
Sbjct: 375 TMMFTATMTSVIEKIAAGYMKKPVYATIGVDTGSEP--------------------LIQQ 414

Query: 372 VIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATI 431
           ++       ++ K+LR++                                     E   I
Sbjct: 415 IVEYSDNDDQKFKKLRSVVTKY---------------------------------EPPII 441

Query: 432 LFVPTRHHVEYVSQLLKDSGYL-VSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARG 490
           +F+  +   +++++  ++   + V+ ++G+  Q  R+  L  FRSG   I+V T+VAARG
Sbjct: 442 VFINYKQTADWLAEKFQNETNMKVTILHGSKSQEQREHSLKLFRSGKVQIMVATNVAARG 501

Query: 491 VDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           +DIP ++ V+NF +P     +IHR+GRT RA   G A S V
Sbjct: 502 LDIPNVSLVVNFQIPKKIDDYIHRIGRTGRAAKEGTAISYV 542

>ZYRO0A03476g Chr1 complement(277585..278784) [1200 bp, 399 aa] {ON}
           highly similar to uniprot|Q12099 Saccharomyces
           cerevisiae YDR021W FAL1 Nucleolar protein required for
           maturation of 18S rRNA member of the eIF4A subfamily of
           DEAD-box ATP-dependent RNA helicases
          Length = 399

 Score =  169 bits (427), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 104/391 (26%), Positives = 193/391 (49%), Gaps = 57/391 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  I   GF  P+ IQ + I  I+  +D++  A++G+GKTA FT+ M++ L+     + 
Sbjct: 34  LLRGIYSYGFEAPSSIQSRAITQIISGKDVIAQAQSGTGKTATFTIGMLQVLELKRKDL- 92

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGN-PDVVIATPG 263
            +A++LSP+RELA Q+ +V        ++++  LTGG +L++    +  +   VV  TPG
Sbjct: 93  -QALVLSPTRELASQSCQVVSNLGDYLNVKAFALTGGKALKDDLKRIQSSGCHVVSGTPG 151

Query: 264 RFLHLKVEMNLDLKTVEYVVFDEADRLFE--MGFQEQLNELLAALPPTRQTLLFSATLPH 321
           R L L     +  + V+ +V DEAD L    +GF++Q+ ++ A LPP  Q ++ SAT+  
Sbjct: 152 RVLDLIKRQVVQTRNVQVLVLDEADELLSETLGFKQQIYDIFARLPPGCQVVVVSATMSR 211

Query: 322 SLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAE 381
            +++  K  +++PV + +  +    E +   ++     E + + L  L + + I      
Sbjct: 212 DILEVTKKFMSDPVKILVKRDEISLEGISQYYVDVSKEEWKFDTLCDLYDSLTIT----- 266

Query: 382 QLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVE 441
                                                            ++F  TR  V+
Sbjct: 267 -----------------------------------------------QCVIFCNTRKKVD 279

Query: 442 YVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVIN 501
           ++S+ L  S + V  ++G + Q  R + + +FR+G + +L+ TDV ARG+D+  ++ VIN
Sbjct: 280 WLSKKLIQSNFAVVSMHGDMKQEDRDKVMNDFRTGHSRVLISTDVWARGIDVQQISLVIN 339

Query: 502 FSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           + +P   + +IHR+GR+ R G  G A + ++
Sbjct: 340 YDMPEIMENYIHRIGRSGRFGRKGVAVNFIT 370

>NCAS0B02570 Chr2 (429423..431195) [1773 bp, 590 aa] {ON} Anc_8.469
          Length = 590

 Score =  173 bits (438), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 123/410 (30%), Positives = 197/410 (48%), Gaps = 75/410 (18%)

Query: 146 LNNISRKG--FRQPTPIQRKTIPLILQ-TRDIVGMARTGSGKTAAFTLPMIEKL------ 196
           L NI ++   F  PTP+QR TIP I++  RD VG+A TGSGKT AF LPM+ +L      
Sbjct: 185 LTNILQRDLKFDFPTPVQRITIPNIVKGNRDFVGVASTGSGKTLAFVLPMLTQLLTNGVP 244

Query: 197 ----KGHSAKIGVRAVILSPSRELAMQTY----KVFKEFSRGSDLRSVLLTGGDSLEEQF 248
               K  +  IG+   +L P+RELA Q      KV         ++   + GG SLEE  
Sbjct: 245 PIALKKMNGPIGL---VLVPTRELAQQIQLEAEKVVNLIREEYPIKIESIVGGHSLEEIS 301

Query: 249 GMMMGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPP 308
             +    D++IATPG+ +       L +  + Y+V DEAD++ ++GF++QL  +L  L  
Sbjct: 302 SNLNEGCDILIATPGKLIECLENHLLVISNLSYLVLDEADKMIDLGFEDQLKTILNNLEV 361

Query: 309 TR-------QTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGER 361
                    +TL+F+ATL   L   A   L NP+   + AE                   
Sbjct: 362 NNSNVSSLYRTLMFTATLSSPLEKIASGYLRNPIYASIKAEG------------------ 403

Query: 362 EANLLYLLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSA 421
            A+ +  +Q+V++      ++ K + ++                            +   
Sbjct: 404 -ADAMPQIQQVVQYCPTDDQKFKAIESI----------------------------LREK 434

Query: 422 NELPSEKATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSIL 481
           N + + +  I+F+  +   ++++     + Y V+ ++G+  Q  R+  +   RSG   IL
Sbjct: 435 NTMDNPRV-IIFINYKATADWLANKFASTKYKVTILHGSKSQEQREHSIQLLRSGKIQIL 493

Query: 482 VVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           + T+VAARG+DIP +A VINF  P     ++HR+GRT RAGN G A +++
Sbjct: 494 IATNVAARGLDIPNVALVINFHFPKDFADYVHRIGRTGRAGNLGTAVTLI 543

>Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON}
           YDR243C (REAL)
          Length = 604

 Score =  173 bits (438), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 121/401 (30%), Positives = 197/401 (49%), Gaps = 76/401 (18%)

Query: 154 FRQPTPIQRKTIPLIL---QTRDIVGMARTGSGKTAAFTLPMIEKL-----KGHSAKI-- 203
           F  PTPIQR TIP +    Q RD +G+A TGSGKT AF +P++ ++     +  S KI  
Sbjct: 210 FPLPTPIQRITIPNVCNAKQYRDFLGVASTGSGKTLAFIIPVLIRMSRSSPRPTSLKIMD 269

Query: 204 GVRAVILSPSRELAMQTY----KVFKEFSRGS--DLRSVLLTGGDSLEEQFGMMMGNPDV 257
           G +A+IL+P+REL  Q      KV K +SR S  D R V + GG SLEE    +    D+
Sbjct: 270 GPKALILAPTRELVQQIQVEAEKVTKIWSRESNYDCRVVSIVGGHSLEEISYSLSEGCDI 329

Query: 258 VIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAAL------PPTRQ 311
           ++ATPGR +       L +K VE +V DEAD++ ++GF++Q+  +L  +         RQ
Sbjct: 330 LVATPGRLIDSLENHLLVMKQVETLVLDEADKMIDLGFEDQVTTILTKVDVSADSATNRQ 389

Query: 312 TLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQE 371
           TL+F+AT+   +   A   +  PV   +  ++                        L+Q+
Sbjct: 390 TLMFTATMTPVIEKIAAGYMRKPVYATIGVDTGSEP--------------------LIQQ 429

Query: 372 VIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATI 431
           ++       ++ K+L+++                                     E   I
Sbjct: 430 IVEYADNEEQKFKKLKSIVTKY---------------------------------EPPII 456

Query: 432 LFVPTRHHVEYVSQ-LLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARG 490
           +F+  +   +++++   K++   V+ ++G+  Q  R+  L  FRSG   +++ T+VAARG
Sbjct: 457 IFINYKQTADWLAERFQKETNMRVTILHGSKSQEQREHSLQLFRSGRVQVMIATNVAARG 516

Query: 491 VDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           +DIP ++ V+NF +      +IHR+GRT RA   G A S+V
Sbjct: 517 LDIPNVSLVVNFQISKKIDDYIHRIGRTGRAAKKGTAISLV 557

>KAFR0B01520 Chr2 (286962..288452) [1491 bp, 496 aa] {ON} Anc_5.40
           YMR290C
          Length = 496

 Score =  171 bits (432), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 123/395 (31%), Positives = 194/395 (49%), Gaps = 65/395 (16%)

Query: 146 LNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKI-- 203
           L  I + GF + TP+Q +TIP ++  RD++G A+TGSGKT AF LP IE L  HS K   
Sbjct: 46  LKAIDKMGFTKMTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLLPAIEML--HSLKFKP 103

Query: 204 --GVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIAT 261
             G   ++++P+RELA+Q + V +E          ++ GG +  ++   +M   +++IAT
Sbjct: 104 RNGTGVIVITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEKLMKGVNILIAT 163

Query: 262 PGRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALP-PTRQTLLFSATL 319
           PGR L HL+       K ++ +V DEADR+ E+GF++++ +++  LP   RQ++LFSAT 
Sbjct: 164 PGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMRQIIKILPNEDRQSMLFSATQ 223

Query: 320 PHSLVDFAKAGL-TNPVLVRLDAE--SKVSENLEMLFLTTKNGEREANLLYLLQEVIRIP 376
              + D A+  L   P+ + + +E  S  ++ LE  ++  ++ +R   L   L+      
Sbjct: 224 TTKVEDLARISLRKGPLFINVVSEKDSSTADGLEQGYVVCESDKRFLLLFSFLKR----- 278

Query: 377 VATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPT 436
                Q K++                               + S N +            
Sbjct: 279 ----NQKKKIIVF----------------------------LSSCNSV------------ 294

Query: 437 RHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPML 496
           ++H E    LL      V  ++G   Q  R    F F +    ILV TDVAARG+DIP +
Sbjct: 295 KYHAE----LLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDVAARGLDIPAV 350

Query: 497 ANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
             +I F  P   + +IHRVGRTAR G  G   S++
Sbjct: 351 DWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 384

>Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON}
           YDR243C (REAL)
          Length = 587

 Score =  172 bits (435), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 122/404 (30%), Positives = 201/404 (49%), Gaps = 80/404 (19%)

Query: 154 FRQPTPIQRKTIPLIL---QTRDIVGMARTGSGKTAAFTLPMIEKL-----KGHSAKI-- 203
           F  PTPIQR TIP +    Q RD +G+A TGSGKT AF +P++ ++     +  S KI  
Sbjct: 193 FFSPTPIQRITIPNVCNAKQHRDFLGVASTGSGKTLAFIIPILIRMSRSPPRPSSLKIMD 252

Query: 204 GVRAVILSPSRELAMQ----TYKVFKEFSRGS--DLRSVLLTGGDSLEEQFGMMMGNPDV 257
           G +A+IL+P+REL  Q    T KV K +SR +  D R + + GG S EE    +    D+
Sbjct: 253 GPKALILAPTRELVQQIQAETEKVTKIWSRENNYDCRVISIVGGHSFEEISFSLSEGCDI 312

Query: 258 VIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAAL------PPTRQ 311
           ++ATPGR +       L +K VE +V DEAD++ ++GF++Q+  +L  +         RQ
Sbjct: 313 LVATPGRLIDSLDNHLLVMKQVETLVLDEADKMIDLGFEDQVTNILTKVDVNVDSATNRQ 372

Query: 312 TLLFSATLPHSLVDFAKAGLTNPVL--VRLDAESKVSENLEMLFLTTKNGEREANLLYLL 369
           TL+F+AT+   +   A   +  PV   + LD  S+                       L+
Sbjct: 373 TLMFTATMTPVIEKIAAGYMRKPVYATIGLDTGSEP----------------------LI 410

Query: 370 QEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKA 429
           ++V+       E+ K+L+++                                  +  E  
Sbjct: 411 RQVVEYADNEEEKFKKLKSVV---------------------------------IKYESP 437

Query: 430 TILFVPTRHHVEYVSQLLK-DSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAA 488
            I+F+  +   +++++  + ++   V+ ++G+  Q  R+  L  FR+G   I++ T+VAA
Sbjct: 438 IIIFINYKQTADWLAERFQTETNMKVTILHGSKSQEQREHSLQLFRTGKVQIMIATNVAA 497

Query: 489 RGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           RG+DIP ++ V+NF +      ++HR+GRT RA   G A+S VS
Sbjct: 498 RGLDIPNVSLVVNFQISKKIDDYVHRIGRTGRAQREGTAFSFVS 541

>TBLA0I01860 Chr9 (418583..419746) [1164 bp, 387 aa] {ON} Anc_3.249
           YDR021W
          Length = 387

 Score =  166 bits (419), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 99/391 (25%), Positives = 195/391 (49%), Gaps = 57/391 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  I   GF  P+ IQ + I  I+  +D++  A++G+GKTA FT+ M++ +   +  + 
Sbjct: 34  LLRGIYSYGFEAPSAIQSRAITQIISGKDVIAQAQSGTGKTATFTIGMLQAIDLKNKDL- 92

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGN-PDVVIATPG 263
            +A+ILSP+RELA Q ++V        +++S  +TGG ++++    +  N   VV  TPG
Sbjct: 93  -QALILSPTRELASQIHQVVSNLGDYMNVQSFAITGGKTMKDDIKKIQRNGCQVVSGTPG 151

Query: 264 RFLHLKVEMNLDLKTVEYVVFDEADRLFE--MGFQEQLNELLAALPPTRQTLLFSATLPH 321
           R L +     L  + ++ ++ DEAD L    +GF++Q+ ++   LPP+ Q ++ SAT+  
Sbjct: 152 RVLDMFKRQMLKSRNIKMLILDEADELLSETLGFKQQIYDIFTKLPPSCQVVVVSATMNK 211

Query: 322 SLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAE 381
            +++  K  + +PV + +  +    E ++  ++  +  E + + L  L + + I      
Sbjct: 212 DILEITKKFMNDPVKILVKRDEISLEGIKQYYVNVEREEWKFDTLCDLYDSLTIT----- 266

Query: 382 QLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVE 441
                                                            ++F  ++  V+
Sbjct: 267 -----------------------------------------------QCVIFCNSKKKVD 279

Query: 442 YVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVIN 501
           ++SQ L  + + +  ++G ++Q+ R + +  FR+G + +LV TDV ARG+D+  ++ VIN
Sbjct: 280 WLSQKLIQNNFAIVSMHGDMEQDERDRVMNEFRTGQSRVLVSTDVWARGIDVQQVSLVIN 339

Query: 502 FSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           + L  + + +IHR+GR+ R G  G A + ++
Sbjct: 340 YDLCENLENYIHRIGRSGRFGRKGIAINFIT 370

>SAKL0A06204g Chr1 complement(560276..562807) [2532 bp, 843 aa] {ON}
           similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237W PRP5 RNA helicase in the DEAD-box family
          Length = 843

 Score =  172 bits (437), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 89/227 (39%), Positives = 148/227 (65%), Gaps = 11/227 (4%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH----SAKIGVRAVI 209
           F  PTPIQ + IP I+  RD+VG+++TGSGKT +F LP++ ++K        + G   +I
Sbjct: 271 FVTPTPIQAQAIPAIMSGRDVVGISKTGSGKTVSFLLPLLRQIKAQRPLSKTETGPMGLI 330

Query: 210 LSPSRELAMQTYKVFKEFSRGS-DLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHL 268
           L+P+RELA+Q Y+   +F+ GS  +RS+  TGG  L++Q   +    +VV+ATPGRF+ L
Sbjct: 331 LAPTRELAVQIYEEVVKFTTGSGSIRSICCTGGSELKQQINDLKKGVEVVVATPGRFIDL 390

Query: 269 KVEMN----LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
            + +N    L  + + +VV DEADRLF++GF+ Q+ +++ A+ P +Q +LFSAT P+ L 
Sbjct: 391 -LTLNSGRLLSTERITFVVMDEADRLFDLGFEPQITQIMKAVRPDKQCVLFSATFPNKLK 449

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEM-LFLTTKNGEREANLLYLLQ 370
           +FA   L  P+ + ++++S ++EN+E  L +   + E+ A +L +L+
Sbjct: 450 NFALKILQKPISITINSKSLINENIEQRLKIFQTDNEKFAAMLEVLE 496

 Score = 61.6 bits (148), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 58/105 (55%)

Query: 427 EKATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDV 486
           ++ TI+FV ++   + +   L + GY+   I+     N R   L  F++    IL+ T+V
Sbjct: 519 DEKTIVFVSSQQICDLIYNRLLEHGYVTYAIHAGKPYNERASNLEKFKNTPNGILLCTEV 578

Query: 487 AARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
            +RG+++P ++ VI ++   +   ++H  GRTAR  N G A +++
Sbjct: 579 LSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGTNKGVALTML 623

>KNAG0A04130 Chr1 (559075..560904) [1830 bp, 609 aa] {ON} Anc_8.469
           YDR243C
          Length = 609

 Score =  168 bits (426), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 118/410 (28%), Positives = 209/410 (50%), Gaps = 76/410 (18%)

Query: 145 ILNNISRK-GFRQPTPIQRKTIPLILQT--RDIVGMARTGSGKTAAFTLPMIEKLKG--- 198
           +LN ++R   F +P+PIQR  IP I+    +D++G++ TGSGKT AF +P++ K+ G   
Sbjct: 206 LLNVLTRDLQFVEPSPIQRIAIPNIVHQPYKDLIGVSSTGSGKTVAFAVPILIKMNGLIR 265

Query: 199 -HSAKI--GVRAVILSPSRELAMQTYKVFKEFSR------GSDLRSVLLTGGDSLEEQFG 249
             S K+  G +A+IL+P+REL  Q     K  +        ++   V + GG SLEE   
Sbjct: 266 PRSLKLMEGPKALILAPTRELVQQIESQIKNVTTRDWTDDPNECTVVSIVGGHSLEELTN 325

Query: 250 MMMGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT 309
            +    D+++ATPGR +       L +  ++ +V DEAD++ ++GF++QL   L+ +   
Sbjct: 326 SLRNGCDILVATPGRLIDCLENHILTISNIDTLVLDEADKMIDLGFEDQLKLTLSKVNVE 385

Query: 310 R------QTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREA 363
                  QTL+F+ATL  ++   + + L +P+ + +D+                 GE   
Sbjct: 386 TKHRAGFQTLMFTATLSPAIELISHSYLQSPIHILVDS-----------------GEGSQ 428

Query: 364 NLLYLLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANE 423
                +++++R    T ++  +L+                                 A  
Sbjct: 429 P---QVKQIVRYSPNTDQRFVELK---------------------------------AKV 452

Query: 424 LPSEKA-TILFVPTRHHVEYVSQ-LLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSIL 481
           LP  KA  I+F+  ++  ++++Q   +++ Y V+ ++G+  Q  R+  L   R+G   I+
Sbjct: 453 LPQFKAPIIIFINYKNTADWLAQKFQQETAYKVTILHGSKSQEQREHSLQLLRTGKAQIM 512

Query: 482 VVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           + T++AARG+DIP ++ VINF +  +   ++HR+GRT RAGNSG A + V
Sbjct: 513 IATNIAARGLDIPNVSLVINFQMSKNFDDYVHRIGRTGRAGNSGTAITFV 562

>Suva_12.48 Chr12 (66743..69055) [2313 bp, 770 aa] {ON} YJL033W
           (REAL)
          Length = 770

 Score =  169 bits (428), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 119/383 (31%), Positives = 183/383 (47%), Gaps = 47/383 (12%)

Query: 146 LNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL--KGHSAKI 203
           L  +    F + T IQ  +IP+ LQ  DI+  A+TGSGKT AF +P+IE+L  +  +   
Sbjct: 53  LKGLRESSFMKLTEIQADSIPVSLQGHDILAAAKTGSGKTLAFLIPVIERLYREKWTEFD 112

Query: 204 GVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPG 263
           G+ A+I+SP+RELAMQ Y+V  +    +   + L+ GG  ++ +   +    +++I TPG
Sbjct: 113 GLGALIISPTRELAMQIYEVLTKIGSHTSFSAGLVIGGKDVKFELERI-SRINILIGTPG 171

Query: 264 RFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHS 322
           R L HL   + L+   ++ +V DEADR  +MGF++ L+ +++ L P+RQTLLFSAT   S
Sbjct: 172 RILQHLDQAVGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVSNLSPSRQTLLFSATQSQS 231

Query: 323 LVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQ 382
           + D A+  LT+   V  +     S+N          G    + L   Q  I +P+  A++
Sbjct: 232 VADLARLSLTDYKSVGTNDVMDGSDN---------KGPSTPDTLQ--QSYIEVPL--ADK 278

Query: 383 LKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEY 442
           L  L +                                 + L S+    L    + H  Y
Sbjct: 279 LDTLFSFIK------------------------------SHLKSKMIVFLSSSKQVHFVY 308

Query: 443 VSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINF 502
            +      G  + +++G   Q AR + L  F       L  TDV ARG+D P +  V+  
Sbjct: 309 ETFRKMQPGISLMHLHGRQKQRARTETLDKFNRAQQVCLFATDVVARGIDFPAVEWVVQI 368

Query: 503 SLPSSSKIFIHRVGRTARAGNSG 525
             P     +IHRVGR AR G  G
Sbjct: 369 DCPEDVDTYIHRVGRCARYGKKG 391

>Kpol_165.1 s165 complement(441..1766) [1326 bp, 441 aa] {ON}
           complement(441..1766) [1326 nt, 442 aa]
          Length = 441

 Score =  163 bits (413), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 107/351 (30%), Positives = 170/351 (48%), Gaps = 54/351 (15%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH---SA 201
           +L  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  +      S 
Sbjct: 124 VLEEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLSP 183

Query: 202 KIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIAT 261
             G   ++L+P+RELA+Q  K   +F   S +R+  + GG    +Q   +    ++VIAT
Sbjct: 184 GDGPIVLVLAPTRELAVQIQKECSKFGSSSRIRNSCVYGGVPRGQQIRELSRGAEIVIAT 243

Query: 262 PGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           PGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  + P RQTL++SAT P 
Sbjct: 244 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 303

Query: 322 SLVDFAKAGLTNPVLVRLDA-ESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATA 380
            +   A   L +P+ V++ + E   S N+  L     + E+   LL  L+        TA
Sbjct: 304 EVKQLAHDYLNDPIQVQIGSLELSASHNITQLVEVVSDFEKRDRLLKHLE--------TA 355

Query: 381 EQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHV 440
            + K  + L                                          +F  T+   
Sbjct: 356 SEDKDSKIL------------------------------------------VFASTKRTC 373

Query: 441 EYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGV 491
           + V++ L++ G+    I+G  DQ  R   L  FR G + I+V TDVAARG+
Sbjct: 374 DEVTKYLREDGWPALAIHGDKDQRERDWVLQEFREGRSPIMVATDVAARGI 424

>TDEL0E04210 Chr5 complement(786151..788373) [2223 bp, 740 aa] {ON}
           Anc_5.208 YLL008W
          Length = 740

 Score =  169 bits (427), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 91/213 (42%), Positives = 132/213 (61%), Gaps = 3/213 (1%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF +P+IE+L    AKI 
Sbjct: 230 VLKGLGDLGYTRPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKIA 289

Query: 205 -VRAVILSPSRELAMQTYKVFKEFSR-GSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATP 262
             R ++L+P+RELA+Q   V K+  +  S L   L  GG +L +Q   +   PD+V+ATP
Sbjct: 290 STRVIVLTPTRELAIQVSDVAKKLGKYVSGLTFGLAVGGLNLRQQEQSLKARPDIVVATP 349

Query: 263 GRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           GRF+ H++   + ++ +VE +V DEADR+ E GFQE+LNE+L+ LP  RQTLLFSAT+  
Sbjct: 350 GRFIDHIRNSASFNVDSVEVLVIDEADRMLEEGFQEELNEILSLLPSKRQTLLFSATMNS 409

Query: 322 SLVDFAKAGLTNPVLVRLDAESKVSENLEMLFL 354
            +       L  PV V +D   + +  L   F+
Sbjct: 410 KIKQLVSLTLKRPVRVMIDPPKQAASKLTQEFV 442

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 65/105 (61%)

Query: 427 EKATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDV 486
           +K  ++FV  +     +  +L   G  V  ++G+L Q  R Q +  F+S    ILV TD+
Sbjct: 467 QKRMVVFVARKEMAHRLRIILGLLGISVGELHGSLSQEQRLQSVNQFKSLEVPILVCTDL 526

Query: 487 AARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           A+RG+DIP +  VIN+ +P + ++++HRVGRTARAG  G + S+V
Sbjct: 527 ASRGLDIPKIEVVINYDMPKNYEVYLHRVGRTARAGREGRSVSLV 571

>TPHA0B02930 Chr2 (666924..668207) [1284 bp, 427 aa] {ON} Anc_6.148
           YBR237W
          Length = 427

 Score =  163 bits (412), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 105/351 (29%), Positives = 170/351 (48%), Gaps = 54/351 (15%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH---SA 201
           +L  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  +      S 
Sbjct: 125 VLEEVKAEGFDKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLSP 184

Query: 202 KIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIAT 261
             G   ++LSP+RELA+Q  K   +F + S +R+  + GG    +Q   ++   ++VIAT
Sbjct: 185 GDGPIVLVLSPTRELAVQIQKECSKFGQSSRIRNTCVYGGVPRGQQIRDLIRGAEIVIAT 244

Query: 262 PGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           PGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  + P RQTL++SAT P 
Sbjct: 245 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 304

Query: 322 SLVDFAKAGLTNPVLVRLDA-ESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATA 380
            +   A+  L +P+ V++ + E   S  +  L     + E+   L   L         TA
Sbjct: 305 EVQQLARDYLNDPIQVQIGSLELSASHTITQLVEVVSDFEKRDRLNKHL--------VTA 356

Query: 381 EQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHV 440
            + K                                          E   ++F  T+   
Sbjct: 357 SEDK------------------------------------------ESKILIFASTKRTC 374

Query: 441 EYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGV 491
           + +++ L++ G+    I+G  DQ  R   L  FR G + I+V TDVAARG+
Sbjct: 375 DEITKYLREDGWPALAIHGDKDQRERDWVLQEFRDGRSPIMVATDVAARGI 425

>AFL027C Chr6 complement(386001..388451) [2451 bp, 816 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR237W
           (PRP5)
          Length = 816

 Score =  169 bits (428), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 86/216 (39%), Positives = 143/216 (66%), Gaps = 11/216 (5%)

Query: 145 ILNNISRK-GFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSA-- 201
           I+N ++R+  F  PTPIQ + IP I+  RD++G+++TGSGKT +F LP++ ++K      
Sbjct: 247 IMNLLTRELEFTVPTPIQAQAIPAIMSGRDVIGISKTGSGKTVSFILPLLRQIKAQRPLG 306

Query: 202 --KIGVRAVILSPSRELAMQTYKVFKEFSRGS-DLRSVLLTGGDSLEEQFGMMMGNPDVV 258
             + G   +ILSP+RELA+Q ++   +F+ G   +RS+  TGG  L+ Q   +    ++V
Sbjct: 307 GDETGPLGLILSPTRELALQIHEEVTKFTSGDPSIRSLCCTGGSELKRQINDIKRGVEIV 366

Query: 259 IATPGRFLHLKVEMN----LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLL 314
           IATPGRF+ L + +N    ++ K + +VV DEADRLF++GF+ Q+N+++  + P +Q +L
Sbjct: 367 IATPGRFIDL-LSLNSGNLINPKRIVFVVMDEADRLFDLGFEPQVNQIMKCIRPDKQCVL 425

Query: 315 FSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLE 350
           FSAT P+ L  FA   L +PV + ++++S ++EN+E
Sbjct: 426 FSATFPNKLKSFASKILHDPVYITVNSKSLINENIE 461

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 57/106 (53%)

Query: 426 SEKATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTD 485
           +++ TI+FV ++   + +   L+ +G+    I+       R   L  F+     IL+ T+
Sbjct: 489 NDEKTIVFVSSQQICDILYNRLEANGFTTFAIHAGKIYTERAWNLKCFKETANGILICTE 548

Query: 486 VAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           V +RG+++P ++ VI ++   +   ++H  GRTAR  N G A +++
Sbjct: 549 VLSRGLNVPEVSLVIIYNAAKTFAQYVHTTGRTARGSNKGTALTLL 594

>Kpol_534.53 s534 (137204..139462) [2259 bp, 752 aa] {ON}
           (137204..139462) [2259 nt, 753 aa]
          Length = 752

 Score =  168 bits (426), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 151/257 (58%), Gaps = 12/257 (4%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +S  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF +P+IE+L    AK+ 
Sbjct: 242 VLKGLSDLGYTKPSPIQSATIPIGLSGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKVA 301

Query: 205 -VRAVILSPSRELAMQTYKVFKEFSR-GSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATP 262
             R ++L+P+RELA+Q   V K+  +  S L   L  GG +L +Q   +   PD+VIATP
Sbjct: 302 STRVIVLTPTRELAIQIADVGKKIGKYVSGLTFGLAVGGLNLRQQEQELKTRPDIVIATP 361

Query: 263 GRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           GRF+ H++   + ++ +VE +V DEADR+ E GFQE+LNE+L  LP  RQTLLFSAT+  
Sbjct: 362 GRFIDHVRNSSSFNVDSVEVLVMDEADRMLEEGFQEELNEILTLLPSKRQTLLFSATMNS 421

Query: 322 SLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGE--REANLLYLL-------QEV 372
            +       L  PV + ++   + +  L   F+  +  +  + A L YL+       Q+ 
Sbjct: 422 RIKSLISLSLRKPVRIMINPPKQAAARLTQEFVRIRKRDHLKPALLFYLIRKLDGTGQKR 481

Query: 373 IRIPVATAEQLKQLRAL 389
           I + VA  E   +LR +
Sbjct: 482 IVVFVARKEMAHKLRII 498

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 65/105 (61%)

Query: 427 EKATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDV 486
           +K  ++FV  +     +  +L   G  V  ++G+L Q  R Q + NF+S    +L+ TD+
Sbjct: 479 QKRIVVFVARKEMAHKLRIILGLLGMKVGELHGSLTQEQRLQSVNNFKSLEVPVLICTDL 538

Query: 487 AARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           A+RG+DIP +  VINF +P S +I++HRVGRTARAG  G + + V
Sbjct: 539 ASRGLDIPKIEVVINFDMPKSYEIYLHRVGRTARAGREGRSVTFV 583

>ACR040W Chr3 (431343..433634) [2292 bp, 763 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL033W (HCA4)
          Length = 763

 Score =  167 bits (424), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 119/378 (31%), Positives = 179/378 (47%), Gaps = 63/378 (16%)

Query: 158 TPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH--SAKIGVRAVILSPSRE 215
           T IQR  IP+ L+  D++G A+TGSGKT AF +P++EKL     +   G+ A+++SP+RE
Sbjct: 65  TDIQRAAIPVALKGHDVLGAAKTGSGKTLAFLVPVLEKLYHERWTELDGLGALVISPTRE 124

Query: 216 LAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGM-MMGNPDVVIATPGRFL-HLKVEMN 273
           LAMQ Y+V  +  +     + L+ GG  +  +F M  +   +++I TPGR L H+   + 
Sbjct: 125 LAMQIYEVLVKIGKYMSFSAGLVIGGKDV--KFEMERVSKINILIGTPGRLLQHMDQSVG 182

Query: 274 LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLVDFAKAGLTN 333
           L+   ++ +V DEADR  +MGF++ L+ +++ LPP+RQTLLFSAT   SL D A+  L +
Sbjct: 183 LNTSNLQILVLDEADRCLDMGFKKALDAIVSNLPPSRQTLLFSATQSQSLADLARLSLAD 242

Query: 334 PVLV-RLDAESK-----VSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLKQLR 387
              V  +D  S        ENLE  +                     I VA  ++L  L 
Sbjct: 243 YKTVGTMDGPSSKNKPATPENLEQFY---------------------IQVALPDKLDILF 281

Query: 388 ALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVSQLL 447
           +                                 + L S+    L    + H  Y +   
Sbjct: 282 SFIK------------------------------SHLKSKMIVFLSSSKQVHFVYETFRK 311

Query: 448 KDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSLPSS 507
              G  + +++G   Q AR + L  F       L  TDV ARG+D P +  VI    P  
Sbjct: 312 MQPGISLMHLHGRQKQTARTETLDKFSRAQHVCLFSTDVVARGIDFPSVDWVIQTDCPED 371

Query: 508 SKIFIHRVGRTARAGNSG 525
              +IHR GR+AR G +G
Sbjct: 372 VDTYIHRAGRSARYGKTG 389

>NCAS0A01550 Chr1 complement(302857..305103) [2247 bp, 748 aa] {ON}
           Anc_5.208
          Length = 748

 Score =  167 bits (424), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 89/213 (41%), Positives = 133/213 (62%), Gaps = 3/213 (1%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF +P+IE+L   SAKI 
Sbjct: 237 VLKGLATLGYTKPSPIQSATIPVALSGKDIIAGAVTGSGKTAAFMIPVIERLLFKSAKIA 296

Query: 205 -VRAVILSPSRELAMQTYKVFKEFSRG-SDLRSVLLTGGDSLEEQFGMMMGNPDVVIATP 262
             R ++L+P+RELA+Q   V K+  +  + +   L  GG +L +Q   +   PD+VIATP
Sbjct: 297 ATRVIVLTPTRELAIQISDVGKKIGKFINGITFGLAVGGLNLRQQEQELKARPDIVIATP 356

Query: 263 GRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           GRF+ H++   + ++ +VE +V DEADR+ E GFQE+LNE++  LP  RQTLLFSAT+  
Sbjct: 357 GRFIDHIRNSASFNVDSVEILVIDEADRMLEEGFQEELNEIMQLLPNKRQTLLFSATMNS 416

Query: 322 SLVDFAKAGLTNPVLVRLDAESKVSENLEMLFL 354
            +       L  PV + +D   + +  L   F+
Sbjct: 417 KIKQLVSLSLRKPVRIMIDPPKQAASRLTQEFV 449

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 65/105 (61%)

Query: 427 EKATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDV 486
           +K  ++FV  +     +  +L   G  V+ ++G+L Q  R + +  F+S    +L+ TD+
Sbjct: 474 QKRMVVFVSRKEMAHRLRIILGLLGMNVAELHGSLSQEQRLESVTKFKSLEIPVLICTDL 533

Query: 487 AARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           A+RG+DIP +  VIN+ +P S +I++HRVGRTARAG  G + S V
Sbjct: 534 ASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVSFV 578

>Kwal_26.8470 s26 complement(798445..799722) [1278 bp, 425 aa] {ON}
           YBR237W (PRP5) - RNA helicase homolog [contig 61] FULL
          Length = 425

 Score =  161 bits (408), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 106/351 (30%), Positives = 171/351 (48%), Gaps = 54/351 (15%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH---SA 201
           +L+ +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  +      S 
Sbjct: 123 VLSEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLSP 182

Query: 202 KIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIAT 261
             G   ++LSP+RELA+Q      +F + S +R+  + GG     Q   +    ++VIAT
Sbjct: 183 GDGPIVLVLSPTRELAVQIQTECSKFGKSSRIRNTCVYGGVPRGHQIRELSRGAEIVIAT 242

Query: 262 PGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           PGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  + P RQTL++SAT P 
Sbjct: 243 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 302

Query: 322 SLVDFAKAGLTNPVLVRLDA-ESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATA 380
            +   A+  L +P+ V + + E   S N++ +       ++   LL  L+        TA
Sbjct: 303 EVQQLARDYLHDPIQVNVGSLELAASHNIKQVVEVVSEMDKRDRLLKHLE--------TA 354

Query: 381 EQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHV 440
            + K  + L                                          +F  T+   
Sbjct: 355 SEDKDSKIL------------------------------------------IFASTKRTC 372

Query: 441 EYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGV 491
           + V+++L+  G+    I+G   QN R   L  FRSG + I+V TDVAARG+
Sbjct: 373 DEVTRVLRQDGWPALAIHGDKAQNERDWVLQEFRSGNSPIMVATDVAARGI 423

>KLTH0A02244g Chr1 (190077..191873) [1797 bp, 598 aa] {ON} similar
           to uniprot|P25808 Saccharomyces cerevisiae YFL002C SPB4
           involved in the maturation of 25S ribosomal RNA
           ATP-dependent RNA helicase
          Length = 598

 Score =  164 bits (416), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 116/403 (28%), Positives = 194/403 (48%), Gaps = 60/403 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEK-----LKGH 199
           I   I   GF   TP+Q  TIP+    +D+V  + TGSGKT AFT+P++EK     L G 
Sbjct: 18  IRTAIDAMGFEIMTPVQASTIPMFSGNKDVVVESVTGSGKTIAFTIPILEKVVKEVLSGS 77

Query: 200 SAKIG-VRAVILSPSRELAMQTYKVFKEF-----SRGSDLRSVLLTGGDSL---EEQFGM 250
             K G   ++I+SP+REL+ Q   V + F     S    ++S L+ G  S    ++    
Sbjct: 78  PLKRGHFYSLIISPTRELSKQIQDVVEAFLAYYPSESCPIKSQLIVGTSSCSVRDDVSKF 137

Query: 251 MMGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTR 310
           +   P ++I TPGR L       +   +   VV DEADRL ++ F++ +  +L  LP  R
Sbjct: 138 LENAPQILIGTPGRVLDFMKASTVKTSSCGVVVLDEADRLLDVSFEKDVESILGMLPKQR 197

Query: 311 QTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQ 370
           +T LFSAT+  +     + G+ NPV + + ++ +  E+L++ ++  K  E+  +LL ++ 
Sbjct: 198 RTGLFSATISSAGNQIYRTGMRNPVKIAVKSKVQNPESLQINYIVVKPEEKLHHLLNIIN 257

Query: 371 EVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKAT 430
                       ++  + +                                   P+ +A 
Sbjct: 258 -----------NMRYRKCIVY--------------------------------FPTCQAV 274

Query: 431 ILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLT-SILVVTDVAAR 489
             F     H+  +S+   D    V  ++G L  N+R   L  F + L  ++L+ TDVAAR
Sbjct: 275 TYFYSFLKHLSDISKTRDD--LEVYSLHGKLQTNSRIGTLAKFSTSLNIAVLLTTDVAAR 332

Query: 490 GVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           G+DIP +  V+ F  P+++++F+HR GRT RA  +G A + ++
Sbjct: 333 GIDIPEVDLVLQFDPPTNAEMFLHRCGRTGRANRAGKAITFIN 375

>CAGL0F05577g Chr6 (559705..561705) [2001 bp, 666 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194c
           MSS116
          Length = 666

 Score =  164 bits (415), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 128/410 (31%), Positives = 206/410 (50%), Gaps = 70/410 (17%)

Query: 145 ILNNISRKGFRQPTPIQRKTI-PLILQT-RDIVGMARTGSGKTAAFTLPMIEKLKGH--S 200
           + ++ISR GF Q TP+Q+KTI P+I  +  DI+  A+TG+GKT AF LP+ + L      
Sbjct: 170 LYDSISRMGFEQLTPVQQKTIEPIITNSDSDIIARAKTGTGKTFAFLLPIFQHLLNTKID 229

Query: 201 AKIGVRAVILSPSRELAMQTY-KVFKEFSRGSDLRS---VLLTGGDSLEEQFGMMMG-NP 255
           ++  V++VI++P+R+LA+Q   +V K  S+   L++   V L GG + +     +   +P
Sbjct: 230 SQNKVKSVIVAPTRDLALQIEDEVRKIHSKNRKLKAFECVSLVGGTNFDRSIRYIEKVSP 289

Query: 256 DVVIATPGRFLHLKVEM-NLDLKTVEYVVFDEADRLFEMGFQEQL---NELLAALPPTR- 310
            +VI TPGR + +  +  N   K V++ V DEADRL E+GF+E L   N++L  L     
Sbjct: 290 SIVIGTPGRLIDVMEKFGNKFFKDVDFKVLDEADRLLEIGFKEDLSYINKMLNTLNTNST 349

Query: 311 ---QTLLFSATLPHSLVDFAKAGLTNPVLVRLDA----ESKVSENLEMLFLTTKNGEREA 363
              +TLLFSATL H +   +   +     + +D     E +  E ++   +    GE  A
Sbjct: 350 EHIRTLLFSATLDHKVQSLSNDIMNKEECLYIDTIDENEPQAHEKIDQTLVV---GETFA 406

Query: 364 NLLYLLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANE 423
           + LY          A  E +++                                     +
Sbjct: 407 DNLY----------AAIEHIREF----------------------------------GTK 422

Query: 424 LPSEKATILFVPTRHHVEYVSQLLKDSGYLVSY-IYGTLDQNARKQQLFNFRSGLTSILV 482
            P+ K+ ILF+PT    ++++ +LK    L  Y  +G +DQ  R + +  F++    +LV
Sbjct: 423 TPNYKS-ILFLPTVKFTKFMATILKRQVKLPIYEFHGQIDQKKRTRIVNEFKTMKKGLLV 481

Query: 483 VTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
            TDV ARG+D P +  V+   LPS    +IHR+GRTAR+G  G + + +S
Sbjct: 482 CTDVGARGMDFPNITEVLQIGLPSEIPNYIHRIGRTARSGKEGSSVTFIS 531

>Suva_10.67 Chr10 (136688..138922) [2235 bp, 744 aa] {ON} YLL008W
           (REAL)
          Length = 744

 Score =  164 bits (416), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 131/213 (61%), Gaps = 3/213 (1%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF +P+IE+L     KI 
Sbjct: 234 VLKGLASLGYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPGKIA 293

Query: 205 -VRAVILSPSRELAMQTYKVFKEFSR-GSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATP 262
             R ++L P+RELA+Q   V K+ +R  S +   L  GG +L +Q  ++   PD+VIATP
Sbjct: 294 STRVIVLLPTRELALQVADVGKQIARFVSGITFGLAVGGLNLRQQEQLLKSRPDIVIATP 353

Query: 263 GRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           GRF+ H++   + ++ +VE +V DEADR+ E GFQ++LNE++  LP  RQ LLFSAT+  
Sbjct: 354 GRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIMGLLPSNRQNLLFSATMNS 413

Query: 322 SLVDFAKAGLTNPVLVRLDAESKVSENLEMLFL 354
            +       L  PV + +D   + +  L   F+
Sbjct: 414 KIKSLVSLSLRRPVRIMIDPPKQAATKLTQEFV 446

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 65/108 (60%), Gaps = 6/108 (5%)

Query: 427 EKATILFVP---TRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVV 483
           +K  ++FV    T H +  +  LL   G  V  ++G+L Q  R   +  F++    +LV 
Sbjct: 471 QKRIVVFVARKETAHRLRIIMGLL---GMSVGELHGSLTQEQRLDSVNKFKNLEVPVLVC 527

Query: 484 TDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           TD+A+RG+DIP +  V+N+ +P S +I++HRVGRTARA   G + ++V
Sbjct: 528 TDLASRGLDIPKIEVVVNYDMPKSYEIYLHRVGRTARADREGRSVTLV 575

>Skud_14.219 Chr14 (403781..405088) [1308 bp, 435 aa] {ON} YNL112W
           (REAL)
          Length = 435

 Score =  159 bits (402), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 105/363 (28%), Positives = 179/363 (49%), Gaps = 58/363 (15%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH---SA 201
           +L  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  +      + 
Sbjct: 124 VLKEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLAP 183

Query: 202 KIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIAT 261
             G   ++LSP+RELA+Q      +F   S +R+  + GG    +Q   +    ++VIAT
Sbjct: 184 GDGPIVLVLSPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDLSRGSEIVIAT 243

Query: 262 PGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           PGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  + P RQTL++SAT P 
Sbjct: 244 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 303

Query: 322 SLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAE 381
            +   A   L +P+ V++                   G  E +  + + +V+ + V+  E
Sbjct: 304 EVKQLAADYLNDPIQVQV-------------------GSLELSASHTITQVVEV-VSDFE 343

Query: 382 QLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVE 441
           +  +L                               + +A++   E  T++F  T+   +
Sbjct: 344 KRDRLN----------------------------KHLETASQ-DDEYKTLVFASTKRMCD 374

Query: 442 YVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVIN 501
            +++ L++ G+    I+G  DQ  R   L  FR+G + ++V TDVAARG+       ++N
Sbjct: 375 DITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPVMVATDVAARGI------GMLN 428

Query: 502 FSL 504
           FS 
Sbjct: 429 FSF 431

>KLLA0F10505g Chr6 complement(966736..969174) [2439 bp, 812 aa] {ON}
           similar to uniprot|Q754U8 Ashbya gossypii AFL027C PRP5
           Pre-mRNA-processing ATP-dependent RNA helicase PRP5 and
           weakly similar to YBR237W uniprot|P21372 Saccharomyces
           cerevisiae PRP5 RNA helicase in the DEAD-box family
          Length = 812

 Score =  164 bits (416), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 79/205 (38%), Positives = 130/205 (63%), Gaps = 9/205 (4%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSA----KIGVRAVI 209
           F   TPIQ + IP I+  RD++G+++TGSGKT AF LP++ ++K        + G   +I
Sbjct: 266 FVTLTPIQCQAIPAIMSGRDVIGISKTGSGKTVAFLLPLVRQIKAQPPLAPDETGPIGLI 325

Query: 210 LSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLK 269
           L+P+RELA+Q  +   +F +GS + S+   GG  L++Q   +    D+++ATPGRF+ L 
Sbjct: 326 LTPTRELAVQIQEEALKFCKGSGISSICCVGGSELKQQINELKRGVDIIVATPGRFIDL- 384

Query: 270 VEMN----LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLVD 325
           + +N    L    + +VV DEADRLF++GF  Q+N+++  + P +Q +LFSAT P  L  
Sbjct: 385 MTLNSGHLLSPTRISFVVMDEADRLFDLGFGPQVNQIMGCIRPDKQCVLFSATFPSKLKH 444

Query: 326 FAKAGLTNPVLVRLDAESKVSENLE 350
           FA   L NP+ + ++++S ++EN++
Sbjct: 445 FASRTLKNPIQITINSKSLINENIQ 469

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 55/105 (52%)

Query: 427 EKATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDV 486
           ++ TI+FV ++   + +   L  +G     I+       R + L  F+     IL+ T+V
Sbjct: 500 DEKTIIFVGSQQLCDLLYDELLLNGITTFPIHAGKPSAERLRNLQKFKETDNGILICTEV 559

Query: 487 AARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
            +RG+++P ++ VI ++   +   ++H VGRT R  N+G A S V
Sbjct: 560 LSRGLNVPEVSLVIIYNAAKTIAQYVHTVGRTGRGTNNGVALSFV 604

>TBLA0H03240 Chr8 complement(787863..790166) [2304 bp, 767 aa] {ON}
           Anc_8.402 YDR194C
          Length = 767

 Score =  163 bits (413), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 124/416 (29%), Positives = 201/416 (48%), Gaps = 49/416 (11%)

Query: 149 ISRKGFRQPTPIQRKTIPLILQT--RDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVR 206
           + R GF+  TP+Q+KTI  IL+    D++  A+TG+GKT AF LP+ +KL        V+
Sbjct: 178 VHRLGFKSLTPVQQKTIKPILKDSGNDVIARAKTGTGKTFAFLLPLFQKLIESPNSAMVK 237

Query: 207 AVILSPSRELAMQT-YKVFKEFSRGSDLR---SVLLTGGDSLEEQFG-MMMGNPDVVIAT 261
           +VI++P+R+LA+Q   ++ K +   S LR    + + GG +       +    P++++AT
Sbjct: 238 SVIMAPTRDLALQIEQEILKLYKNNSALRQYNCLSIVGGTNYSYSLQRLHRERPNIIVAT 297

Query: 262 PGRFLHLKVEM-NLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTR-------QTL 313
           PGR L +  +  +     V++ V DEADRL E+GF+E L  +  +L           +TL
Sbjct: 298 PGRMLAVLSDFGDKFFSEVDFKVLDEADRLLEIGFKEDLVAISNSLDSVNSNGADHIRTL 357

Query: 314 LFSATLPHSLVDFAKAGLTNPVLVRLDA----ESKVSENLEMLFLTTKNGEREANLLYLL 369
           LFSATL   +   A   +     + LD     E +  EN+    + +   +  ++ +Y +
Sbjct: 358 LFSATLDDKVQTLANDIMNKEECLFLDTIDKNEPEAHENINQNLVVS---DAFSHSIYAV 414

Query: 370 QEVIR-------IPVA--TAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPS 420
            E IR       +P+A  T E+  ++ A                              P 
Sbjct: 415 IEHIRSRLHPTELPIAEVTTEEETKVEA--------------GVESVEETEVITKATKPF 460

Query: 421 ANELPSEKATILFVPTRHHVEYVSQLLKD----SGYLVSYIYGTLDQNARKQQLFNFRSG 476
                     ILF PT    +++SQL+K      G  +   +G +DQN R + +  F+  
Sbjct: 461 DKHDTQNYKAILFTPTVKCTKFLSQLIKREFQIEGIPIYEFHGKIDQNRRTRIVEKFKRA 520

Query: 477 LTSILVVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
            + ILV TDV ARG+D P +  V+   +PS    ++HR+GRTARAG  G + + +S
Sbjct: 521 NSGILVCTDVGARGMDFPNVQEVLQLGVPSELSNYVHRIGRTARAGKKGISTAFLS 576

>KLLA0A05731g Chr1 (536243..537433) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P10081 Saccharomyces cerevisiae
           YKR059W TIF1 translation initiation factor eIF4A
          Length = 396

 Score =  156 bits (395), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 99/370 (26%), Positives = 175/370 (47%), Gaps = 56/370 (15%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  I   GF +P+ IQ++ I  I++ +D++  A++G+GKT  F+   I  L+    KI 
Sbjct: 33  LLRGIFGYGFVEPSAIQQRAILPIIEGKDVLAQAQSGTGKTGTFS---IAALQNIDEKIK 89

Query: 205 V-RAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPG 263
             + +IL+P+RELA+Q  KV    +   D++     GG SL+E    + G   +++ TPG
Sbjct: 90  APQGLILAPTRELALQIQKVVMALAIHMDVKVHACIGGTSLQEDSEALRGGAQIIVGTPG 149

Query: 264 RFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSL 323
           R   +          ++  + DEAD +   GF+EQ+  +   LPPT Q +L SAT+P  +
Sbjct: 150 RVFDMIDRRIFKTDNIKMFILDEADEMLSTGFKEQIYNIFTMLPPTSQVVLLSATMPGDV 209

Query: 324 VDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQL 383
           ++     + +PV + +  +    E +   ++  +  + + + L  L + I +  A     
Sbjct: 210 LEVTSKFMKDPVRILVKKDELTLEGIGQYYVNVEEEQYKYDCLTDLYDSISVTQA----- 264

Query: 384 KQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYV 443
                                                          ++F  TR  VE +
Sbjct: 265 -----------------------------------------------VIFCNTRRKVEEL 277

Query: 444 SQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFS 503
           ++ L+++ + VS IY  L Q  R   +  FRSG + IL+ TD+ ARG+D+  ++ VIN+ 
Sbjct: 278 TERLRENNFTVSAIYSDLQQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYD 337

Query: 504 LPSSSKIFIH 513
           LPS+ + +IH
Sbjct: 338 LPSNKENYIH 347

>ACR253C Chr3 complement(802236..803426) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL138C
           (TIF2) and YKR059W (TIF1)
          Length = 396

 Score =  156 bits (395), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 98/369 (26%), Positives = 174/369 (47%), Gaps = 54/369 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  I   GF  P+ IQ++ I  I++  D++  A++G+GKT  F++  ++++   S K  
Sbjct: 33  LLRGIYGYGFVDPSAIQQRAILPIIEGHDVLAQAQSGTGKTGTFSIAALQRID-ESIK-A 90

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A+IL+P+RELA+Q  KV    +   D++     GG    E    +     +V+ TPGR
Sbjct: 91  PQALILAPTRELALQIQKVVMALALHMDVKVHACIGGTDPREDAEALRAGAQIVVGTPGR 150

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
              +    N     ++  + DEAD +   GF+EQ+ ++   LPPT Q +L SAT+P  ++
Sbjct: 151 VFDMIERRNFKTDHIKMFILDEADEMLSSGFKEQIYKIFTMLPPTTQVVLLSATMPKEVL 210

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
           D     +  PV + +  ++   E ++  ++  ++ E + + L  L + I +  A      
Sbjct: 211 DVTDKFMNKPVRILVKKDALTLEGIQQYYINVESEEYKYDCLSDLYDSISVTQA------ 264

Query: 385 QLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVS 444
                                                         ++F  TR  VE ++
Sbjct: 265 ----------------------------------------------VIFCNTRRKVEELT 278

Query: 445 QLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSL 504
           + L D  + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  ++ VIN+ L
Sbjct: 279 KRLTDDSFTVSAIYSDLPQAQRDTIMKEFRTGSSRILISTDLLARGIDVQQVSLVINYDL 338

Query: 505 PSSSKIFIH 513
           P++ + +IH
Sbjct: 339 PNNKENYIH 347

>Kwal_23.5125 s23 complement(1024642..1026438) [1797 bp, 598 aa]
           {ON} YFL002C (SPB4) - ATP-dependent RNA helicase [contig
           7] FULL
          Length = 598

 Score =  160 bits (404), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 120/411 (29%), Positives = 187/411 (45%), Gaps = 76/411 (18%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEK-----LKGH 199
           I   I   G+   TP+Q  TIPL    +D+V  + TGSGKT AF +P++EK     + G 
Sbjct: 18  IRTAIDAMGYETMTPVQASTIPLFSGNKDVVVESVTGSGKTVAFVIPVLEKVMKDIINGV 77

Query: 200 SAKIG-VRAVILSPSRELAMQTYKVFKEF-----SRGSDLRSVLLTG--GDSLEEQFGMM 251
           S K G   ++I+SP+REL+ Q   VF  F     S    ++S LL G    S+ +     
Sbjct: 78  SLKKGHFHSLIISPTRELSKQIQSVFDSFLEFYPSTPCPIKSQLLVGTSASSVRDDVNAF 137

Query: 252 MGN-PDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTR 310
             N P +++ TPGR         +   +   V+ DEADRL ++ F++++  +L  LP  R
Sbjct: 138 TENKPQILVGTPGRTFEFLKSTAVKSTSCSVVILDEADRLLDVSFEKEVESILNLLPKQR 197

Query: 311 QTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQ 370
           +T LFSAT+  +     + G+ NPV + + A+ +  E+L++ +L  K  ++   LL +L 
Sbjct: 198 RTGLFSATISSAGDQIFRTGMRNPVKIAVRAKGQNPESLKINYLVVKPEDKLQQLLNIL- 256

Query: 371 EVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKAT 430
                                                              N     K  
Sbjct: 257 ---------------------------------------------------NNFRYRKCI 265

Query: 431 ILFVPTRHHVEYVSQLLKDSGYL--------VSYIYGTLDQNARKQQLFNFRSGL-TSIL 481
           + F PT   V Y    +K    L        +  ++G L  N+R   L  F   L +S+L
Sbjct: 266 VYF-PTCQAVTYFYSFIKHLCELGIIGASLQIFSLHGKLQTNSRLGTLTKFSQSLDSSVL 324

Query: 482 VVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           + TDVAARG+DIP +  V+ F  P ++++F+HR GRT RA   G A + ++
Sbjct: 325 LTTDVAARGIDIPEVDLVLQFDPPPNAEMFLHRCGRTGRANRVGKAVTFLN 375

>TPHA0N01130 Chr14 complement(237020..239653) [2634 bp, 877 aa] {ON}
           Anc_6.148 YBR237W
          Length = 877

 Score =  161 bits (407), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 82/230 (35%), Positives = 141/230 (61%), Gaps = 11/230 (4%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH----SAKIGVRAVI 209
           +  PTPIQ + IP I+  RD++G+++TGSGKT ++ LP+I  +K      +++ G   +I
Sbjct: 302 YDTPTPIQSQAIPAIMTGRDVIGISKTGSGKTISYALPLIRHVKAQRPLSNSETGPLGLI 361

Query: 210 LSPSRELAMQTYKVFKEFSRGS-DLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHL 268
           ++P+RELA+Q  +  ++F +    +RS+  TGG  L+ Q        ++V+ATPGRF+ L
Sbjct: 362 IAPTRELAIQINEEIQKFIKSDPSIRSICCTGGSELKNQIYEFKRGIEIVVATPGRFIDL 421

Query: 269 KVEMN----LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
            + +N    L+ K +  V+ DEADRLF+MGF+ Q+ +++  + P +Q +LFSAT P  L 
Sbjct: 422 -LTLNTGKLLNTKRITSVILDEADRLFDMGFEPQVTQIMKTIRPDKQCVLFSATFPIKLQ 480

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLF-LTTKNGEREANLLYLLQEVI 373
            F K  L NP+ + +D+++ V+EN+   F +   + E+   L+ +L   +
Sbjct: 481 AFVKRVLHNPLTITIDSKTMVNENVHQAFEILNNDSEKFFKLIEILDNFV 530

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 51/99 (51%)

Query: 433 FVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVD 492
           FV ++   + V+  L+   Y V  I+       R   L  F+    SIL+ T+V +RG++
Sbjct: 556 FVSSQQTCDAVAANLEKYDYDVFSIHAGRSYQERVSNLEKFKKTKNSILLCTEVLSRGLN 615

Query: 493 IPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           +P ++ VI ++  +    ++H  GRTAR    G A +++
Sbjct: 616 VPEVSLVIIYNAVNKFSQYVHTTGRTARGTRRGNAITLL 654

>TPHA0D01990 Chr4 complement(411607..413103) [1497 bp, 498 aa] {ON}
           Anc_5.337 YHR065C
          Length = 498

 Score =  156 bits (395), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 93/245 (37%), Positives = 136/245 (55%), Gaps = 11/245 (4%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPS 213
           F +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P++ KL     +    A IL+P+
Sbjct: 95  FSKPTPIQSKSIPPALEGHDIIGLAQTGSGKTAAFAIPILNKL--WEDQQPYYACILAPT 152

Query: 214 RELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFL-HLKVEM 272
           RELA Q  + F        +RSV + GG ++ +Q   +M  P ++IATPGR + HL+   
Sbjct: 153 RELAQQIKETFDSLGSLMGVRSVCIVGGMNMMDQSRELMRKPHIIIATPGRLMDHLENTK 212

Query: 273 NLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAGL 331
              L+ ++++V DEADRL +M F   L+ +L  +P   R T LFSAT+   +    +A L
Sbjct: 213 GFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQDRTTYLFSATMTSKIEKLQRASL 272

Query: 332 TNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPV-------ATAEQLK 384
           TNPV   +  + +  E L    +    G +   L+YLL E I   +       A AE+L 
Sbjct: 273 TNPVKCAVSNKYQTVETLVQTLMVVPGGLKNTYLIYLLNEFIGKSIIVFTRTKANAERLS 332

Query: 385 QLRAL 389
            L  L
Sbjct: 333 ALSNL 337

 Score = 92.8 bits (229), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 72/123 (58%)

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
           K+ I+F  T+ + E +S L     +  + ++G L+QN R   L  F++G   ILV  DVA
Sbjct: 316 KSIIVFTRTKANAERLSALSNLLEFSSTALHGDLNQNQRTGALDLFKAGKRQILVAIDVA 375

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXG 547
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG SG + S+VS              G
Sbjct: 376 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 435

Query: 548 KKI 550
           KK+
Sbjct: 436 KKL 438

>SAKL0H13574g Chr8 (1161196..1163202) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194C
           MSS116 DEAD-box protein required for efficient splicing
           of mitochondrial Group I and II introns presumed RNA
           helicase due to DEAD-box motif
          Length = 668

 Score =  159 bits (401), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 121/407 (29%), Positives = 192/407 (47%), Gaps = 74/407 (18%)

Query: 145 ILNNISRKGFRQPTPIQRKTI-PLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH--SA 201
           +  +I R GF   TP+Q+KTI P++  T D++  A+TG+GKT AF +PM E L  +   +
Sbjct: 131 LYKSIDRMGFPALTPVQQKTIKPILATTNDVIARAKTGTGKTLAFLIPMFEHLLANRTDS 190

Query: 202 KIGVRAVILSPSRELAMQ----TYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGN-PD 256
           +  V+ V+++P+R+LA+Q      K+ K        +SV L GG + +     M    P+
Sbjct: 191 QYMVKCVVVAPTRDLALQIDSEIQKIHKNNYGLQKFKSVCLIGGTNFDSSIKKMFKERPN 250

Query: 257 VVIATPGRFLHLKVEMNLD-LKTVEYVVFDEADRLFEMGFQE-------QLNELLAALPP 308
           +++ATPGR   +  + +    K V++ + DEADRL E+GF++       QLN +    P 
Sbjct: 251 IIVATPGRLQDVMSKFSGKFFKFVDFKILDEADRLLEIGFKQDLENISSQLNSINEKGPE 310

Query: 309 TRQTLLFSATLPHSLVDFAKAGLTNPVLVRLDA----ESKVSENLEMLFLTTKNGEREAN 364
             +TLLFSATL   + + A   +     + LD     E +  E ++   + +   E+ A+
Sbjct: 311 HIRTLLFSATLDDRVQELANDIMNREECLFLDTVDKNEPEAHEKIDQHLVIS---EKFAH 367

Query: 365 LLYLLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANEL 424
            LY   E I+  +A  E LK                                        
Sbjct: 368 NLYAPIEEIKSQLAENENLK---------------------------------------- 387

Query: 425 PSEKATILFVPTRHHVEY----VSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSI 480
                 ILFVPT    ++    + Q+L D  + +   +G ++Q  R + +  F+     +
Sbjct: 388 -----AILFVPTVKFAKFFCRSLEQILPD--FPILEFHGKIEQRRRTRIVQEFKRAKRGL 440

Query: 481 LVVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWA 527
           LV TDV ARG+D P +  V    +PS    +IHR+GRTAR G  G A
Sbjct: 441 LVSTDVGARGMDFPNIDEVFQIGVPSELANYIHRIGRTARGGKEGRA 487

>TPHA0B03040 Chr2 complement(690810..692000) [1191 bp, 396 aa] {ON}
           Anc_1.211 YJL138C
          Length = 396

 Score =  153 bits (386), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 99/370 (26%), Positives = 179/370 (48%), Gaps = 57/370 (15%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F++  +E++   S+   
Sbjct: 34  LLKGVYGYGFEEPSAIQQRAILPIVEKHDVLAQAQSGTGKTGTFSIAALERID--SSIKS 91

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDS-LEEQFGMMMGNPDVVIATPG 263
            +A+IL+P+RELA+Q  KV    +   D++     GG S +E+  G+   +  +V+ TPG
Sbjct: 92  PQALILAPTRELALQIQKVVIALALHMDVKVHACIGGTSFVEDSEGLR--DAQIVVGTPG 149

Query: 264 RFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSL 323
           R              ++  + DEAD +   GF+EQ+ ++   LPPT Q +L SATLP+ +
Sbjct: 150 RVSDNIQRRRFKTDNIKMFILDEADEMLSSGFREQIYQIFTMLPPTTQVVLLSATLPNDV 209

Query: 324 VDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQL 383
           ++     + NPV + +  +    E ++  ++  +  + + + L  L + I +  A     
Sbjct: 210 LEVTTKFMRNPVRILVKKDELTLEGIKQFYINVEEDDYKFDCLTDLYDSISVTQA----- 264

Query: 384 KQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYV 443
                                                          ++F  TR  VE +
Sbjct: 265 -----------------------------------------------VIFCNTRRKVEEL 277

Query: 444 SQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFS 503
           +Q L ++ + VS IY  L Q  R   +  FRSG + IL+ TD+ ARG+D+  ++ VIN+ 
Sbjct: 278 TQKLTENNFTVSSIYSDLPQQERDVIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYD 337

Query: 504 LPSSSKIFIH 513
           LP++ + +IH
Sbjct: 338 LPTNKENYIH 347

>KNAG0B04660 Chr2 complement(900857..902341) [1485 bp, 494 aa] {ON}
           Anc_5.337 YHR065C
          Length = 494

 Score =  155 bits (392), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 129/222 (58%), Gaps = 4/222 (1%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPS 213
           + +PTPIQ ++IP  L+ +DI+G+A+TGSGKTAAF +P++  L  H  +    A ILSP+
Sbjct: 94  YSKPTPIQSRSIPPALKGKDIIGLAQTGSGKTAAFAIPILNSL-WHDQQ-PYYACILSPT 151

Query: 214 RELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFL-HLKVEM 272
           RELA Q  + F        +RSV + GG ++ +Q   +M  P ++I TPGR + HL+   
Sbjct: 152 RELAQQIKETFDSLGSLMGVRSVCIVGGMNMMDQARDLMRKPHIIIGTPGRLMDHLENTR 211

Query: 273 NLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAGL 331
              L+ ++Y+V DEADRL +M F   L+ +L  +P   R T LFSAT+   +    +A L
Sbjct: 212 GFSLRNLKYLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSKIDKLQRASL 271

Query: 332 TNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVI 373
           TNPV   +  + +  + L    +    G ++  L+YLL E I
Sbjct: 272 TNPVKCAVSTKYQTVDTLVQTLMVVPGGVKDTYLVYLLNEFI 313

 Score = 99.0 bits (245), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 74/123 (60%)

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
           K+ I+F  T+ + E +S L     +  + ++G L+QN R   L  F++G  SILV TDVA
Sbjct: 315 KSMIIFTRTKANAERISGLANLLQFSATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 374

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXG 547
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG SG + S+VS              G
Sbjct: 375 ARGLDIPSVDVVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 434

Query: 548 KKI 550
           KK+
Sbjct: 435 KKL 437

>TDEL0H00930 Chr8 complement(152864..154051) [1188 bp, 395 aa] {ON}
           Anc_1.211 YJL138C
          Length = 395

 Score =  152 bits (384), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 98/369 (26%), Positives = 174/369 (47%), Gaps = 55/369 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +   GF  P+ IQ++ I  I++  D++  A++G+GKT  F++  ++++   SA   
Sbjct: 33  LLRGVFGYGFEDPSAIQQRAILPIIEGHDVLAQAQSGTGKTGTFSIAALQRID--SALKS 90

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A+IL+P+RELA+Q  KV    +   D++     GG S +E     + +  +V+ TPGR
Sbjct: 91  PQALILAPTRELALQIQKVVIALAFHMDIKVHACIGGTSFQED-AEGLRDAQIVVGTPGR 149

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
                        +++  + DEAD +   GF+EQ+ ++   LPPT Q +L SAT+P  ++
Sbjct: 150 VFDNIQRRKFKTDSIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPKDVL 209

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
           +     + NPV + +  +    E ++  ++  +    + + L  L + I +  A      
Sbjct: 210 EVTTKFMRNPVRILVKKDELTLEGIQQFYINVEQELYKYDCLTDLYDSISVTQA------ 263

Query: 385 QLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVS 444
                                                         ++F  TR  VE ++
Sbjct: 264 ----------------------------------------------VIFCNTRRKVEELT 277

Query: 445 QLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSL 504
           Q LK   + VS IY  L Q  R   +  FRSG + IL+ TD+ ARG+D+  ++ VIN+ L
Sbjct: 278 QKLKADNFTVSSIYSDLPQQERDIIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDL 337

Query: 505 PSSSKIFIH 513
           P++ + +IH
Sbjct: 338 PTNKENYIH 346

>NDAI0C04250 Chr3 (968216..969730) [1515 bp, 504 aa] {ON} Anc_5.337
          Length = 504

 Score =  154 bits (390), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 88/222 (39%), Positives = 128/222 (57%), Gaps = 4/222 (1%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPS 213
           + +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P++  L  H  +    A IL+P+
Sbjct: 104 YSKPTPIQSKSIPPALKGHDIIGLAQTGSGKTAAFAIPILNSL-WHDQQ-PYYACILAPT 161

Query: 214 RELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFL-HLKVEM 272
           RELA Q  + F        +RSV + GG ++ +Q   +M  P V+IATPGR + HL+   
Sbjct: 162 RELAQQIKETFDSLGSLMGVRSVCIVGGMNMMDQARDLMRKPHVIIATPGRLMDHLENTK 221

Query: 273 NLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAGL 331
              L+ ++Y+V DEADRL +M F   L+ +L  LP   R T LFSAT+   +    +A L
Sbjct: 222 GFSLRKLKYLVMDEADRLLDMEFGPVLDRILKILPTQGRTTYLFSATMTSKIDKLQRASL 281

Query: 332 TNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVI 373
           TNPV   +  + +  + L    +    G +   L+YLL E I
Sbjct: 282 TNPVKCAVSNKYQTVDTLVQTLIVVPGGLKNTFLIYLLNEYI 323

 Score =  100 bits (250), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 75/123 (60%)

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
           K+TI+F  T+ + E +S L     +  + ++G L+QN R   L  F++G  +ILV TDVA
Sbjct: 325 KSTIIFTRTKANAERISGLCNLLEFNATALHGDLNQNQRTGALDLFKAGRKTILVATDVA 384

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXG 547
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG SG + S+VS              G
Sbjct: 385 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 444

Query: 548 KKI 550
           KK+
Sbjct: 445 KKL 447

>KAFR0D04630 Chr4 complement(909161..910624) [1464 bp, 487 aa] {ON}
           Anc_5.337 YHR065C
          Length = 487

 Score =  154 bits (388), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 85/220 (38%), Positives = 126/220 (57%), Gaps = 4/220 (1%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPS 213
           + +PTPIQ K+IP  L  +DI+G+A+TGSGKTAAF +P++  L     ++   A ILSP+
Sbjct: 87  YEKPTPIQSKSIPPALNGKDIIGLAQTGSGKTAAFAIPILNSL--WHDQLPYYACILSPT 144

Query: 214 RELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFL-HLKVEM 272
           RELA Q  + F        +R+V + GG ++ +Q   +M  P ++IATPGR + HL+   
Sbjct: 145 RELAQQIKETFDSLGSLMGVRTVCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTR 204

Query: 273 NLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAGL 331
              L+ + Y+V DEADRL +M F   L+ +L  LP   R T LFSAT+   +    +A L
Sbjct: 205 GFSLRKLRYLVMDEADRLLDMEFGPVLDRILKILPTEGRTTYLFSATMTSKIDKLQRASL 264

Query: 332 TNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQE 371
           TNPV   +  + +  + L    +    G +   L+YLL E
Sbjct: 265 TNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNE 304

 Score = 96.3 bits (238), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 73/123 (59%)

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
           K  I+F  T+ + E ++ L     +  + ++G L+QN R   L  F++G  SILV TDVA
Sbjct: 308 KTFIIFTRTKANAERIAGLANLLEFNATALHGDLNQNQRTGALDLFKAGKRSILVATDVA 367

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXG 547
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG SG + S+VS              G
Sbjct: 368 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 427

Query: 548 KKI 550
           KK+
Sbjct: 428 KKL 430

>Kpol_1058.43 s1058 complement(121252..123075) [1824 bp, 607 aa]
           {ON} complement(121252..123075) [1824 nt, 608 aa]
          Length = 607

 Score =  156 bits (394), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 119/408 (29%), Positives = 188/408 (46%), Gaps = 86/408 (21%)

Query: 153 GFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL-----------KGHSA 201
           GF   TP+Q  TIPL  + +D+V  + TGSGKT +F +P+ EK+           KGH  
Sbjct: 26  GFENMTPVQAATIPLFARNKDVVVDSVTGSGKTVSFVIPIFEKIVQEEANTTKMKKGH-- 83

Query: 202 KIGVRAVILSPSRELAMQTYKVFKEF-----SRGSDLRSVLLTGGD--SLEEQFGMMMGN 254
                ++I+SP++ELA Q + VF+ F          +RS LL G +  ++ +     M N
Sbjct: 84  ---FHSLIVSPTKELAKQIHSVFESFLEHYPENLYPIRSQLLVGTNVKTVRDDVSDFMEN 140

Query: 255 -PDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTL 313
            P ++I TPGR L      ++       V+ DEADRL ++ F + +  ++  LP  R+T 
Sbjct: 141 KPQILIGTPGRILDFLKIPSVKTSMCSMVILDEADRLLDVSFLKDMENIMNILPKQRRTG 200

Query: 314 LFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVI 373
           LFSAT+  +  +  K GL NPV V ++++S+   +L                        
Sbjct: 201 LFSATITSAGDNIFKTGLRNPVKVTVNSKSQAPSSL------------------------ 236

Query: 374 RIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILF 433
           +I  A  E  K+L  +                            +   N    +K  I +
Sbjct: 237 KIDCAVVETDKKLEQV----------------------------ISIINNYKFKKC-IAY 267

Query: 434 VPTRHHVEYVS---QLLKDSGYL-----VSYIYGTLDQNARKQQLFNFRSGLT-SILVVT 484
            PT H V Y     Q L   G +     +  ++G L  +AR + L  F   ++ ++L+ T
Sbjct: 268 FPTCHSVTYFYSFMQYLLKKGIIKEEIQIYSLHGKLQTSARIKTLETFTETISNAVLLTT 327

Query: 485 DVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           DVAARG+DIP +  V+    P+  ++F+HR GRT RA   G A + ++
Sbjct: 328 DVAARGIDIPDVDLVLQLDPPTDPEVFLHRCGRTGRANKLGKAITFLT 375

>KLLA0C14608g Chr3 (1276354..1277817) [1464 bp, 487 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065C RRP3 Required for maturation of the 35S primary
           transcript of pre-rRNA and is required for cleavages
           leading to mature 18S RNA RRP3 is a DEAD box gene
           homologous to eIF-4a which encodes an RNA-dependent
           ATPase possessing helicase activity which is not
           specific for RNA
          Length = 487

 Score =  154 bits (388), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 86/222 (38%), Positives = 128/222 (57%), Gaps = 4/222 (1%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPS 213
           + +PTPIQ K IP  L+  DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 87  YNKPTPIQSKAIPPALKGSDIIGLAQTGSGKTAAFAIPILNQL-WHDQQ-PYYACILAPT 144

Query: 214 RELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFL-HLKVEM 272
           RELA Q  + F        +RS  + GG S+ +Q   +M  P ++IATPGR + HL+   
Sbjct: 145 RELAQQIKETFDSLGSLMGVRSTCIVGGMSMMDQARDLMRKPHIIIATPGRLMDHLENTK 204

Query: 273 NLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAGL 331
             +L+ ++Y+V DEADRL +M F   L+ +L  +P   R T LFSAT+   +    +A L
Sbjct: 205 GFNLRKLKYLVMDEADRLLDMEFGPVLDRILNIIPTQGRTTYLFSATMTSKIDKLQRASL 264

Query: 332 TNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVI 373
           TNPV   +  + +  + L    +    G +   L+YLL E I
Sbjct: 265 TNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEFI 306

 Score =  102 bits (254), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 55/123 (44%), Positives = 75/123 (60%)

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
           K+TI+F  T+ + E +S L     +  + ++G L+QN R   L  F++G  SILV TDVA
Sbjct: 308 KSTIVFTRTKANAERISNLCNLLEFSATALHGDLNQNQRTGALDLFKAGKRSILVATDVA 367

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXG 547
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG SG + S+VS              G
Sbjct: 368 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 427

Query: 548 KKI 550
           KK+
Sbjct: 428 KKL 430

>Kpol_1060.58 s1060 complement(135570..136760) [1191 bp, 396 aa]
           {ON} complement(135570..136760) [1191 nt, 397 aa]
          Length = 396

 Score =  151 bits (382), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 98/370 (26%), Positives = 178/370 (48%), Gaps = 57/370 (15%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F++  ++++   S+   
Sbjct: 34  LLKGVYGYGFEEPSAIQQRAILPIVEEHDVLAQAQSGTGKTGTFSIAALQRID--SSIKA 91

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDS-LEEQFGMMMGNPDVVIATPG 263
            +A+IL+P+RELA+Q  KV    +   D++     GG S +E+  G+   +  +V+ TPG
Sbjct: 92  PQALILAPTRELALQIQKVVIALAFHMDVKVHACIGGTSFVEDTEGL--KDAQIVVGTPG 149

Query: 264 RFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSL 323
           R              ++  + DEAD +   GF+EQ+ ++   LPPT Q +L SATLP  +
Sbjct: 150 RVSDNIQRHRFKTDNIKMFILDEADEMLSSGFREQIYQIFTMLPPTTQVVLLSATLPGDV 209

Query: 324 VDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQL 383
           ++     + NP+ + +  +    E ++  ++  +  + + + L  L + I +  A     
Sbjct: 210 LEVTTKFMRNPIRILVKKDELTLEGIKQFYINVEEEQYKFDCLSDLYDSISVTQA----- 264

Query: 384 KQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYV 443
                                                          ++F  TR  VE +
Sbjct: 265 -----------------------------------------------VIFCNTRRKVEEL 277

Query: 444 SQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFS 503
           +Q L +S + VS IY  L Q  R   +  FRSG + IL+ TD+ ARG+D+  ++ VIN+ 
Sbjct: 278 TQKLTESNFTVSSIYSDLPQQERDVIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYD 337

Query: 504 LPSSSKIFIH 513
           LP++ + +IH
Sbjct: 338 LPTNKENYIH 347

>Ecym_7324 Chr7 complement(689228..691021) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii AGL004C
          Length = 597

 Score =  155 bits (392), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 113/400 (28%), Positives = 182/400 (45%), Gaps = 70/400 (17%)

Query: 153 GFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL-----------KGHSA 201
           GF   TP+Q  TIPL    +D+V  + TGSGKT AF +P++EK+           KGH  
Sbjct: 26  GFEAMTPVQASTIPLFAGNKDVVVESVTGSGKTVAFVIPILEKIIKDGANSAAFRKGH-- 83

Query: 202 KIGVRAVILSPSRELAMQTYKVFKEF-----SRGSDLRSVLLTGGDSL---EEQFGMMMG 253
                ++I+SP+RELA Q   V + F          +RS ++ G + +   ++    M  
Sbjct: 84  ---FHSLIVSPTRELASQIQLVVQSFLNYYPDNCYPIRSQIIVGTNQVTVRDDVAEFMQN 140

Query: 254 NPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTL 313
            P ++I TPGR L     + +   +   VV DEAD+L +  F + ++ +L  LP  R+T 
Sbjct: 141 RPQILIGTPGRLLDFLKMVGVKTTSCGIVVLDEADKLLDYNFGKDVDNILKFLPKQRRTG 200

Query: 314 LFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVI 373
           LFSAT+  +  +  K G+ NPV + + +  K  ++L+M ++  +  E++  LL  +    
Sbjct: 201 LFSATISSAGDEVFKTGMRNPVKISVKSHKKAPQSLKMNYVVVE-PEKKFELLLSILNYY 259

Query: 374 RIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILF 433
           R                                                 LP+  +   F
Sbjct: 260 RFKKCIV------------------------------------------YLPTCISVTYF 277

Query: 434 VPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLT-SILVVTDVAARGVD 492
                H+  + Q+  D    +  ++G L   +R + L  F   L  S+L+ TDVAARG+D
Sbjct: 278 YAIIQHLTKLGQM--DEDLKIYSLHGKLQTTSRMKTLEKFTQDLNKSVLLTTDVAARGID 335

Query: 493 IPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           IP +  V+    P+ + IF+HR GRT RA   G A  +++
Sbjct: 336 IPNIDLVLQMDPPTDTDIFLHRCGRTGRANRVGKAIVLLN 375

>Skud_6.72 Chr6 complement(140844..142664) [1821 bp, 606 aa] {ON}
           YFL002C (REAL)
          Length = 606

 Score =  155 bits (393), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 123/403 (30%), Positives = 186/403 (46%), Gaps = 76/403 (18%)

Query: 153 GFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSA------KIGVR 206
           GF   TP+Q  TIP++   +D+V  + TGSGKTAAF +P++EK+    A      K    
Sbjct: 26  GFETMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPILEKIVKEEANTFKFKKAHFH 85

Query: 207 AVILSPSRELAMQTYKVFKEF--SRGSDLRSV---LLTGGD--SLEEQFGMMMGN-PDVV 258
           ++I++P+REL+ Q   V   F     SDL  V   LL G +  S+ +   + + N P ++
Sbjct: 86  SLIIAPTRELSRQIETVVLSFLEHYPSDLFPVKCQLLVGTNEGSVRDDVSIFLENRPQIL 145

Query: 259 IATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSAT 318
           + TPGR L       +       V+ DEADRL +M F + +  +L  LP  R+T LFSAT
Sbjct: 146 VGTPGRVLDFLQMPAVKTSACSMVILDEADRLLDMSFIKDIERILRLLPKQRRTGLFSAT 205

Query: 319 LPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVA 378
           +  +  D  K GL NPV + ++++ +   +L++ +          N L  LQ ++ I   
Sbjct: 206 MRSAGSDIFKTGLRNPVRITVNSKHQAPSSLKLDYCV-------VNPLEKLQLLVSI--- 255

Query: 379 TAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRH 438
                                                      N    +K  + F PT  
Sbjct: 256 ------------------------------------------LNNYKFKKCIVYF-PTCV 272

Query: 439 HVEYVS---QLLKDSGYLVS-----YIYGTLDQNARKQQLFNFRSGL-TSILVVTDVAAR 489
            V Y     Q L     L+S      ++G L  +AR + L +F   L  S+L  TDVAAR
Sbjct: 273 SVSYFYSFIQRLSKKNILISELEVFSLHGKLQTSARTKTLASFTESLNNSVLFTTDVAAR 332

Query: 490 GVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           G+DIP +  VI    P++S +F+HR GRT RA   G A + ++
Sbjct: 333 GIDIPEVDLVIQLDPPTNSDMFMHRCGRTGRANRIGKAITFLN 375

>Ecym_5196 Chr5 complement(405570..406760) [1191 bp, 396 aa] {ON}
           similar to Ashbya gossypii ACR253C
          Length = 396

 Score =  151 bits (381), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 97/369 (26%), Positives = 173/369 (46%), Gaps = 54/369 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  I   GF  P+ IQ++ I  I++  D++  A++G+GKT  F++  ++++   S K  
Sbjct: 33  LLRGIYGYGFVDPSAIQQRAILPIIEGHDVLAQAQSGTGKTGTFSIAALQRID-ESIK-S 90

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A+IL+P+RELA+Q  KV    +   D++     GG    E    +     +V+ TPGR
Sbjct: 91  PQALILAPTRELALQIQKVVMALALHMDVKVHACIGGTDPREDAEALRAGAQIVVGTPGR 150

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
              +          ++  + DEAD +   GF+EQ+ ++   LPPT Q +L SAT+P  ++
Sbjct: 151 VFDMIERRFFKTDHIKMFILDEADEMLSSGFKEQIYKIFTMLPPTTQVVLLSATMPKEVL 210

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
           D     +  PV + +  ++   E ++  F+  ++ E + + L  L + I +  A      
Sbjct: 211 DVTDKFMNKPVRILVKKDALTLEGIQQYFINVESEEYKYDCLSDLYDSISVTQA------ 264

Query: 385 QLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVS 444
                                                         ++F  TR  VE ++
Sbjct: 265 ----------------------------------------------VIFCNTRRKVEELT 278

Query: 445 QLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSL 504
           + L +  + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  ++ VIN+ L
Sbjct: 279 KRLTEDDFTVSAIYSDLPQAQRDTIMKEFRTGSSRILISTDLLARGIDVQQVSLVINYDL 338

Query: 505 PSSSKIFIH 513
           P++ + +IH
Sbjct: 339 PNNKENYIH 347

>AGL112C Chr7 complement(495879..497855) [1977 bp, 658 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR194C
           (MSS116)
          Length = 658

 Score =  156 bits (394), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 124/395 (31%), Positives = 191/395 (48%), Gaps = 70/395 (17%)

Query: 152 KGFRQPTPIQRKTIPLILQT-RDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVIL 210
           +GF + TP+Q+KT+  ILQT  D+V  A+TG+GKT AF +P+ ++L        V+AV++
Sbjct: 144 RGFDKLTPVQQKTLKPILQTEHDVVARAKTGTGKTLAFLMPLFQRLLEGPPSENVKAVVI 203

Query: 211 SPSRELAMQTYKVFKEFSRGS----DLRSVLLTGGDSLEEQF-GMMMGNPDVVIATPGRF 265
           +P+R+LA Q +    E    +       +V++ GG S  E F  +    P++V+ATPGR 
Sbjct: 204 APTRDLAAQIFNEINEMRNANRKLRRFNAVVMMGGSSRTETFRSLERRRPNIVVATPGRL 263

Query: 266 LHLKVEMNLDLKT-VEYVVFDEADRLFEMGFQ---EQLNELLAAL----PPTRQTLLFSA 317
           + +         T V++ V DEAD L E+GF+   EQ+N++L  L        +TLL SA
Sbjct: 264 IDMLEACGPKYFTEVDFKVLDEADTLLEIGFKQALEQINDILNQLNQKGTTHIRTLLVSA 323

Query: 318 TLPHSLVDFAKAGLTNPVLVRLDA----ESKVSENLEMLFLTTKN-GEREANLLYLLQEV 372
           TL   +   A + + +   + +D     E   +EN+    + +K+  +     LY ++E 
Sbjct: 324 TLDDKVQSLANSIMNHAKCLFIDTVDPNEQATNENIAQKVVISKDFADNITASLYKIRE- 382

Query: 373 IRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATIL 432
                                                          SAN  P  KA I+
Sbjct: 383 ---------------------------------------------EASAN--PKLKA-IV 394

Query: 433 FVPTRHHVEYVSQLLKDS--GYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARG 490
           F+PT   VEY  +LL+    G  V   +G L Q  R   +  FR+  + ILV TDVAARG
Sbjct: 395 FMPTIVAVEYWGELLQSQCRGTPVLLFHGGLSQGRRNSTMKRFRAMDSGILVCTDVAARG 454

Query: 491 VDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSG 525
           +D+  + +V    +P+S   +IHR+GRT RAG  G
Sbjct: 455 MDVSDVQHVYQVGVPTSPDNYIHRIGRTGRAGRKG 489

>KLTH0F05610g Chr6 complement(483243..484433) [1191 bp, 396 aa] {ON}
           highly similar to uniprot|P10081 Saccharomyces
           cerevisiae YKR059W TIF1 and highly similar to
           uniprot|P10081 Saccharomyces cerevisiae YJL138C
           TIF2translation initiation factor eIF4A
          Length = 396

 Score =  150 bits (380), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 97/370 (26%), Positives = 171/370 (46%), Gaps = 56/370 (15%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  I   GF  P+ IQ++ I  I +  D++  A++G+GKT  F++  ++K+     KI 
Sbjct: 33  LLRGIYGYGFVDPSAIQQRAILPITEGHDVLAQAQSGTGKTGTFSIAALQKI---DPKIK 89

Query: 205 V-RAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPG 263
             +A++L+P+RELA+Q  KV    +   D++     GG S  E    +     +V+ TPG
Sbjct: 90  APQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEALRDGAQIVVGTPG 149

Query: 264 RFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSL 323
           R   +          ++  + DEAD +   GF+EQ+ ++   LPPT Q +L SAT+P  +
Sbjct: 150 RVFDMIERRRFRTDHIKMFILDEADEMLSSGFKEQIYKIFTLLPPTTQVVLLSATMPQDV 209

Query: 324 VDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQL 383
           ++     + NP+ + +  +    E ++  F+  +  + + + L  L + I +  A     
Sbjct: 210 LEVTTKFMRNPIRILVKKDELTLEGIKQFFINVEEEDYKYDCLSDLYDSISVTQA----- 264

Query: 384 KQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYV 443
                                                          ++F  TR  VE +
Sbjct: 265 -----------------------------------------------VIFCNTRRKVEEL 277

Query: 444 SQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFS 503
           +Q L    + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  ++ VIN+ 
Sbjct: 278 TQRLVADNFTVSAIYSDLPQQQRDTIMKEFRTGSSRILISTDLLARGIDVQQVSLVINYD 337

Query: 504 LPSSSKIFIH 513
           LP++ + +IH
Sbjct: 338 LPTNKENYIH 347

>Smik_6.81 Chr6 complement(152467..154287) [1821 bp, 606 aa] {ON}
           YFL002C (REAL)
          Length = 606

 Score =  154 bits (390), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 119/402 (29%), Positives = 185/402 (46%), Gaps = 74/402 (18%)

Query: 153 GFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSA------KIGVR 206
           GF   TP+Q  TIP++   +D+V  + TGSGKTAAF +P++EK+    A      K    
Sbjct: 26  GFETMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPILEKIVKEEANSSKFKKAQFH 85

Query: 207 AVILSPSRELAMQTYKVFKEF--SRGSDL---RSVLLTGGDSL---EEQFGMMMGNPDVV 258
           ++I++P+REL+ Q   V   F     SDL   R  LL G +     ++    +   P ++
Sbjct: 86  SLIVAPTRELSRQIESVVLSFLEHYPSDLFPIRCQLLIGTNEATVRDDVSDFLRNRPQIL 145

Query: 259 IATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSAT 318
           I TPGR L       +       VV DEADRL ++ F + +  +L  LP  R+T LFSAT
Sbjct: 146 IGTPGRVLDFLQMPAVKTSACSMVVLDEADRLLDVSFIKDIERILRLLPKQRRTGLFSAT 205

Query: 319 LPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVA 378
           +  +  D  K GL NPV + ++++++   +L+M +      E+    L LL  ++     
Sbjct: 206 MRSAGSDIFKTGLRNPVRITVNSKNQAPSSLKMNYCVVNPVEK----LQLLVSIL----- 256

Query: 379 TAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILF---VP 435
                                                      N    +K+ + F   V 
Sbjct: 257 -------------------------------------------NNYKFKKSIVYFPTCVS 273

Query: 436 TRHHVEYVSQLLKDSGYL----VSYIYGTLDQNARKQQLFNFRSGLT-SILVVTDVAARG 490
             +   +V  L K    +    V  ++G L  +AR + L  F + L+ S+L  TDVAARG
Sbjct: 274 VSYFYSFVQHLAKRKTLINEVEVFSLHGKLQTSARTKTLAAFTNSLSNSVLFTTDVAARG 333

Query: 491 VDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           +DIP +  VI    P++S +F+HR GRT RA   G A + ++
Sbjct: 334 IDIPQVDLVIQLDPPTNSDMFMHRCGRTGRANRVGKAITFLN 375

>CAGL0L08976g Chr12 complement(981008..982861) [1854 bp, 617 aa]
           {ON} highly similar to uniprot|P25808 Saccharomyces
           cerevisiae YFL002c SPB4
          Length = 617

 Score =  154 bits (390), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 123/411 (29%), Positives = 186/411 (45%), Gaps = 92/411 (22%)

Query: 149 ISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL-----------K 197
           I+  GF   TP+Q  TIP+  + +D+V  + TGSGKT AF +P++EK+           K
Sbjct: 22  INVSGFDSMTPVQASTIPMFAKNKDVVVESVTGSGKTIAFVIPILEKIISEGINNSKFKK 81

Query: 198 GHSAKIGVRAVILSPSRELAMQTYKVFKEF-----SRGSDLRSVLLTGGD--SLEEQFGM 250
           GH       ++IL+P+REL+MQ   V   F          +RS L+ G +  S+ +    
Sbjct: 82  GH-----FYSLILAPTRELSMQIQNVVSSFLEHYPEDQYPIRSQLVVGTNEKSVRDDVNT 136

Query: 251 MMGN-PDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT 309
           ++   P ++I TPGR L      ++   +   VV DEADRL ++ F + + ++L  LP  
Sbjct: 137 LLDERPQILIGTPGRVLDFLQSPSVKTSSCGMVVLDEADRLLDVSFFKDVEKILNVLPKQ 196

Query: 310 RQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLL 369
           R+T LFSAT+  +     K GL NPV + ++++ K +     LF +    E +      L
Sbjct: 197 RRTGLFSATISSAGTLIFKTGLRNPVKITVNSQGKNAPTTLNLFYSVMKPEEK------L 250

Query: 370 QEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKA 429
           Q +I I       +  +R                                        K 
Sbjct: 251 QNLIHI-------MNNIRF---------------------------------------KK 264

Query: 430 TILFVPTRHHVEYVSQLLKDSGYL------------VSYIYGTLDQNARKQQLFNFRSGL 477
            I++  T   V +  Q LK   YL            V  I+G L   +R++ L  F   L
Sbjct: 265 CIVYFSTCVSVTFFYQYLK---YLQQTDKTLREDLQVISIHGKLTTQSRRKALSTFTESL 321

Query: 478 T-SILVVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWA 527
           +  IL+ TDVAARG+DIP +  V+    P+ + IF+HR GRT RA   G A
Sbjct: 322 SDCILLTTDVAARGIDIPDVDLVLQIDPPTDADIFLHRCGRTGRANKIGRA 372

>ZYRO0C14234g Chr3 complement(1116350..1117834) [1485 bp, 494 aa]
           {ON} highly similar to uniprot|Q75EW9 Ashbya gossypii
           AAL041C RRP3 ATP-dependent rRNA helicase RRP3 and
           similar to YHR065C uniprot|P38712 Saccharomyces
           cerevisiae YHR065C RRP3 Required for maturation of the
           35S primary transcript of pre-rRNA and is required for
           cleavages leading to mature 18S RNA RRP3 is a DEAD box
           gene homologous to eIF- 4a which encodes an
           RNA-dependent ATPase possessing helicase activity which
           is not specific for RNA
          Length = 494

 Score =  152 bits (384), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 84/222 (37%), Positives = 128/222 (57%), Gaps = 4/222 (1%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPS 213
           F +PTPIQ + IP  L+ RDI+G+A+TGSGKTAAF +P++ +L     K    A +L+P+
Sbjct: 92  FDKPTPIQARAIPPALEGRDIIGLAQTGSGKTAAFAIPILNRL--WEDKQPYYACVLAPT 149

Query: 214 RELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFL-HLKVEM 272
           RELA QT + F        +RS  + GG ++ +Q   +M  P ++IATPGR + HL+   
Sbjct: 150 RELAQQTKETFDSLGALMGVRSTCIVGGMNMMDQARELMRKPHIIIATPGRLMDHLENTK 209

Query: 273 NLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAGL 331
              L+ + ++V DEADRL +M F   L+++L  +P   R T LFSAT+   +    +A L
Sbjct: 210 GFSLRKLRFLVMDEADRLLDMEFGPVLDKILKVIPTQDRTTYLFSATMTSKIDKLQRASL 269

Query: 332 TNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVI 373
           T PV   +  + +  + L    +   +G +   L+YLL E I
Sbjct: 270 TEPVKCAVSNKYQTVDTLVQTLMVVPSGLKNTYLIYLLNENI 311

 Score =  100 bits (248), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 73/123 (59%)

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
           K  I+F  T+ + E +S L     +  + ++G L+QN R   L  F++G  SILV TDVA
Sbjct: 313 KTVIIFTRTKANAERLSALCNLLEFNATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 372

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXG 547
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG SG + S+VS              G
Sbjct: 373 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 432

Query: 548 KKI 550
           KK+
Sbjct: 433 KKL 435

>Ecym_3217 Chr3 complement(411925..413385) [1461 bp, 486 aa] {ON}
           similar to Ashbya gossypii AAL041C
          Length = 486

 Score =  152 bits (383), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 86/222 (38%), Positives = 126/222 (56%), Gaps = 4/222 (1%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPS 213
           F +PTPIQ K IP  LQ  DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 86  FTKPTPIQSKAIPPALQGNDIIGLAQTGSGKTAAFAIPILNQL-WHDQQ-PYYACILAPT 143

Query: 214 RELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFL-HLKVEM 272
           RELA Q  + F        +RS  + GG ++ +Q   +M  P ++IATPGR + HL+   
Sbjct: 144 RELAQQIKETFDSLGSLMGVRSTCIMGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 203

Query: 273 NLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAGL 331
              L+ + ++V DEADRL +M F   L+ +L  +P   R T LFSAT+   +    +A L
Sbjct: 204 GFSLRKLRFLVIDEADRLLDMEFGAVLDRILKNIPTKGRTTYLFSATMTSKIDKLQRASL 263

Query: 332 TNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVI 373
           TNPV   +  + +  + L    +    G +   L+YLL E I
Sbjct: 264 TNPVKCSVSNKYQTVDTLIQTLMVVPGGLKNTYLIYLLNEFI 305

 Score =  101 bits (252), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 55/123 (44%), Positives = 75/123 (60%)

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
           K+TI+F  T+ + E +S L     +  + ++G L+QN R   L  F++G  SILV TDVA
Sbjct: 307 KSTIVFTRTKANAERISGLCNLLEFSATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 366

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXG 547
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG SG + S+VS              G
Sbjct: 367 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 426

Query: 548 KKI 550
           KK+
Sbjct: 427 KKL 429

>Kpol_1005.11 s1005 complement(18157..19677) [1521 bp, 506 aa] {ON}
           complement(18157..19677) [1521 nt, 507 aa]
          Length = 506

 Score =  152 bits (383), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 84/222 (37%), Positives = 128/222 (57%), Gaps = 4/222 (1%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPS 213
           F +PTPIQ ++IP  LQ  DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 106 FAKPTPIQARSIPPALQGHDIIGLAQTGSGKTAAFAIPILNRL-WHDQQ-PYYACILAPT 163

Query: 214 RELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFL-HLKVEM 272
           RELA Q  + F        +RS  + GG ++ +Q   +M  P ++IATPGR + HL+   
Sbjct: 164 RELAQQIKETFDSLGSLMGVRSACIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTR 223

Query: 273 NLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAGL 331
              L+ ++++V DEADRL +M F   L+ +L  +P   R T LFSAT+   +    +A L
Sbjct: 224 GFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSKIDKLQRASL 283

Query: 332 TNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVI 373
           TNPV   +  + +  + L    +    G +   L+YL+ E I
Sbjct: 284 TNPVKCAVSNKYQTVDTLVQTLIVVPGGLKNTYLIYLMNEFI 325

 Score = 97.8 bits (242), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 73/123 (59%)

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
           K  I+F  T+ + E ++ L     +  + ++G L+QN R   L  F++G  SILV TDVA
Sbjct: 327 KTIIVFTRTKANAERITTLANLLEFSATALHGDLNQNQRTGSLDLFKAGRRSILVATDVA 386

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXG 547
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG SG + S+VS              G
Sbjct: 387 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 446

Query: 548 KKI 550
           KK+
Sbjct: 447 KKL 449

>NCAS0F02790 Chr6 (561303..562811) [1509 bp, 502 aa] {ON} Anc_5.337
          Length = 502

 Score =  152 bits (383), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 128/222 (57%), Gaps = 4/222 (1%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPS 213
           + +PTPIQ ++IP  L+  DI+G+A+TGSGKTAAF +P++  L  H  +    A IL+P+
Sbjct: 102 YTKPTPIQSRSIPPALKGNDIIGLAQTGSGKTAAFAIPILNSL-WHDQQ-PYYACILAPT 159

Query: 214 RELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFL-HLKVEM 272
           RELA Q  + F        +RS  + GG ++ +Q   +M  P ++IATPGR + HL+   
Sbjct: 160 RELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 219

Query: 273 NLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAGL 331
              L+ ++Y+V DEADRL +M F   L+ +L  LP   R T LFSAT+   +    +A L
Sbjct: 220 GFSLRKLKYLVMDEADRLLDMEFGPVLDRILKILPTQGRTTYLFSATMTSKIDKLQRASL 279

Query: 332 TNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVI 373
           TNPV   +  + +  + L    +    G ++  L+YLL E I
Sbjct: 280 TNPVKCAVSNKYQTVDTLVQTLIVVPGGLKDTYLVYLLNEFI 321

 Score =  102 bits (253), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/123 (44%), Positives = 74/123 (60%)

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
           K TI+F  T+ + E +S L     +  + ++G L+QN R   L  F++G  SILV TDVA
Sbjct: 323 KTTIIFTRTKANAERISGLCNLLEFNATALHGDLNQNQRTGALDLFKAGRKSILVATDVA 382

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXG 547
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG SG + S+VS              G
Sbjct: 383 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 442

Query: 548 KKI 550
           KK+
Sbjct: 443 KKL 445

>Suva_11.294 Chr11 (539139..540329) [1191 bp, 396 aa] {ON} YKR059W
           (REAL)
          Length = 396

 Score =  149 bits (376), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 97/369 (26%), Positives = 174/369 (47%), Gaps = 55/369 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F++  ++++   S K  
Sbjct: 34  LLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSVAALQRIDT-SVK-A 91

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A++L+P+RELA+Q  KV    +   D++     GG S  E     + +  +V+ TPGR
Sbjct: 92  PQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVED-AEGLKDAQIVVGTPGR 150

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
                         ++  + DEAD +   GF+EQ+ ++   LPPT Q +L SAT+P+ ++
Sbjct: 151 VFDNMQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVL 210

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
           +     + NPV + +  +    E ++  ++  +  + +   L  L + I +  A      
Sbjct: 211 EVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEDFKYECLTDLYDSISVTQA------ 264

Query: 385 QLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVS 444
                                                         ++F  TR  VE ++
Sbjct: 265 ----------------------------------------------VIFCNTRRKVEELT 278

Query: 445 QLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSL 504
             L+D  + VS IY  L Q  R   +  FRSG + IL+ TD+ ARG+D+  ++ VIN+ L
Sbjct: 279 TKLRDDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDL 338

Query: 505 PSSSKIFIH 513
           PS+ + +IH
Sbjct: 339 PSNKENYIH 347

>KAFR0G00650 Chr7 complement(164087..165274) [1188 bp, 395 aa] {ON}
           Anc_1.211 YJL138C
          Length = 395

 Score =  149 bits (375), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 95/369 (25%), Positives = 172/369 (46%), Gaps = 55/369 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +   GF  P+ IQ++ I  I+++ D++  A++G+GKT  F++  ++++   ++   
Sbjct: 33  LLRGVYGYGFENPSAIQQRAIMPIIESHDVLAQAQSGTGKTGTFSIAALQRID--TSIKA 90

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A++L+P+RELA+Q  KV    S   D++     GG S  E     + +  +V+ TPGR
Sbjct: 91  PQALMLAPTRELALQIQKVVMALSFHMDVKVHACIGGTSFVED-AEGLRDAQIVVGTPGR 149

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
                         ++  + DEAD +   GF+EQ+ ++   LPPT Q +L SAT+P  ++
Sbjct: 150 VFDNIQRRKFKTDNIKMFILDEADEMLSSGFKEQIYQIFTMLPPTTQVVLLSATMPSDVL 209

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
           +     + NPV + +  +    E ++  ++  +  + +   L  L + I +  A      
Sbjct: 210 EVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEQYKYECLTDLYDSISVTQA------ 263

Query: 385 QLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVS 444
                                                         ++F  TR  VE ++
Sbjct: 264 ----------------------------------------------VIFCNTRRKVEELT 277

Query: 445 QLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSL 504
           Q L    + VS IY  L Q  R   +  FRSG + IL+ TD+ ARG+D+  ++ VIN+ L
Sbjct: 278 QKLTADNFTVSSIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDL 337

Query: 505 PSSSKIFIH 513
           P++ + +IH
Sbjct: 338 PTNKENYIH 346

>Kpol_340.2 s340 complement(3233..5245) [2013 bp, 670 aa] {ON}
           complement(3233..5245) [2013 nt, 671 aa]
          Length = 670

 Score =  154 bits (388), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 124/410 (30%), Positives = 193/410 (47%), Gaps = 77/410 (18%)

Query: 149 ISRKGFRQPTPIQRKTIPLILQT--RDIVGMARTGSGKTAAFTLPMIEKL---KGHSAKI 203
           ISR GF   T +Q+KTI  IL+   RD++  A+TG+GKT AF +P+ E L   +  S  +
Sbjct: 130 ISRMGFPNLTAVQQKTIKPILENEDRDVIARAKTGTGKTFAFLIPLFEHLIRTRRESPDM 189

Query: 204 GVRAVILSPSRELAMQT-YKVFKEFSRGSDLR---SVLLTGGDSLEEQ-FGMMMGNPDVV 258
            V+AV+L+P+R+LA+Q   +V K  S    L+    + + GG    +  F +    P+++
Sbjct: 190 -VKAVVLAPTRDLALQIEQEVHKIHSNNYALKKFGCMSVVGGTKFGQSLFQLKKTRPNII 248

Query: 259 IATPGRFLHLKVEMNLD-LKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTR------- 310
           IATPGRF+     +  +  K V++ V DEADRL E+GF++ L  +  +L           
Sbjct: 249 IATPGRFIATVEAVGAEYFKHVDFKVLDEADRLLEIGFKDDLEYISTSLNGLNDVGKDHI 308

Query: 311 QTLLFSATLPHSLVDFAKAGLTNPVLVRLDA----ESKVSENLEMLFLTTKNGERE--AN 364
           +TLLFSATL   +   A   +     + LD     E +  E +E   + ++N      A 
Sbjct: 309 RTLLFSATLDEKVQTLADDVMNKSECLFLDTVDKNEPESHEKIEQSLVVSQNFAESTYAV 368

Query: 365 LLYLLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANEL 424
           + +LL++   +P   A                                            
Sbjct: 369 IDHLLKQTKNVPNYKA-------------------------------------------- 384

Query: 425 PSEKATILFVPTRHHVEYVSQLLKDS--GYLVSYIYGTLDQNARKQQLFNFRSGLTSILV 482
                 ILF PT    +++S LLK S   Y V   +G +DQ  R + + +F+     +LV
Sbjct: 385 ------ILFTPTIKATKFLSNLLKKSLHRYPVYEFHGKIDQAKRTRIVGSFKGAPAGLLV 438

Query: 483 VTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
            TDV ARG+D P +  V+   +PS    ++HR+GRTAR G  G +   +S
Sbjct: 439 CTDVGARGMDFPNVTEVLQLGVPSELSNYVHRIGRTARGGKEGASVIFLS 488

>ZYRO0D03058g Chr4 complement(237526..238713) [1188 bp, 395 aa] {ON}
           highly similar to uniprot|P10081 Saccharomyces
           cerevisiae YKR059W TIF1 translation initiation factor
           eIF4A
          Length = 395

 Score =  149 bits (375), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 94/369 (25%), Positives = 174/369 (47%), Gaps = 55/369 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F++  ++++  +     
Sbjct: 33  LLRGVFGYGFEEPSAIQQRAILPIIEAHDVLAQAQSGTGKTGTFSIAALQRIDVNVK--A 90

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A++L+P+RELA+Q  KV    +   D++     GG S +E     + +  +V+ TPGR
Sbjct: 91  PQALMLAPTRELALQIQKVVIALAFHMDIKVHACIGGTSFQED-AEGLRDAQIVVGTPGR 149

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
                         ++  + DEAD +   GF+EQ+ ++   LPPT Q +L SAT+P+ ++
Sbjct: 150 VFDNIQRRKFKTDHIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVL 209

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
           +     + NPV + +  +    E ++  ++  +    + + L  L + I +  A      
Sbjct: 210 EVTTKFMRNPVRILVKKDELTLEGIQQFYINVEEELYKYDCLTDLYDSISVTQA------ 263

Query: 385 QLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVS 444
                                                         ++F  TR  VE ++
Sbjct: 264 ----------------------------------------------VIFCNTRRKVEELT 277

Query: 445 QLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSL 504
           Q L+   + VS IY  L Q  R   +  FRSG + IL+ TD+ ARG+D+  ++ VIN+ L
Sbjct: 278 QKLRADSFTVSSIYSDLPQQERDVIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDL 337

Query: 505 PSSSKIFIH 513
           P++ + +IH
Sbjct: 338 PTNKENYIH 346

>Skud_2.369 Chr2 (660665..663211) [2547 bp, 848 aa] {ON} YBR237W
           (REAL)
          Length = 848

 Score =  155 bits (392), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 79/226 (34%), Positives = 145/226 (64%), Gaps = 13/226 (5%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSA----KIGVRAVI 209
           F   TPIQ + +P I+  RD++G+++TGSGKT ++ LP++ ++K   +    + G   +I
Sbjct: 274 FDSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVKAQRSLSKHETGPLGLI 333

Query: 210 LSPSRELAMQTYKVFKEFSRGSD--LRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLH 267
           L+P+RELA+Q ++   +F+ G+D  +RSV  TGG  +++Q   +    ++V+ATPGRF+ 
Sbjct: 334 LAPTRELALQIHEEVTKFT-GTDASIRSVCCTGGSEMKKQITDLKRGAEIVVATPGRFID 392

Query: 268 LKVEMN----LDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSL 323
           + + +N    L  K + +V+ DEADRLF++GF+ Q+ +++  + P +Q +LFSAT P+ L
Sbjct: 393 I-LTLNDGKLLSTKRITFVIMDEADRLFDLGFEPQITQIMKTVRPDKQCVLFSATFPNKL 451

Query: 324 VDFAKAGLTNPVLVRLDAESKVSENLEMLF-LTTKNGEREANLLYL 368
             FA   L +P+ + ++++  V+EN++  F +   + E+  NL+ +
Sbjct: 452 RSFAVRVLRSPISITINSKGLVNENVKQKFKICHSDDEKFENLIQI 497

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 56/101 (55%)

Query: 431 ILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARG 490
           I+FV ++   + +S+ L ++G +   I+       R   L  F+    SIL+ T+V +RG
Sbjct: 527 IIFVSSQQICDLISKKLTNAGIVAYAIHAGKPYQERLMNLEKFKREKNSILLCTEVLSRG 586

Query: 491 VDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           +++P ++ VI ++   +   ++H  GRTAR   SG A +++
Sbjct: 587 LNVPEVSLVIIYNAVKTFAQYVHTTGRTARGSRSGTAITLL 627

>Suva_6.218 Chr6 (395411..396601) [1191 bp, 396 aa] {ON} YJL138C
           (REAL)
          Length = 396

 Score =  149 bits (375), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 97/369 (26%), Positives = 174/369 (47%), Gaps = 55/369 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F++  ++++   S K  
Sbjct: 34  LLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSVAALQRIDT-SVK-A 91

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A++L+P+RELA+Q  KV    +   D++     GG S  E     + +  +V+ TPGR
Sbjct: 92  PQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVED-AEGLKDAQIVVGTPGR 150

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
                         ++  + DEAD +   GF+EQ+ ++   LPPT Q +L SAT+P+ ++
Sbjct: 151 VFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVL 210

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
           +     + NPV + +  +    E ++  ++  +  + +   L  L + I +  A      
Sbjct: 211 EVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEDFKYECLTDLYDSISVTQA------ 264

Query: 385 QLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVS 444
                                                         ++F  TR  VE ++
Sbjct: 265 ----------------------------------------------VIFCNTRRKVEELT 278

Query: 445 QLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSL 504
             L+D  + VS IY  L Q  R   +  FRSG + IL+ TD+ ARG+D+  ++ VIN+ L
Sbjct: 279 TKLRDDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDL 338

Query: 505 PSSSKIFIH 513
           PS+ + +IH
Sbjct: 339 PSNKENYIH 347

>ZYRO0F04312g Chr6 complement(366863..368671) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P25808 Saccharomyces
           cerevisiae YFL002C SPB4 involved in the maturation of
           25S ribosomal RNA ATP-dependent RNA helicase
          Length = 602

 Score =  152 bits (385), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 114/399 (28%), Positives = 187/399 (46%), Gaps = 59/399 (14%)

Query: 149 ISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSA------K 202
           I   GF   TP+Q  TIP+  + +D+V  + TGSGKT AF +P++EK+    A      K
Sbjct: 22  IDVMGFDTMTPVQTSTIPMFARNKDVVVESVTGSGKTVAFVIPILEKIIAEEANTPNLKK 81

Query: 203 IGVRAVILSPSRELAMQTYKVFKEF-----SRGSDLRSVLLTGGD--SLEEQFGMMMGN- 254
               ++I++P+REL+ Q   V + F          +RS LL G +  S+ +     + N 
Sbjct: 82  GHFHSLIVTPTRELSNQIQSVIQSFLEHYPDDEHPIRSQLLVGTNQSSVRDDLANFLQNR 141

Query: 255 PDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLL 314
           P +++ TPGR L       +  K+   +V DEADRL ++ F   + ++L  LP  R+T L
Sbjct: 142 PQILVGTPGRVLDFLQMSAVQTKSCSVLVLDEADRLLDLSFFGDIEKILKTLPKQRRTGL 201

Query: 315 FSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIR 374
           FSAT+  +     K GL NPV + + +++K   +L + +      E EA +  LL     
Sbjct: 202 FSATIGSAGSQIFKTGLRNPVKITVSSKTKAPTSLGLFYTVI---EPEAKIQQLLS---- 254

Query: 375 IPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFV 434
             +    + K+                                       P+  +   F 
Sbjct: 255 --IMNNYKFKKCIVY----------------------------------FPTCISVTYFY 278

Query: 435 PTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNF-RSGLTSILVVTDVAARGVDI 493
               +++   +LL +     S ++G L  ++R++ L +F +S   ++L  TDVAARG+DI
Sbjct: 279 SFMQYLQRDKKLLDEEVEFFS-LHGKLQTSSRQKTLDSFGKSFGKAVLFTTDVAARGIDI 337

Query: 494 PMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           P +  VI    PS + +F+HR GRT RA   G A + ++
Sbjct: 338 PDVDLVIQLDPPSDTTMFLHRCGRTGRANKEGRAITFLN 376

>Smik_10.94 Chr10 complement(151257..152444) [1188 bp, 395 aa] {ON}
           YJL138C (REAL)
          Length = 395

 Score =  148 bits (374), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 96/369 (26%), Positives = 174/369 (47%), Gaps = 55/369 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F++  ++++   S K  
Sbjct: 33  LLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDT-SVK-A 90

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A++L+P+RELA+Q  KV    +   D++     GG S  E     + +  +V+ TPGR
Sbjct: 91  PQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVED-AEGLRDAQIVVGTPGR 149

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
                         ++  + DEAD +   GF+EQ+ ++   LPPT Q +L SAT+P+ ++
Sbjct: 150 VFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVL 209

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
           +     + NPV + +  +    E ++  ++  +  + +   L  L + I +  A      
Sbjct: 210 EVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEDYKYECLTDLYDSISVTQA------ 263

Query: 385 QLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVS 444
                                                         ++F  TR  VE ++
Sbjct: 264 ----------------------------------------------VIFCNTRRKVEELT 277

Query: 445 QLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSL 504
             L+D  + VS IY  L Q  R   +  FRSG + IL+ TD+ ARG+D+  ++ VIN+ L
Sbjct: 278 TKLRDDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDL 337

Query: 505 PSSSKIFIH 513
           P++ + +IH
Sbjct: 338 PANKENYIH 346

>Smik_11.321 Chr11 (544869..546056) [1188 bp, 395 aa] {ON} YKR059W
           (REAL)
          Length = 395

 Score =  148 bits (374), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 96/369 (26%), Positives = 174/369 (47%), Gaps = 55/369 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F++  ++++   S K  
Sbjct: 33  LLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDT-SVK-A 90

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A++L+P+RELA+Q  KV    +   D++     GG S  E     + +  +V+ TPGR
Sbjct: 91  PQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVED-AEGLRDAQIVVGTPGR 149

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
                         ++  + DEAD +   GF+EQ+ ++   LPPT Q +L SAT+P+ ++
Sbjct: 150 VFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVL 209

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
           +     + NPV + +  +    E ++  ++  +  + +   L  L + I +  A      
Sbjct: 210 EVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEDYKYECLTDLYDSISVTQA------ 263

Query: 385 QLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVS 444
                                                         ++F  TR  VE ++
Sbjct: 264 ----------------------------------------------VIFCNTRRKVEELT 277

Query: 445 QLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSL 504
             L+D  + VS IY  L Q  R   +  FRSG + IL+ TD+ ARG+D+  ++ VIN+ L
Sbjct: 278 TKLRDDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDL 337

Query: 505 PSSSKIFIH 513
           P++ + +IH
Sbjct: 338 PANKENYIH 346

>SAKL0G09328g Chr7 (797795..799312) [1518 bp, 505 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065C RRP3 Required for maturation of the 35S primary
           transcript of pre-rRNA and is required for cleavages
           leading to mature 18S RNA RRP3 is a DEAD box gene
           homologous to eIF-4a which encodes an RNA-dependent
           ATPase possessing helicase activity which is not
           specific for RNA
          Length = 505

 Score =  150 bits (380), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 127/223 (56%), Gaps = 4/223 (1%)

Query: 153 GFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSP 212
           GF +PTPIQ K IP  L+  DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P
Sbjct: 104 GFSKPTPIQAKAIPPALEGSDIIGLAQTGSGKTAAFAIPILNRL-WHDQQ-PYYACILAP 161

Query: 213 SRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFL-HLKVE 271
           +RELA Q  + F        +R+  + GG ++ +Q   +M  P ++IATPGR + HL+  
Sbjct: 162 TRELAQQIKETFDSLGALMGVRATCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENT 221

Query: 272 MNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAG 330
               L+ + ++V DEADRL +M F   L+ +L  +P   R T LFSAT+   +    +A 
Sbjct: 222 RGFSLRKLRFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSKIDKLQRAS 281

Query: 331 LTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVI 373
           LTNPV   +  + +  + L    +    G +   L+YLL E I
Sbjct: 282 LTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEFI 324

 Score = 99.0 bits (245), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 73/123 (59%)

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
           K  I+F  T+ + E +S L     +  + ++G L+QN R   L  F++G  SILV TDVA
Sbjct: 326 KTVIVFTRTKANAERISTLCNLLEFSATALHGDLNQNQRTGALDLFKAGKRSILVATDVA 385

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXG 547
           ARG+DIP +  V+N+ +P  SK +IHRVGRTARAG SG + S+VS              G
Sbjct: 386 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 445

Query: 548 KKI 550
           KK+
Sbjct: 446 KKL 448

>Smik_8.136 Chr8 complement(202825..204330) [1506 bp, 501 aa] {ON}
           YHR065C (REAL)
          Length = 501

 Score =  150 bits (380), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 84/222 (37%), Positives = 128/222 (57%), Gaps = 4/222 (1%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPS 213
           + +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 101 YSKPTPIQSKSIPPALEGHDIIGLAQTGSGKTAAFAIPILNRL-WHDQE-PYYACILAPT 158

Query: 214 RELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFL-HLKVEM 272
           RELA Q  + F        +RS  + GG ++ +Q   +M  P ++IATPGR + HL+   
Sbjct: 159 RELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 218

Query: 273 NLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAGL 331
              L+ ++++V DEADRL +M F   L+ +L  +P   R T LFSAT+   +    +A L
Sbjct: 219 GFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTTYLFSATMTSKIDKLQRASL 278

Query: 332 TNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVI 373
           TNPV   +  + +  + L    +    G +   L+YLL E I
Sbjct: 279 TNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLLNEFI 320

 Score = 97.8 bits (242), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 73/123 (59%)

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
           K  I+F  T+ + E +S L     +  + ++G L+QN R   L  F++G  SILV TDVA
Sbjct: 322 KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGALDLFKAGKRSILVATDVA 381

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXG 547
           ARG+DIP +  V+N+ +P  SK +IHRVGRTARAG SG + S+VS              G
Sbjct: 382 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 441

Query: 548 KKI 550
           KK+
Sbjct: 442 KKL 444

>SAKL0C06336g Chr3 complement(584406..585599) [1194 bp, 397 aa] {ON}
           highly similar to uniprot|P10081 Saccharomyces
           cerevisiae YKR059W TIF1 translation initiation factor
           eIF4A and highly similar to uniprot|P10081 Saccharomyces
           cerevisiae YJL138C TIF2
          Length = 397

 Score =  148 bits (373), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 95/369 (25%), Positives = 170/369 (46%), Gaps = 54/369 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +   GF  P+ IQ++ I  I +  D++  A++G+GKT  FT+  ++++   + K  
Sbjct: 34  LLRGVYGYGFVDPSAIQQRAILPITEGHDVLAQAQSGTGKTGTFTIAALQRID-ETIK-A 91

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A+IL+P+RELA+Q  KV    +   D+      GG S  E    +     +V+ TPGR
Sbjct: 92  PQALILAPTRELALQIRKVVMALAFHMDINVHACIGGTSFVEDAEALRNGAQIVVGTPGR 151

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
              +          ++  + DEAD +   GF+EQ+ ++   LPPT Q +L SAT+P  ++
Sbjct: 152 VFDMIERRKFRTDHIKMFILDEADEMLSSGFKEQIYKIFTLLPPTTQVVLLSATMPGDVL 211

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
           +     + NP+ + +  +    E ++  ++  +  + + + L  L + I +  A      
Sbjct: 212 EVTTKFMRNPIRILVKKDELTLEGIKQFYINVEEEDYKYDCLSDLYDSISVTQA------ 265

Query: 385 QLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVS 444
                                                         ++F  TR  VE ++
Sbjct: 266 ----------------------------------------------VIFCNTRRKVEELT 279

Query: 445 QLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSL 504
           Q L    + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  ++ VIN+ L
Sbjct: 280 QRLVADNFTVSAIYSDLPQQQRDTIMKEFRTGSSRILISTDLLARGIDVQQVSLVINYDL 339

Query: 505 PSSSKIFIH 513
           P++ + +IH
Sbjct: 340 PTNKENYIH 348

>YFL002C Chr6 complement(145114..146934) [1821 bp, 606 aa] {ON}
           SPB4Putative ATP-dependent RNA helicase, nucleolar
           protein required for synthesis of 60S ribosomal subunits
           at a late step in the pathway; sediments with 66S
           pre-ribosomes in sucrose gradients
          Length = 606

 Score =  152 bits (384), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 121/403 (30%), Positives = 186/403 (46%), Gaps = 76/403 (18%)

Query: 153 GFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSA------KIGVR 206
           GF   TP+Q  TIP++   +D+V  + TGSGKTAAF +P++EK+    A      K    
Sbjct: 26  GFETMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPVLEKVVKEEANTSKFKKAHFH 85

Query: 207 AVILSPSRELAMQTYKVFKEF--SRGSDL---RSVLLTGGDSL---EEQFGMMMGNPDVV 258
           ++I++P+REL+ Q   V   F     SDL   +  LL G +     ++    +   P ++
Sbjct: 86  SLIIAPTRELSRQIESVVLSFLEHYPSDLFPIKCQLLVGTNEATVRDDVSNFLRNRPQIL 145

Query: 259 IATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSAT 318
           I TPGR L       +       VV DEADRL +M F +   ++L  LP  R+T LFSAT
Sbjct: 146 IGTPGRVLDFLQMPAVKTSACSMVVMDEADRLLDMSFIKDTEKILRLLPKQRRTGLFSAT 205

Query: 319 LPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVA 378
           +  +  D  K GL NPV + ++++++   +L++ +                       V 
Sbjct: 206 MRSAGSDIFKTGLRNPVRITVNSKNQAPSSLKLNYCV---------------------VN 244

Query: 379 TAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRH 438
            AE+L+ L ++                                N    +K  + F PT  
Sbjct: 245 PAEKLQLLVSIL-------------------------------NNYKFKKCIVYF-PTCV 272

Query: 439 HVEYVS---QLLKDSGYLVSYI-----YGTLDQNARKQQLFNFRSGLT-SILVVTDVAAR 489
            V Y     Q L     LV+ +     +G L  +AR + L  F   L+ S+L  TDVAAR
Sbjct: 273 SVSYFYSFIQYLGKRNILVNEVEIFSLHGKLQTSARTKTLTAFTDSLSNSVLFTTDVAAR 332

Query: 490 GVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           G+DIP +  VI    P+++ +F+HR GRT RA   G A + ++
Sbjct: 333 GIDIPDVDLVIQLDPPTNTDMFMHRCGRTGRANRVGKAITFLN 375

>CAGL0I04356g Chr9 (389225..390415) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P10081 Saccharomyces cerevisiae
           YKR059w TIF1 or uniprot|P10081 Saccharomyces cerevisiae
           YJL138c TIF2
          Length = 396

 Score =  148 bits (373), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 95/369 (25%), Positives = 172/369 (46%), Gaps = 55/369 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F++  ++++    A   
Sbjct: 34  LLRGVFGYGFNKPSAIQQRAIMPIIEGNDVLAQAQSGTGKTGTFSIAALQRI--DPAIKA 91

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A++L+P+RELA+Q  KV        D++     GG S  E     + +  +V+ TPGR
Sbjct: 92  PQALMLAPTRELALQIQKVVMALGFHMDIKVHACIGGTSFVED-AEGLRDAQIVVGTPGR 150

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
                      +  ++  + DEAD +   GF+EQ+ ++   LPPT Q +L SAT+P  ++
Sbjct: 151 VFDNIQRRKFKVDNIKMFILDEADEMLSTGFKEQIYQIFTMLPPTTQVVLLSATMPRDVL 210

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
           +     + NPV + +  +    E ++  ++  +  + + + L  L + I +  A      
Sbjct: 211 EVTAKFMQNPVRILVKKDELTLEGIKQFYVNVEEEQFKYDCLTDLYDSISVTQA------ 264

Query: 385 QLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVS 444
                                                         ++F  TR  VE ++
Sbjct: 265 ----------------------------------------------VIFCNTRRKVEELT 278

Query: 445 QLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSL 504
           Q L    + VS IY  L Q  R   +  FRSG + IL+ TD+ ARG+D+  ++ VIN+ L
Sbjct: 279 QRLTADNFTVSSIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDL 338

Query: 505 PSSSKIFIH 513
           P++ + +IH
Sbjct: 339 PTNKENYIH 347

>YJL138C Chr10 complement(153504..154691) [1188 bp, 395 aa] {ON}
           TIF2Translation initiation factor eIF4A, identical to
           Tif1p; DEA(D/H)-box RNA helicase that couples ATPase
           activity to RNA binding and unwinding; forms a dumbbell
           structure of two compact domains connected by a linker;
           interacts with eIF4G
          Length = 395

 Score =  147 bits (372), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 96/369 (26%), Positives = 174/369 (47%), Gaps = 55/369 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F++  ++++   S K  
Sbjct: 33  LLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDT-SVK-A 90

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A++L+P+RELA+Q  KV    +   D++     GG S  E     + +  +V+ TPGR
Sbjct: 91  PQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVED-AEGLRDAQIVVGTPGR 149

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
                         ++  + DEAD +   GF+EQ+ ++   LPPT Q +L SAT+P+ ++
Sbjct: 150 VFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVL 209

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
           +     + NPV + +  +    E ++  ++  +  E +   L  L + I +  A      
Sbjct: 210 EVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDLYDSISVTQA------ 263

Query: 385 QLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVS 444
                                                         ++F  TR  VE ++
Sbjct: 264 ----------------------------------------------VIFCNTRRKVEELT 277

Query: 445 QLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSL 504
             L++  + VS IY  L Q  R   +  FRSG + IL+ TD+ ARG+D+  ++ VIN+ L
Sbjct: 278 TKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDL 337

Query: 505 PSSSKIFIH 513
           P++ + +IH
Sbjct: 338 PANKENYIH 346

>YKR059W Chr11 (554987..556174) [1188 bp, 395 aa] {ON}
           TIF1Translation initiation factor eIF4A, identical to
           Tif2p; DEA(D/H)-box RNA helicase that couples ATPase
           activity to RNA binding and unwinding; forms a dumbbell
           structure of two compact domains connected by a linker;
           interacts with eIF4G
          Length = 395

 Score =  147 bits (372), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 96/369 (26%), Positives = 174/369 (47%), Gaps = 55/369 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F++  ++++   S K  
Sbjct: 33  LLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDT-SVK-A 90

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A++L+P+RELA+Q  KV    +   D++     GG S  E     + +  +V+ TPGR
Sbjct: 91  PQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVED-AEGLRDAQIVVGTPGR 149

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
                         ++  + DEAD +   GF+EQ+ ++   LPPT Q +L SAT+P+ ++
Sbjct: 150 VFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVL 209

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
           +     + NPV + +  +    E ++  ++  +  E +   L  L + I +  A      
Sbjct: 210 EVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDLYDSISVTQA------ 263

Query: 385 QLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVS 444
                                                         ++F  TR  VE ++
Sbjct: 264 ----------------------------------------------VIFCNTRRKVEELT 277

Query: 445 QLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSL 504
             L++  + VS IY  L Q  R   +  FRSG + IL+ TD+ ARG+D+  ++ VIN+ L
Sbjct: 278 TKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDL 337

Query: 505 PSSSKIFIH 513
           P++ + +IH
Sbjct: 338 PANKENYIH 346

>NCAS0J00580 Chr10 (87108..88943) [1836 bp, 611 aa] {ON} Anc_8.87
          Length = 611

 Score =  152 bits (383), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 115/403 (28%), Positives = 187/403 (46%), Gaps = 76/403 (18%)

Query: 153 GFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSA------KIGVR 206
           GF Q TP+Q  TIPL  + +D+V  + TGSGKT +F +P++EK+   +A      K    
Sbjct: 26  GFDQMTPVQASTIPLFAKNKDVVVESVTGSGKTVSFVIPILEKVIAENANTKNFKKAHFH 85

Query: 207 AVILSPSRELAMQTYKVFKEF-----SRGSDLRSVLLTGGD--SLEEQFGMMMGN-PDVV 258
            +I+SP+REL+ Q   V  +F          +R+ LL G +  ++ +    ++ N P ++
Sbjct: 86  TLIVSPTRELSKQIKSVIDQFLEHYPEDQYPIRAQLLVGTNESTVRDDVNDLIENRPQIL 145

Query: 259 IATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSAT 318
           + TPGR L       +   +   V+ DEADRL ++ F + +  +L+ LP  R+T LFSAT
Sbjct: 146 VGTPGRILDFLQMPVVKTTSCSMVILDEADRLLDVSFVKDVERILSVLPKQRRTGLFSAT 205

Query: 319 LPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVA 378
           +  +     K GL NPV + +++++    +L++ ++                      V 
Sbjct: 206 ISSAGNTIFKTGLRNPVKITVNSKNHAPSSLKLNYIV---------------------VD 244

Query: 379 TAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRH 438
              + +QL ++                                N    +K  + F PT  
Sbjct: 245 PELKFQQLLSI-------------------------------VNNYRYKKCIVYF-PTCI 272

Query: 439 HVEYVS---QLLKDSGYL-----VSYIYGTLDQNARKQQLFNFRSGL-TSILVVTDVAAR 489
            V Y     Q L+  G +     +  ++G L   +R + L  F   L  S+L+ TDVAAR
Sbjct: 273 SVTYFYSFIQFLQSKGIINENLSIFSLHGKLQTVSRMKTLEKFTETLDNSVLLTTDVAAR 332

Query: 490 GVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           G+DIP +  VI    P+ S IF+HR GRT RA   G A + ++
Sbjct: 333 GIDIPDVDLVIQLDPPTDSDIFLHRCGRTGRANRIGKAITFLN 375

>KNAG0C01220 Chr3 complement(237478..238671) [1194 bp, 397 aa] {ON}
           Anc_1.211 YJL138C
          Length = 397

 Score =  147 bits (372), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 98/370 (26%), Positives = 174/370 (47%), Gaps = 57/370 (15%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F++  ++++    A   
Sbjct: 35  LLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRID--PAIKN 92

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDS-LEEQFGMMMGNPDVVIATPG 263
            +A++L+P+RELA+Q  KV    S   +L+     GG S +E+  G+   +  +V+ TPG
Sbjct: 93  PQALMLAPTRELALQIQKVVMSLSFHMNLKVHACIGGTSFIEDAEGLR--DAQIVVGTPG 150

Query: 264 RFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSL 323
           R              ++  + DEAD +   GF+EQ+ E+   LPPT Q +L SAT+P  +
Sbjct: 151 RVFDNIQRRRFKTDNIKMFILDEADEMLSSGFKEQIYEIFTMLPPTTQVVLLSATMPRDV 210

Query: 324 VDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQL 383
           ++     + +PV + +  +    E ++  ++  +  + +   L  L E I +  A     
Sbjct: 211 LEVTTKFMRSPVRILVKKDELTLEGIKQFYVNVEQEQYKYECLTDLYESIAVTQA----- 265

Query: 384 KQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYV 443
                                                          ++F  TR  VE +
Sbjct: 266 -----------------------------------------------VIFCNTRRKVEEL 278

Query: 444 SQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFS 503
           +Q L    + VS IY  L Q  R   +  FRSG + IL+ TD+ ARG+D+  ++ VIN+ 
Sbjct: 279 TQRLTADNFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYD 338

Query: 504 LPSSSKIFIH 513
           LP++ + +IH
Sbjct: 339 LPTNKENYIH 348

>YHR065C Chr8 complement(227532..229037) [1506 bp, 501 aa] {ON}
           RRP3Protein involved in rRNA processing; required for
           maturation of the 35S primary transcript of pre-rRNA and
           for cleavage leading to mature 18S rRNA; homologous to
           eIF-4a, which is a DEAD box RNA-dependent ATPase with
           helicase activity
          Length = 501

 Score =  150 bits (378), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 84/222 (37%), Positives = 127/222 (57%), Gaps = 4/222 (1%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPS 213
           + +PTPIQ K IP  L+  DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 101 YSKPTPIQSKAIPPALEGHDIIGLAQTGSGKTAAFAIPILNRL-WHDQE-PYYACILAPT 158

Query: 214 RELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFL-HLKVEM 272
           RELA Q  + F        +RS  + GG ++ +Q   +M  P ++IATPGR + HL+   
Sbjct: 159 RELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 218

Query: 273 NLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAGL 331
              L+ ++++V DEADRL +M F   L+ +L  +P   R T LFSAT+   +    +A L
Sbjct: 219 GFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTTYLFSATMTSKIDKLQRASL 278

Query: 332 TNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVI 373
           TNPV   +  + +  + L    +    G +   L+YLL E I
Sbjct: 279 TNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLLNEFI 320

 Score = 98.2 bits (243), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 73/123 (59%)

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
           K  I+F  T+ + E +S L     +  + ++G L+QN R   L  F++G  SILV TDVA
Sbjct: 322 KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGSLDLFKAGKRSILVATDVA 381

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXG 547
           ARG+DIP +  V+N+ +P  SK +IHRVGRTARAG SG + S+VS              G
Sbjct: 382 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 441

Query: 548 KKI 550
           KK+
Sbjct: 442 KKL 444

>Skud_10.76 Chr10 complement(128551..129738) [1188 bp, 395 aa] {ON}
           YJL138C (REAL)
          Length = 395

 Score =  147 bits (371), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 96/369 (26%), Positives = 174/369 (47%), Gaps = 55/369 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F++  ++++   S K  
Sbjct: 33  LLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDT-SVK-A 90

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A++L+P+RELA+Q  KV    +   D++     GG S  E     + +  +V+ TPGR
Sbjct: 91  PQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVED-AEGLRDAQIVVGTPGR 149

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
                         ++  + DEAD +   GF+EQ+ ++   LPPT Q +L SAT+P+ ++
Sbjct: 150 VFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVL 209

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
           +     + NPV + +  +    E ++  ++  +  + +   L  L + I +  A      
Sbjct: 210 EVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEDFKYECLTDLYDSISVTQA------ 263

Query: 385 QLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVS 444
                                                         ++F  TR  VE ++
Sbjct: 264 ----------------------------------------------VIFCNTRRKVEELT 277

Query: 445 QLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSL 504
             L+D  + VS IY  L Q  R   +  FRSG + IL+ TD+ ARG+D+  ++ VIN+ L
Sbjct: 278 TKLRDDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDL 337

Query: 505 PSSSKIFIH 513
           P++ + +IH
Sbjct: 338 PANKENYIH 346

>TDEL0E02890 Chr5 (550708..552213) [1506 bp, 501 aa] {ON} Anc_5.337
           YHR065C
          Length = 501

 Score =  150 bits (378), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 84/222 (37%), Positives = 126/222 (56%), Gaps = 4/222 (1%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPS 213
           F +PTPIQ K IP  L+ +DI+G+A+TGSGKTAAF LP++ +L    +     A ILSP+
Sbjct: 101 FTKPTPIQAKAIPPALEGKDIIGLAQTGSGKTAAFALPILNRLWHDQSP--YYACILSPT 158

Query: 214 RELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFL-HLKVEM 272
           RELA Q  + F         R+  + GG ++ +Q   +M  P ++IATPGR + HL+   
Sbjct: 159 RELAQQIKETFDSLGTIMGARTTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 218

Query: 273 NLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAGL 331
              L+ ++++V DEADRL +M F   L+ +L  +P   R T LFSAT+   +    +A L
Sbjct: 219 GFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSKIDKLQRASL 278

Query: 332 TNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVI 373
           T+PV   +  + +  + L    +    G +   L+YLL E I
Sbjct: 279 TDPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEFI 320

 Score =  101 bits (252), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/123 (44%), Positives = 74/123 (60%)

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
           K TI+F  T+ + E +S L     +  + ++G L+QN R   L  F++G  SILV TDVA
Sbjct: 322 KTTIIFTRTKANAERISGLCNLLEFNATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 381

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXG 547
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG SG + S+VS              G
Sbjct: 382 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 441

Query: 548 KKI 550
           KK+
Sbjct: 442 KKL 444

>Skud_8.122 Chr8 complement(200848..202359) [1512 bp, 503 aa] {ON}
           YHR065C (REAL)
          Length = 503

 Score =  149 bits (377), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 84/222 (37%), Positives = 128/222 (57%), Gaps = 4/222 (1%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPS 213
           + +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 103 YSKPTPIQSKSIPPALKGHDIIGLAQTGSGKTAAFAIPILNRL-WHDQE-PYYACILAPT 160

Query: 214 RELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFL-HLKVEM 272
           RELA Q  + F        +RS  + GG ++ +Q   +M  P ++IATPGR + HL+   
Sbjct: 161 RELAQQIKEAFDSLGSLMGVRSTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 220

Query: 273 NLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAGL 331
              L+ ++++V DEADRL +M F   L+ +L  +P   R T LFSAT+   +    +A L
Sbjct: 221 GFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTTYLFSATMTSKIDKLQRASL 280

Query: 332 TNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVI 373
           TNPV   +  + +  + L    +    G +   L+YLL E I
Sbjct: 281 TNPVKCAVSNKYQTVDTLVQALMVVPGGLKNTYLIYLLNESI 322

 Score = 97.1 bits (240), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 50/105 (47%), Positives = 69/105 (65%)

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
           K  I+F  T+ + E +S L     +  + ++G L+QN R   L  F++G  SILV TDVA
Sbjct: 324 KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGALDLFKAGKRSILVATDVA 383

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           ARG+DIP +  V+N+ +P  SK +IHRVGRTARAG SG + S+VS
Sbjct: 384 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVS 428

>KLTH0F08382g Chr6 (724794..726767) [1974 bp, 657 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194C
           MSS116 DEAD-box protein required for efficient splicing
           of mitochondrial Group I and II introns presumed RNA
           helicase due to DEAD-box motif
          Length = 657

 Score =  152 bits (383), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 121/402 (30%), Positives = 189/402 (47%), Gaps = 71/402 (17%)

Query: 149 ISRKGFRQPTPIQRKTIPLILQT-RDIVGMARTGSGKTAAFTLPMIEKL---KGHSAKIG 204
           +SR  F   TP+Q+KTI  IL+T  D++  A+TG+GKT AF +P+ E L   +  S  + 
Sbjct: 118 VSRMNFESLTPVQQKTIKPILETEHDVIARAKTGTGKTLAFLVPIFEHLIKTRTESPSM- 176

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSD----LRSVLLTGGDSLEEQFGMMMGN-PDVVI 259
           V+ VI++P+R+LA+Q     ++  + +      +S+ L GG + +     M  + P++V+
Sbjct: 177 VKCVIVAPTRDLALQIDSEIEKLHKNNHALRKFKSIALIGGSNFQVAIKRMFKDTPNIVV 236

Query: 260 ATPGRFLHLKVEMNLDL-KTVEYVVFDEADRLFEMGFQEQL-------NELLAALPPTRQ 311
           ATPGR + +  + +    K V++ V DEADRL E+GF E L       N + A  P   +
Sbjct: 237 ATPGRLMDVMSKFSDKFFKHVDFKVLDEADRLLEIGFDEDLRDISKTLNSINATGPEHIR 296

Query: 312 TLLFSATLPHSLVDFAKAGLTNPVLVRLDA----ESKVSENLEMLFLTTKNGEREANLLY 367
           TLLFSATL  ++   A   +     + LD     E +  E ++   + ++N    A+ LY
Sbjct: 297 TLLFSATLGDNVQKLAAGIMNRKESLFLDTVDVNEPEAHEKIDQRLVISENF---ASNLY 353

Query: 368 LLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSE 427
                I+  +AT                                          N  P +
Sbjct: 354 APISAIKNRLAT------------------------------------------NNEPFK 371

Query: 428 KATILFVPTRHHVEYVSQLLKD--SGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTD 485
              ILFVPT    ++   +L+       V   +G +DQ  R + +  F+     I V TD
Sbjct: 372 --AILFVPTVKFTKFYCTILERLFPSLPVYEFHGKIDQRKRTKMVGLFKRAHEGIFVCTD 429

Query: 486 VAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWA 527
           V ARG+D P +  V+   +PS    +IHR+GRTAR G  G A
Sbjct: 430 VGARGMDFPGVEEVLQLGVPSELSNYIHRIGRTARGGKEGKA 471

>Kwal_33.14000 s33 complement(477253..478443) [1191 bp, 396 aa] {ON}
           YKR059W (TIF1) - translation initiation factor eIF4A
           [contig 106] FULL
          Length = 396

 Score =  147 bits (370), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/370 (25%), Positives = 170/370 (45%), Gaps = 56/370 (15%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  I   GF  P+ IQ++ I  I +  D++  A++G+GKT  F++  ++++     KI 
Sbjct: 33  LLRGIYGYGFVDPSAIQQRAILPITEGHDVLAQAQSGTGKTGTFSIAALQQI---DPKIK 89

Query: 205 V-RAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPG 263
             +A++L+P+RELA+Q  KV    +   D++     GG S  E    +     +V+ TPG
Sbjct: 90  APQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEALRDGAQIVVGTPG 149

Query: 264 RFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSL 323
           R   +          ++  + DEAD +   GF+EQ+ ++   LPPT Q +L SAT+P  +
Sbjct: 150 RVFDMIERRRFRTDHIKMFILDEADEMLSSGFKEQIYKIFTLLPPTTQVVLLSATMPQDV 209

Query: 324 VDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQL 383
           ++     + NP+ + +  +    E ++  F+  +  + + + L  L + I +  A     
Sbjct: 210 LEVTTKFMRNPIRILVKKDELTLEGIKQFFINVEEEDYKYDCLSDLYDSISVTQA----- 264

Query: 384 KQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYV 443
                                                          ++F  TR  VE +
Sbjct: 265 -----------------------------------------------VIFCNTRRKVEEL 277

Query: 444 SQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFS 503
           +  L    + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  ++ VIN+ 
Sbjct: 278 TSRLVADNFTVSAIYSDLPQQQRDTIMKEFRTGSSRILISTDLLARGIDVQQVSLVINYD 337

Query: 504 LPSSSKIFIH 513
           LP++ + +IH
Sbjct: 338 LPTNKENYIH 347

>Suva_15.254 Chr15 complement(429201..430712) [1512 bp, 503 aa] {ON}
           YHR065C (REAL)
          Length = 503

 Score =  149 bits (376), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 84/222 (37%), Positives = 127/222 (57%), Gaps = 4/222 (1%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPS 213
           + +PTPIQ K+IP  L   DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 103 YSKPTPIQSKSIPPALAGHDIIGLAQTGSGKTAAFAIPILNRL-WHDQE-PYYACILAPT 160

Query: 214 RELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFL-HLKVEM 272
           RELA Q  + F        +RS  + GG ++ +Q   +M  P ++IATPGR + HL+   
Sbjct: 161 RELAQQIKEAFDSLGSLMGVRSTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 220

Query: 273 NLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAGL 331
              L+ ++++V DEADRL +M F   L+ +L  +P   R T LFSAT+   +    +A L
Sbjct: 221 GFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTTYLFSATMTSKIDKLQRASL 280

Query: 332 TNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVI 373
           TNPV   +  + +  + L    +    G +   L+YLL E I
Sbjct: 281 TNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLLNEFI 322

 Score = 96.3 bits (238), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 73/123 (59%)

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
           K  I+F  T+ + E +S L     +  + ++G L+QN R   L  F++G  +ILV TDVA
Sbjct: 324 KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGALDLFKAGKRAILVATDVA 383

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXG 547
           ARG+DIP +  V+N+ +P  SK +IHRVGRTARAG SG + S+VS              G
Sbjct: 384 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSVSLVSQYDLELILRIEEVLG 443

Query: 548 KKI 550
           KK+
Sbjct: 444 KKL 446

>TDEL0F05260 Chr6 complement(983324..985291) [1968 bp, 655 aa] {ON}
           Anc_8.402 YDR194C
          Length = 655

 Score =  151 bits (382), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 125/404 (30%), Positives = 189/404 (46%), Gaps = 72/404 (17%)

Query: 148 NISRKGFRQPTPIQRKTIPLILQT--RDIVGMARTGSGKTAAFTLPMIEKLKG--HSAKI 203
           +ISR  F   T +Q+KTI  I+Q+  +D++  A+TG+GKT AF +P+ + L      ++ 
Sbjct: 112 SISRMNFTGLTSVQQKTIKPIVQSEEQDVIARAKTGTGKTFAFLIPIFQHLINTRRDSQY 171

Query: 204 GVRAVILSPSRELAMQ----TYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMG-NPDVV 258
            V+ VI++P+R+LA+Q     +K+ +          V L GG +       M    P++V
Sbjct: 172 MVKCVIVAPTRDLALQIETEVHKIHEHNYALKKFGCVSLVGGTNFGSAMRKMSSVRPNIV 231

Query: 259 IATPGRFLH-LKVEMNLDLKTVEYVVFDEADRLFEMGFQEQ-------LNELLAALPPTR 310
           IATPGR +  L    +   K V++ + DEADRL E+GF+E        LNE+    P   
Sbjct: 232 IATPGRLMAVLDQYADRYFKFVDFKILDEADRLLEIGFKEDLESISDTLNEINDKSPDHI 291

Query: 311 QTLLFSATLPHSLVDFAKAGLTNPVLVRLDA----ESKVSENLEMLFLTTKNGEREANLL 366
           +TLLFSATL   +   A   +     V LD     E +  E +E   + +   ER A+ +
Sbjct: 292 RTLLFSATLDDKVQKLASKIMNKDECVFLDTVDKNEPEAHEKIEQSMVIS---ERMAHSI 348

Query: 367 YLLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPS 426
           Y          A  + +KQ                                M S    P+
Sbjct: 349 Y----------AAVDHIKQ-------------------------------KMVSE---PN 364

Query: 427 EKATILFVPTRHHVEYVSQLLK---DSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVV 483
            KA ILF PT     ++S +L+    S   V   +G +DQ  R   +  F+   + +LV 
Sbjct: 365 YKA-ILFTPTVKFTRFLSAILRRELRSKLPVLEFHGQIDQRRRTNLVNQFKRDKSGLLVC 423

Query: 484 TDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWA 527
           TDV ARG+D P +  V+   +PS    +IHR+GRTAR G  G +
Sbjct: 424 TDVGARGMDFPNVTEVLQIGVPSELANYIHRIGRTARGGQEGSS 467

>Skud_11.295 Chr11 (536422..537711) [1290 bp, 429 aa] {ON} YKR059W
           (REAL)
          Length = 429

 Score =  147 bits (371), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 96/369 (26%), Positives = 174/369 (47%), Gaps = 55/369 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F++  ++++   S K  
Sbjct: 67  LLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDT-SVK-A 124

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A++L+P+RELA+Q  KV    +   D++     GG S  E     + +  +V+ TPGR
Sbjct: 125 PQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVED-AEGLRDAQIVVGTPGR 183

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
                         ++  + DEAD +   GF+EQ+ ++   LPPT Q +L SAT+P+ ++
Sbjct: 184 VFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTVLPPTTQVVLLSATMPNDVL 243

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
           +     + NPV + +  +    E ++  ++  +  + +   L  L + I +  A      
Sbjct: 244 EVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEDFKYECLTDLYDSISVTQA------ 297

Query: 385 QLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVS 444
                                                         ++F  TR  VE ++
Sbjct: 298 ----------------------------------------------VIFCNTRRKVEELT 311

Query: 445 QLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSL 504
             L+D  + VS IY  L Q  R   +  FRSG + IL+ TD+ ARG+D+  ++ VIN+ L
Sbjct: 312 TKLRDDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDL 371

Query: 505 PSSSKIFIH 513
           P++ + +IH
Sbjct: 372 PANKENYIH 380

>ZYRO0C04378g Chr3 complement(342717..344762) [2046 bp, 681 aa] {ON}
           similar to uniprot|P15424 Saccharomyces cerevisiae
           YDR194C MSS116 DEAD-box protein required for efficient
           splicing of mitochondrial Group I and II introns
           presumed RNA helicase due to DEAD-box motif
          Length = 681

 Score =  151 bits (382), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 131/406 (32%), Positives = 188/406 (46%), Gaps = 77/406 (18%)

Query: 153 GFRQPTPIQRKTIPLIL--QTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAK--IGVRAV 208
           GF   TP+Q+K I  IL  Q++D++  A+TG+GKT AF +PM + L     +    V+ V
Sbjct: 97  GFTGLTPVQQKAIRPILENQSQDVITRAKTGTGKTFAFLIPMFQHLINTKRENPSAVKYV 156

Query: 209 ILSPSRELAMQ----------TYKVFKEFSRGSDLRSVLLTGGDSLEEQF-GMMMGNPDV 257
           I++P+R+LA+Q           + V K F       S+ L GG +       ++   P V
Sbjct: 157 IVAPTRDLALQIEMETRRIQAAHPVLKRF------HSLTLVGGTNFAASVTDLIRRKPQV 210

Query: 258 VIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAAL-------PPTR 310
           VIATPGR L +        K V+  V DEADRL E+GFQ+ L ++ + L       P   
Sbjct: 211 VIATPGRLLDILQRYEKHFKQVDVKVLDEADRLLEIGFQQDLEKISSILNKINETGPDHI 270

Query: 311 QTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFL-TTKNGEREANLLYLL 369
           +TLLFSATL   + D               ++S + ++ E LFL T    E +A+     
Sbjct: 271 RTLLFSATLDAKVQDL--------------SQSIMGKD-ECLFLDTVDKNEPQAH----- 310

Query: 370 QEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKA 429
            E I      AE L                                     AN  P+ KA
Sbjct: 311 -EKISQSAVIAENLGH---------------------SILATMDHVKRQVLAN--PNYKA 346

Query: 430 TILFVPTRHHVEYVSQLL---KDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDV 486
            ILF PT      +S+LL   +D    +   +G   QN R + +  F+   + ILV TDV
Sbjct: 347 -ILFTPTIKCTTLISELLHAQQDVAVPILEFHGKKTQNVRTKMVQKFKRDRSGILVCTDV 405

Query: 487 AARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           AARG+D P +  V+   +P+    +IHR+GRTARAG +G A   +S
Sbjct: 406 AARGLDFPDVGEVLQIGVPAIMSQYIHRIGRTARAGKTGKAVLFMS 451

>Kwal_27.11734 s27 complement(923899..925614) [1716 bp, 571 aa] {ON}
           YDR243C (PRP28) - RNA helicase [contig 27] FULL
          Length = 571

 Score =  149 bits (377), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 121/406 (29%), Positives = 190/406 (46%), Gaps = 90/406 (22%)

Query: 150 SRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLK-----GHSAKI- 203
           S+  +R+PTPIQR TIP +L+ RD VG+A TGSGKT AF LP + +L          K+ 
Sbjct: 185 SKLKYREPTPIQRITIPNVLRGRDFVGIAATGSGKTLAFLLPSLCQLSKLPPLNDITKLD 244

Query: 204 GVRAVILSPSRELAMQ----TYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVI 259
           G   +IL+P+RELA Q      KV   +SR + + S++  GG S+EE    +    D+++
Sbjct: 245 GPFTLILAPTRELAQQIEAEAKKVVNLWSRPTKVTSIV--GGHSIEEISYSLSDGCDILV 302

Query: 260 ATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATL 319
           ATPGR +       L LK V  +V DEADR                              
Sbjct: 303 ATPGRLIDCLENRMLVLKQVRILVLDEADR------------------------------ 332

Query: 320 PHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNG--EREANLLYLLQEVIRIPV 377
              ++DF        +L R ++   VS    M+F  T +   E+ AN        +R+  
Sbjct: 333 ---MIDFGFEDQLTTILARTES---VSGRQTMMFTATMSNTVEKIANGYLTKPAYVRVGS 386

Query: 378 A-TAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANE---------LPSE 427
             T  Q+KQ+                               +PS  +         LP  
Sbjct: 387 DDTKAQIKQI----------------------------VEYLPSEEQRFQKMARDILPKF 418

Query: 428 KATIL-FVPTRHHVEY-VSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTD 485
           +A I+ F+  +   ++ VS+   ++ + V+ ++G+  Q  R+  L   R+G   I++ TD
Sbjct: 419 RAPIMIFINYKKTADWLVSKFSSETRFKVTTLHGSKSQEQREHSLNMLRTGKVDIMIATD 478

Query: 486 VAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           VA RG+DIP ++ V+NF + ++ + ++HR+GRT RAG SG A + +
Sbjct: 479 VAGRGIDIPDVSLVVNFQMCTAFESYVHRIGRTGRAGRSGCALTFL 524

>CAGL0J10912g Chr10 (1063600..1065081) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065c RRP3
          Length = 493

 Score =  148 bits (373), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 82/222 (36%), Positives = 125/222 (56%), Gaps = 4/222 (1%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPS 213
           F +PTPIQ + IP  L   D++G+A+TGSGKTAAF +P++ KL     +    A +L+P+
Sbjct: 93  FTKPTPIQARAIPPALAGSDVIGLAQTGSGKTAAFAIPILNKL--WEDQQPYYACVLAPT 150

Query: 214 RELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFL-HLKVEM 272
           RELA Q  + F        +R+  + GG ++ +Q   +M  P ++IATPGR + HL+   
Sbjct: 151 RELAQQIKETFDSLGSLMGVRTTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 210

Query: 273 NLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAGL 331
              LK ++++V DEADRL +M F   L+ +L  +P   R T LFSAT+   +    +A L
Sbjct: 211 GFSLKNLKFLVMDEADRLLDMEFGPVLDRILKIIPTKGRTTYLFSATMTSKIDKLQRASL 270

Query: 332 TNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVI 373
           TNPV   +  + +  + L    +    G +   L+YLL E I
Sbjct: 271 TNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEFI 312

 Score = 98.6 bits (244), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 73/123 (59%)

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
           K  I+F  T+ + E +S L     +  + ++G L+QN R   L  F++G  SILV TDVA
Sbjct: 314 KTVIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRTGALDLFKAGKRSILVATDVA 373

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXG 547
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG SG + S+VS              G
Sbjct: 374 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 433

Query: 548 KKI 550
           KK+
Sbjct: 434 KKL 436

>TBLA0C03500 Chr3 complement(835236..836756) [1521 bp, 506 aa] {ON}
           Anc_5.337 YHR065C
          Length = 506

 Score =  148 bits (373), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 128/222 (57%), Gaps = 4/222 (1%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPS 213
           + +PTPIQ + IP  L+ +DI+G+A+TGSGKTAAF +P++ KL     +    A I++P+
Sbjct: 106 YEKPTPIQSRAIPPALEGKDIIGLAQTGSGKTAAFAIPILNKL--WEDQQPYYACIMAPT 163

Query: 214 RELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFL-HLKVEM 272
           RELA Q  + F        +RSV + GG ++ +Q   +M  P ++IATPGR + HL+   
Sbjct: 164 RELAQQIKEQFDSLGALMGVRSVCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTR 223

Query: 273 NLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAGL 331
              L+ ++++V DEADRL ++ F   L+ +L  LP   R T LFSAT+   +    +A L
Sbjct: 224 GFSLRKLKFLVMDEADRLLDLEFGPVLDRILKILPTQGRTTYLFSATMTSKIDKLQRASL 283

Query: 332 TNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVI 373
           TNPV   +  + +  + L    +    G +   L+YL+ E +
Sbjct: 284 TNPVKCAVSNKYQTVDTLIQTLMVVPGGLKNTYLIYLINEFV 325

 Score = 96.7 bits (239), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 73/123 (59%)

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
           K+ I+F  T+ + E +S L     +    ++G L+QN R   L  F++G  SIL+ TDVA
Sbjct: 327 KSIIIFTRTKANAERLSLLSNTLEFDAIALHGDLNQNQRTGALDLFKAGKKSILIATDVA 386

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXG 547
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG SG + S+VS              G
Sbjct: 387 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 446

Query: 548 KKI 550
           KK+
Sbjct: 447 KKL 449

>TBLA0D05750 Chr4 (1420975..1422180) [1206 bp, 401 aa] {ON}
           Anc_1.211 YJL138C
          Length = 401

 Score =  145 bits (367), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 94/370 (25%), Positives = 179/370 (48%), Gaps = 57/370 (15%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F++  ++++        
Sbjct: 34  LLRGVFAYGFEEPSAIQQRAILPIVEGNDVLAQAQSGTGKTGTFSIAALQRINPEIK--A 91

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDS-LEEQFGMMMGNPDVVIATPG 263
            +A+IL+P+RELA+Q  KV    +   D++     GG S +E+  G+   +  +V+ TPG
Sbjct: 92  PQALILAPTRELALQIQKVVISLALYLDIKVHACIGGTSFVEDTEGLR--DAQIVVGTPG 149

Query: 264 RFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSL 323
           R         L    ++  + DEAD +   GF+EQ+ ++   +PPT Q +L SAT+P  +
Sbjct: 150 RVFDNIQRHRLRTDKIKMFISDEADEMLSSGFKEQIYQIFTMMPPTTQVVLLSATMPRDV 209

Query: 324 VDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQL 383
           ++     + +PV + +  +    E ++  ++  +  + + ++L  L + I +  A     
Sbjct: 210 LEVTTKFMRDPVRILVKKDELTLEGIKQFYINVEEEDYKYDVLTDLYDSISVTQA----- 264

Query: 384 KQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYV 443
                                                          ++F  TR  VE +
Sbjct: 265 -----------------------------------------------VIFCNTRRKVEEL 277

Query: 444 SQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFS 503
           ++ L ++ + VS IY  L Q  R+  +  FRSG + IL+ TD+ ARG+D+  ++ VIN+ 
Sbjct: 278 TKKLTEADFTVSAIYSDLPQQERETIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYD 337

Query: 504 LPSSSKIFIH 513
           LP++ + +IH
Sbjct: 338 LPTNKENYIH 347

>NCAS0B08130 Chr2 (1551641..1552831) [1191 bp, 396 aa] {ON}
           Anc_1.211
          Length = 396

 Score =  145 bits (366), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 94/369 (25%), Positives = 172/369 (46%), Gaps = 55/369 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +   GF  P+ IQ++ I  I++  D++  A++G+GKT  F++  ++++   ++   
Sbjct: 34  LLRGVFGYGFEDPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRID--TSIKA 91

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A++L+P+RELA+Q  KV    +   D++     GG S  E     + +  +V+ TPGR
Sbjct: 92  PQALMLAPTRELALQIQKVVMALAFHMDVKVHACIGGTSFVED-AEGLRDAQIVVGTPGR 150

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
                        +++  + DEAD +   GF+EQ+ ++   LPPT Q +L SAT+P  ++
Sbjct: 151 VFDNIQRRRFRTDSIKMFILDEADEMLSSGFKEQIYQIFTMLPPTTQVVLLSATMPRDVL 210

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
           +     + NPV + +  +    E ++  ++  +  + +   L  L + I +  A      
Sbjct: 211 EVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEQFKYECLTDLYDSISVTQA------ 264

Query: 385 QLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVS 444
                                                         ++F  TR  VE ++
Sbjct: 265 ----------------------------------------------VIFCNTRRKVEELT 278

Query: 445 QLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSL 504
           Q L    + VS IY  L Q  R   +  FRSG + IL+ TD+ ARG+D+  ++ VIN+ L
Sbjct: 279 QKLTADDFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDL 338

Query: 505 PSSSKIFIH 513
           P++ + +IH
Sbjct: 339 PTNKENYIH 347

>Kwal_33.14325 s33 (619599..621101) [1503 bp, 500 aa] {ON} YHR065C
           (RRP3) - RRP3 is a DEAD box gene homologous to eIF-4a
           which encodes an RNA-dependent ATPase possessing
           helicase activity which is not specific for RNA [contig
           104] FULL
          Length = 500

 Score =  147 bits (372), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 80/222 (36%), Positives = 128/222 (57%), Gaps = 4/222 (1%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPS 213
           + +PTPIQ + IP  L+ +DI+G+A+TGSGKTAAF +P++ +L  H  +    A +L+P+
Sbjct: 99  YSKPTPIQAEAIPPALEGKDIIGLAQTGSGKTAAFAIPILNQL-WHDQQ-PYYACVLAPT 156

Query: 214 RELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFL-HLKVEM 272
           RELA Q  + F        +R+  + GG ++ +Q   +M  P ++IATPGR + HL+   
Sbjct: 157 RELAQQIKETFDSLGGAMGVRTTCIVGGMNMIDQARDLMRKPHIIIATPGRLMDHLENTK 216

Query: 273 NLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAGL 331
              ++ ++Y+V DEADRL +M F   L+ +L  +P   R T LFSAT+   +    +A L
Sbjct: 217 GFSMRKLKYLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSKIDKLQRASL 276

Query: 332 TNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVI 373
           TNPV   +  + +  + L    +    G +   L+YLL E +
Sbjct: 277 TNPVKCAVSTKYQTVDTLIQTLMVVPGGLKNTFLIYLLNEFL 318

 Score = 99.4 bits (246), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 51/105 (48%), Positives = 69/105 (65%)

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
           K  I+F  T+ + E +S L     +  + ++G L+QN R   L  F++G  SILV TDVA
Sbjct: 320 KTVIIFTRTKANAERISTLCNLLEFSSTALHGDLNQNQRTGALDLFKAGRRSILVATDVA 379

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG SG + S+VS
Sbjct: 380 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVS 424

>NDAI0B05440 Chr2 (1333810..1335000) [1191 bp, 396 aa] {ON}
           Anc_1.211
          Length = 396

 Score =  145 bits (366), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 94/369 (25%), Positives = 171/369 (46%), Gaps = 55/369 (14%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  +   GF  P+ IQ++ I  I++  D++  A++G+GKT  F++  ++++   ++   
Sbjct: 34  LLRGVFGYGFEDPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRID--TSIKA 91

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A++L+P+RELA+Q  KV    +   D++     GG S  E     + +  +V+ TPGR
Sbjct: 92  PQALMLAPTRELALQIQKVVMALAFHMDVKVHACIGGTSFVED-AEGLRDAQIVVGTPGR 150

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
                         ++  + DEAD +   GF+EQ+ ++   LPPT Q +L SAT+P  ++
Sbjct: 151 VFDNIQRGRFRTDAIKMFILDEADEMLSSGFKEQIYQIFTMLPPTTQVVLLSATMPRDVL 210

Query: 325 DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384
           +     + NP+ + +  +    E ++  ++  +  E +   L  L + I +  A      
Sbjct: 211 EVTTKFMRNPIRILVKKDELTLEGIKQFYVNVEEEEFKYECLTDLYDSISVTQA------ 264

Query: 385 QLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVS 444
                                                         ++F  TR  VE ++
Sbjct: 265 ----------------------------------------------VIFCNTRRKVEELT 278

Query: 445 QLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSL 504
           Q L    + VS IY  L Q  R   +  FRSG + IL+ TD+ ARG+D+  ++ VIN+ L
Sbjct: 279 QKLTADNFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDL 338

Query: 505 PSSSKIFIH 513
           P++ + +IH
Sbjct: 339 PTNKENYIH 347

>Suva_6.59 Chr6 complement(110278..112098) [1821 bp, 606 aa] {ON}
           YFL002C (REAL)
          Length = 606

 Score =  149 bits (376), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 118/403 (29%), Positives = 182/403 (45%), Gaps = 76/403 (18%)

Query: 153 GFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSA------KIGVR 206
           GF   TP+Q  TIP++   +D+V  + TGSGKTAAF +P++EK+    A      K    
Sbjct: 26  GFESMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPILEKIVQEEANSPKFKKAHFH 85

Query: 207 AVILSPSRELAMQTYKVFKEF-----SRGSDLRSVLLTGGD--SLEEQFGMMMGN-PDVV 258
           ++I++P+REL+ Q   V   F     S    ++  LL G +  ++ +     + N P ++
Sbjct: 86  SLIIAPTRELSRQIESVVLSFLEHYPSDSFSIKCQLLIGTNEATVRDDVSSFLQNRPQIL 145

Query: 259 IATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSAT 318
           I TPGR L       +       V+ DEADRL ++ F +   ++L  LP  R+T LFSAT
Sbjct: 146 IGTPGRVLDFLQMPAVKSSACSMVILDEADRLLDVSFIKDTEKILRLLPKQRRTGLFSAT 205

Query: 319 LPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVA 378
           +  +  D  K GL NPV + ++++ +   +L++ +          N L  LQ ++ I   
Sbjct: 206 MRSAGSDIFKTGLRNPVRITVNSKHQAPSSLKLNYCV-------VNPLEKLQLLVSI--- 255

Query: 379 TAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRH 438
                                                      N    +K  + F PT  
Sbjct: 256 ------------------------------------------LNNYKFKKCIVYF-PTCV 272

Query: 439 HVEYVS---QLLKDSGYLVS-----YIYGTLDQNARKQQLFNFRSGL-TSILVVTDVAAR 489
            V Y     Q L     L S      ++G L  +AR + L  F   L  ++L  TDVAAR
Sbjct: 273 SVSYFYSFVQYLSKKNILTSELEVFSLHGKLQTSARMKTLAAFTDSLNNAVLFTTDVAAR 332

Query: 490 GVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           G+DIP +  VI    P++S +F+HR GRT RA   G A + ++
Sbjct: 333 GIDIPEVDLVIQLDPPTNSDMFMHRCGRTGRANRVGKAITFLN 375

>TPHA0N00940 Chr14 (202770..205085) [2316 bp, 771 aa] {ON} Anc_5.241
           YJL033W
          Length = 771

 Score =  150 bits (380), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 80/191 (41%), Positives = 122/191 (63%), Gaps = 4/191 (2%)

Query: 146 LNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL--KGHSAKI 203
           +  ++   F + T IQR +IP+ L+  DI+G A+TGSGKT AF +P++EKL  +  S   
Sbjct: 53  VKGLNEASFVKVTEIQRDSIPISLKGHDILGAAKTGSGKTLAFLIPVLEKLYREKWSEFD 112

Query: 204 GVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPG 263
           G+ A+I+SP+RELAMQTY+V  +    +   + L+ GG  ++ +    +   +++I TPG
Sbjct: 113 GLGALIISPTRELAMQTYEVLTKIGTHTSFSAGLVIGGKDVKFE-SARISKINILIGTPG 171

Query: 264 RFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHS 322
           R L H+   + L    ++ +V DEADR  +MGFQ+ L+ +++ LPPTRQTLLFSAT   S
Sbjct: 172 RILQHMDQAVGLSTSNLQMLVLDEADRCLDMGFQKTLDAIVSNLPPTRQTLLFSATQSQS 231

Query: 323 LVDFAKAGLTN 333
           L D A+  LT+
Sbjct: 232 LTDLARLSLTD 242

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 48/97 (49%), Gaps = 2/97 (2%)

Query: 431 ILFVPTRHHVEYVSQLLK--DSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAA 488
           I+F+ +   V +V +  +    G  + +++G   Q AR + L  F       L  TDV A
Sbjct: 295 IVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFSRAQQVCLFATDVVA 354

Query: 489 RGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSG 525
           RG+D P +  V+    P     +IHRVGR+AR G  G
Sbjct: 355 RGIDFPSVDWVVQLDCPEDVDTYIHRVGRSARYGKQG 391

>Kwal_23.3235 s23 (209691..211721) [2031 bp, 676 aa] {ON} YDR194C
           (MSS116) - Mitochondrial DEAD box RNA helicase [contig
           250] FULL
          Length = 676

 Score =  150 bits (378), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 121/401 (30%), Positives = 184/401 (45%), Gaps = 69/401 (17%)

Query: 149 ISRKGFRQPTPIQRKTIPLILQT-RDIVGMARTGSGKTAAFTLPMIEKLKGHSAK--IGV 205
           +SR  F   TP+Q+KT+  IL T  D++  A+TG+GKT AF +P+ E L     +    V
Sbjct: 119 VSRMNFESLTPVQQKTMKPILATEHDVIARAKTGTGKTLAFLVPIFEHLIKTRVESPYMV 178

Query: 206 RAVILSPSRELAMQ----TYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGN-PDVVIA 260
           + VI++P+R+LA+Q      K+ K        +S+ L GG + +     M    P++V+A
Sbjct: 179 KCVIVAPTRDLALQIDSEVAKLHKNNYALKKFKSIALIGGSNFQAAIKRMFKERPNIVVA 238

Query: 261 TPGRFLHLKVEMNLD-LKTVEYVVFDEADRLFEMGFQEQLNELL-------AALPPTRQT 312
           TPGR + +  + + +  K V++ V DEADRL E+GF E L E+        AA P   +T
Sbjct: 239 TPGRLMDVMSKFSHEFFKHVDFKVLDEADRLLEIGFDEDLREISKNLSSINAAGPEHIRT 298

Query: 313 LLFSATLPHSLVDFAKAGLTNPVLVRLDA----ESKVSENLEMLFLTTKNGEREANLLYL 368
           LLFSATL  ++   A   +     + LD     E +  E +E   + +   +  A+ +Y 
Sbjct: 299 LLFSATLGDNVQKLASGIMDRKQCLFLDTVDKNEPEAHERIEQSLVIS---DTFAHNMYA 355

Query: 369 LQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEK 428
               I+  +  AE  K  +A                                        
Sbjct: 356 PISAIKDRI--AENDKPFKA---------------------------------------- 373

Query: 429 ATILFVPTRHHVEYVSQLLKD--SGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDV 486
             ILFVPT    ++   +L+       V   +G +DQ  R + +  F+     I V TDV
Sbjct: 374 --ILFVPTVKFTKFYCSVLERLFPSLPVYEFHGKIDQRKRTKMVQLFKRAHEGIFVCTDV 431

Query: 487 AARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWA 527
            ARG+D P +  V    +PS    +IHR+GRTAR G  G A
Sbjct: 432 GARGMDFPDVEEVYQLGVPSELSNYIHRIGRTARGGKDGKA 472

>KAFR0B06170 Chr2 complement(1271195..1273066) [1872 bp, 623 aa]
           {ON} Anc_8.402 YDR194C
          Length = 623

 Score =  149 bits (376), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 121/408 (29%), Positives = 191/408 (46%), Gaps = 65/408 (15%)

Query: 149 ISRKGFRQPTPIQRKTI-PLILQT-RDIVGMARTGSGKTAAFTLPMIEKLKGH--SAKIG 204
           I R GF   TP+Q+KTI P I+    DI+  A+TG+GKT AF +P+ + L      ++  
Sbjct: 92  IDRMGFPNLTPVQQKTIKPTIMNNENDIIARAKTGTGKTFAFLIPIFQHLINTKLDSQYM 151

Query: 205 VRAVILSPSRELAMQ----TYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMG-NPDVVI 259
           V+++I++P+R+LA+Q      K++K        + V L GG +L E    M    P+++I
Sbjct: 152 VKSIIITPTRDLALQIEDEAKKLYKNNYGLKKFQCVSLIGGTNLNESIRRMKKLRPNIII 211

Query: 260 ATPGRFLH-LKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQ------- 311
           ATPGR +  L    N   + V++ V DEADRL E+GF+E L E+   L    +       
Sbjct: 212 ATPGRLIDVLNRYGNEFFRFVDFKVLDEADRLLEIGFKEDLREISNILNEISERDENHIR 271

Query: 312 TLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFL-TTKNGEREANLLYLLQ 370
           T+LFSATL  ++       L+N ++             + LF+ T    E EA+      
Sbjct: 272 TMLFSATLDENV-----QNLSNDIM----------NKEKCLFIDTIDKNEPEAH------ 310

Query: 371 EVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKAT 430
                     E++ Q   L                            +   +E+      
Sbjct: 311 ----------EKIDQSMVL----------SDHFAHNIYAAANHIQSRLSQDSEMKDNYKA 350

Query: 431 ILFVPTRHHVEYVSQLLKD---SGYL---VSYIYGTLDQNARKQQLFNFRSGLTSILVVT 484
           ILF PT    ++++ +L D   S Y    +   +G +DQ  R + +  F+   + IL+ T
Sbjct: 351 ILFTPTVKFTKFITGVLYDKLHSKYRDLPIIEFHGQIDQKKRTRLVEQFKRLKSGILICT 410

Query: 485 DVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           DV ARG+D P +  V+   +PS    +IHR+GRTAR+G  G +   +S
Sbjct: 411 DVGARGMDFPDVKEVLQIGVPSELSNYIHRIGRTARSGKDGISTLFIS 458

>KNAG0A04660 Chr1 (663566..665707) [2142 bp, 713 aa] {ON} Anc_8.402
           YDR194C
          Length = 713

 Score =  150 bits (378), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 121/402 (30%), Positives = 190/402 (47%), Gaps = 71/402 (17%)

Query: 148 NISRKGFRQPTPIQRKTIPLILQTR--DIVGMARTGSGKTAAFTLPMIEKLKG--HSAKI 203
           +ISR GF + T +Q+KTI  IL+ +  D++  A+TG+GKT AF +P+ + L      ++ 
Sbjct: 146 SISRMGFPELTSVQQKTIKPILEDKENDVIARAKTGTGKTFAFLIPIFQHLINTQFDSQY 205

Query: 204 GVRAVILSPSRELAMQTYKVFKEFSRGS----DLRSVLLTGGDSLEEQFGMMMG-NPDVV 258
            V++VI++P+R+LA+Q     ++    +      + + L GG         M    P++V
Sbjct: 206 MVKSVIVAPTRDLALQIEAEVRKIHDNNYGLKKFQCISLVGGTDFRRAMDKMHKLRPNIV 265

Query: 259 IATPGRFLHLKVEMNLDL-KTVEYVVFDEADRLFEMGFQ---EQLNELLAALPPTRQ--- 311
           IATPGR + +  +        V++ V DEADRL E+GF+   EQ++E+L +L    +   
Sbjct: 266 IATPGRLIDVMEKFGKKFFGWVDFKVLDEADRLLEIGFKEDLEQISEMLNSLNGHSKDHI 325

Query: 312 -TLLFSATLPHSLVDFAKAGLTNPVLVRLDA----ESKVSENLEMLFLTTKNGEREANLL 366
            TLLFSATL   +   A   +  P  + +D     E +  E +E   + TK  E   N+ 
Sbjct: 326 RTLLFSATLDEKVQGLANQIMNKPKCLFIDTVDKNEPETHEKIEQSLVVTK--EFGHNIY 383

Query: 367 YLLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPS 426
             ++ +       AE L                                       E P 
Sbjct: 384 AAIEHI------KAELL---------------------------------------EDPK 398

Query: 427 EKATILFVPTRHHVEYVSQLLKDS--GYL-VSYIYGTLDQNARKQQLFNFRSGLTSILVV 483
               ILF PT    +++S++L     G L V   +G + Q+ R   +  F+     +LV 
Sbjct: 399 NYKAILFTPTVKFTKFISRILDRELRGKLRVLEFHGQISQSRRTNLVKEFKQDRPGLLVC 458

Query: 484 TDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSG 525
           TDV ARG+D P +  V+   LPS    +IHR+GRTAR+G SG
Sbjct: 459 TDVGARGMDFPNIKEVLQIGLPSELANYIHRIGRTARSGKSG 500

>SAKL0G11748g Chr7 complement(998525..1000816) [2292 bp, 763 aa]
           {ON} highly similar to uniprot|P20448 Saccharomyces
           cerevisiae YJL033W HCA4 Putative nucleolar DEAD box RNA
           helicase high-copy number suppression of a U14 snoRNA
           processing mutant suggests an involvement in 18S rRNA
           synthesis
          Length = 763

 Score =  150 bits (379), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 80/191 (41%), Positives = 122/191 (63%), Gaps = 4/191 (2%)

Query: 146 LNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL--KGHSAKI 203
           L  +    F + T IQ+ +IP+ L+  D++G A+TGSGKT AF +P+IEKL  +  +   
Sbjct: 53  LKGLKESAFIKMTEIQKNSIPVSLKGHDLLGAAKTGSGKTLAFLIPVIEKLYREKWTEHD 112

Query: 204 GVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPG 263
           G+ A+I+SP+RELAMQTY+V  +  R +   + L+ GG  ++ +   +    +V+I TPG
Sbjct: 113 GLGALIISPTRELAMQTYEVLVKIGRHTSFSAGLVIGGKDVKFELERI-SKINVLIGTPG 171

Query: 264 RFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHS 322
           R L H+   + L+   ++ +V DEADR  +MGF+  L+ +++ LPPTRQTLLFSAT   S
Sbjct: 172 RILQHMDQAIGLNTSGLQMLVLDEADRCLDMGFKRTLDAIVSNLPPTRQTLLFSATQSQS 231

Query: 323 LVDFAKAGLTN 333
           L D A+  LT+
Sbjct: 232 LADLARLSLTD 242

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 47/97 (48%), Gaps = 2/97 (2%)

Query: 431 ILFVPTRHHVEYVSQLLK--DSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAA 488
           I+F+ +   V +V +  +    G  + +++G   Q AR + L  F       L  TDV A
Sbjct: 293 IVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQQVCLFATDVVA 352

Query: 489 RGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSG 525
           RG+D P +  V+    P     +IHR GR+AR G  G
Sbjct: 353 RGIDFPAVDWVVQVDCPEDVDTYIHRAGRSARYGKQG 389

>AAL041C Chr1 complement(270739..272202) [1464 bp, 487 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR065C
           (RRP3)
          Length = 487

 Score =  146 bits (368), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 127/223 (56%), Gaps = 5/223 (2%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPS 213
           F +PTPIQ K IP  LQ +DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 86  FTKPTPIQSKAIPPALQGKDIIGLAQTGSGKTAAFAIPILNRL-WHDQQ-PYYACILAPT 143

Query: 214 RELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFL-HLKV-E 271
           RELA Q  + F        +R+  + GG ++ +Q   +M  P ++IATPGR + HL+V +
Sbjct: 144 RELAQQIKETFDSLGSLMGVRTTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLEVHK 203

Query: 272 MNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPP-TRQTLLFSATLPHSLVDFAKAG 330
               L+  +++V DEADRL  M F   L+ +L  +P   R T LFSAT+   +    +A 
Sbjct: 204 RGFALRKQQFLVMDEADRLLNMKFGPVLDRILKNIPTKVRTTYLFSATMTSKIDKLQRAS 263

Query: 331 LTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVI 373
           LTN V   +  + +  + L    +    G +   L+YLL E I
Sbjct: 264 LTNTVKCAVSNKYQTVDTLVQTLIVVPGGLKNTFLIYLLNEFI 306

 Score =  101 bits (252), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/123 (44%), Positives = 74/123 (60%)

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
           K TI+F  T+ + E +S L     +  + ++G L+QN R   L  F++G  SILV TDVA
Sbjct: 308 KTTIVFTRTKANAERISGLCNLLEFSATALHGDLNQNQRTGALDLFKAGKKSILVATDVA 367

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXG 547
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG SG + S+VS              G
Sbjct: 368 ARGLDIPSVDLVINYDIPVDSKSYIHRVGRTARAGRSGKSVSLVSQYDLELILRIEEVLG 427

Query: 548 KKI 550
           KK+
Sbjct: 428 KKL 430

>KLTH0F07106g Chr6 (618637..620214) [1578 bp, 525 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065C RRP3 Required for maturation of the 35S primary
           transcript of pre-rRNA and is required for cleavages
           leading to mature 18S RNA RRP3 is a DEAD box gene
           homologous to eIF-4a which encodes an RNA-dependent
           ATPase possessing helicase activity which is not
           specific for RNA
          Length = 525

 Score =  146 bits (368), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 79/222 (35%), Positives = 128/222 (57%), Gaps = 4/222 (1%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPS 213
           + +PTPIQ + IP  L+ +DI+G+A+TGSGKTAAF +P++ +L  H  +    A +L+P+
Sbjct: 125 YSKPTPIQAEAIPPALEGKDIIGLAQTGSGKTAAFAIPILNQL-WHDQQ-PYYACVLAPT 182

Query: 214 RELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFL-HLKVEM 272
           RELA Q  + F        +R+  + GG ++ +Q   +M  P ++IATPGR + HL+   
Sbjct: 183 RELAQQIKETFDSLGGAMGVRTTCIVGGMNMIDQARDLMRKPHIIIATPGRLMDHLENTK 242

Query: 273 NLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAGL 331
              ++ ++++V DEADRL +M F   L+ +L  +P   R T LFSAT+   +    +A L
Sbjct: 243 GFSMRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSKIDKLQRASL 302

Query: 332 TNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVI 373
           TNPV   +  + +  + L    +    G +   L+YLL E +
Sbjct: 303 TNPVKCAVSTKYQTVDTLIQTLMVVPGGLKNTFLIYLLNEFL 344

 Score = 99.4 bits (246), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 50/105 (47%), Positives = 69/105 (65%)

Query: 428 KATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
           K  I+F  T+ + E ++ L     +  + ++G L+QN R   L  F++G  SILV TDVA
Sbjct: 346 KTAIVFTRTKANAERIATLCNLLEFSATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 405

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           ARG+DIP +  VIN+ +P  SK +IHRVGRTARAG SG + S+VS
Sbjct: 406 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVS 450

>KNAG0A05850 Chr1 (873957..875306) [1350 bp, 449 aa] {ON} Anc_2.384
           YDL084W
          Length = 449

 Score =  144 bits (362), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 105/386 (27%), Positives = 180/386 (46%), Gaps = 61/386 (15%)

Query: 153 GFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSP 212
           GF  P+ +Q+ TIP  +   D++  A++G GKTA F L  +++L     ++ V  V++  
Sbjct: 84  GFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPIPGEVSV--VVICN 141

Query: 213 SRELAMQTYKVFKEFSR-GSDLRSVLLTGGDSLEEQFGMMMG---NPDVVIATPGRFLHL 268
           +RELA Q    +  FS+   D+++ +  GG  + +   ++     +P +V+ATPGR   L
Sbjct: 142 ARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPINKDAELLKNKETSPHIVVATPGRLKAL 201

Query: 269 KVEMNLDLKTVEYVVFDEADRLF-EMGFQEQLNELLAALPPTRQTLLFSATLPHSLVDFA 327
             +  +DL  V+  V DE D++  E+  +  + ++  A P  +Q ++FSATL   +    
Sbjct: 202 VRDKMIDLSHVKNFVIDECDKVLEELDMRRDVQDIFRATPRDKQVMMFSATLSQEIRPIC 261

Query: 328 KAGLTNPVLVRLDAESKVS-ENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLKQL 386
           +  L NP+ + +D E+K++   L+  +  TK  ERE N                 +L QL
Sbjct: 262 RRFLQNPLEIFVDDEAKLTLHGLQQYY--TKLEEREKN----------------RKLAQL 303

Query: 387 RALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVSQL 446
                                              ++L   +  I FV + +    +++L
Sbjct: 304 ----------------------------------LDDLEFNQVII-FVKSTNRANELTKL 328

Query: 447 LKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSLPS 506
           L +S +    ++G + Q  R  +   F+     I V TDV  RG+DI  +   IN+ LPS
Sbjct: 329 LNESNFPAITVHGHMKQEERIARYKAFKDFEKRICVSTDVFGRGIDIERINLAINYDLPS 388

Query: 507 SSKIFIHRVGRTARAGNSGWAYSIVS 532
            +  ++HRVGR  R G  G A S +S
Sbjct: 389 EADQYLHRVGRAGRFGTKGLAISFIS 414

>KLLA0D18667g Chr4 complement(1574160..1576217) [2058 bp, 685 aa]
           {ON} similar to uniprot|P15424 Saccharomyces cerevisiae
           YDR194C MSS116 DEAD-box protein required for efficient
           splicing of mitochondrial Group I and II introns
           presumed RNA helicase due to DEAD-box motif
          Length = 685

 Score =  147 bits (372), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 118/407 (28%), Positives = 193/407 (47%), Gaps = 81/407 (19%)

Query: 149 ISRKGFRQPTPIQRKTIPLILQT-RDIVGMARTGSGKTAAFTLPMIEKLKGHSAK--IGV 205
           IS   F   TP+Q++TI  IL T  D+V  A+TG+GKT AF  P+ + L     +  + V
Sbjct: 153 ISAMKFESLTPVQQRTIKPILTTENDVVAKAKTGTGKTLAFLAPLFQHLISTKLQNPLAV 212

Query: 206 RAVILSPSRELAMQTYKVFKEFSRGS----DLRSVLLTGGDSLEEQF-GMMMGNPDVVIA 260
           +AVI++P+R+LA+Q     K+  + +      RS+ L GG +L++    +   NP++++ 
Sbjct: 213 KAVIVTPTRDLAIQIASEVKKLQQCNPSLKSYRSLTLIGGTNLDKSLKDLHTLNPNIIVG 272

Query: 261 TPGRFLHLKVEMNLD------LKTVEYVVFDEADRLFEMGFQEQ-------LNELLAALP 307
           TPGR   +     LD       K V++ V DEAD L ++GFQ +       LNE      
Sbjct: 273 TPGRINDI-----LDRVGAKYFKDVDFKVLDEADTLLQIGFQTELSLISRKLNEFNTQGE 327

Query: 308 PTRQTLLFSATLPHSLVDFAKAGLTNPVLVRLDA----ESKVSENLEMLFLTTKNGEREA 363
              +TLLFSAT+ H++ + A   +     + +D     +S+  ++++   + TK+     
Sbjct: 328 EHIRTLLFSATMDHNVQELAATIMNKKDCLFIDTVDKNDSEAHDSIDQKLVITKSFAE-- 385

Query: 364 NLLYLLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANE 423
           +++ L+Q +     +   Q K  +A                                   
Sbjct: 386 SMVALIQSI----ESELLQKKNFKA----------------------------------- 406

Query: 424 LPSEKATILFVPTRHHVEYVSQLLKDS---GYLVSYIYGTLDQNARKQQLFNFRSGLTSI 480
                  ILF+PT   V++ S+ L +S      +   +G +DQ  R + +  F+     I
Sbjct: 407 -------ILFLPTVKFVDFFSETLSESLTKRIDIIKFHGKIDQKKRTKLVDRFKKTNHGI 459

Query: 481 LVVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWA 527
            V TDV ARG+  P + +V    +P+S   +IHR+GRTARAG SG A
Sbjct: 460 FVCTDVGARGMHFPSVEHVYQLCVPTSLPNYIHRIGRTARAGESGAA 506

>KAFR0E01640 Chr5 complement(335123..337405) [2283 bp, 760 aa] {ON}
           Anc_5.241 YJL033W
          Length = 760

 Score =  147 bits (372), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 80/191 (41%), Positives = 123/191 (64%), Gaps = 4/191 (2%)

Query: 146 LNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL--KGHSAKI 203
           L  ++   F Q T IQR +IP+ L+  D++G ARTGSGKT AF +P++EKL  +  +A  
Sbjct: 53  LKGLNESAFIQLTGIQRDSIPVSLKGHDVLGAARTGSGKTLAFLIPVLEKLYREKWTAFD 112

Query: 204 GVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPG 263
           G+ A+I+SP+RELAMQ Y+V  +  R +   + L+ GG  ++ +    +   +++I TPG
Sbjct: 113 GLGALIISPTRELAMQIYEVLIKIGRHTSFSAGLVIGGKDVKFE-SERISKINILIGTPG 171

Query: 264 RFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHS 322
           R L HL   + L    ++ +V DEADR  +MGF++ L+ +++ LP +RQTLLFSAT  +S
Sbjct: 172 RVLQHLDQAVGLSTSNLQMLVLDEADRCLDMGFKKTLDAIVSNLPASRQTLLFSATQSNS 231

Query: 323 LVDFAKAGLTN 333
           L D A+  LT+
Sbjct: 232 LADLARLSLTD 242

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 47/97 (48%), Gaps = 2/97 (2%)

Query: 431 ILFVPTRHHVEYVSQLLK--DSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAA 488
           I+F+ +   V +V +  +    G  + +++G   Q AR + L  F       L  TDV A
Sbjct: 295 IVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQKARTETLDKFNRAQHVCLFATDVVA 354

Query: 489 RGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSG 525
           RG+D P +  VI    P     +IHRVGRT R G  G
Sbjct: 355 RGIDFPAVNWVIQVDCPEDVDTYIHRVGRTGRYGKKG 391

>Kwal_23.2883 s23 complement(58087..60381) [2295 bp, 764 aa] {ON}
           YJL033W (HCA4) - putative RNA helicase [contig 246] FULL
          Length = 764

 Score =  147 bits (372), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 125/196 (63%), Gaps = 9/196 (4%)

Query: 146 LNNISRKGFRQP-----TPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL--KG 198
           L+  ++KG R       T IQ+K+IP+ L+  D++  A+TGSGKT AF +P+IEKL  + 
Sbjct: 48  LSQHTQKGLRDSAFVKMTEIQQKSIPVSLKGHDLLAAAKTGSGKTLAFLIPVIEKLYREK 107

Query: 199 HSAKIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVV 258
            +   G+ A+I+SP+RELAMQTY+V  +  R S   + L+ GG  ++ +   +    +++
Sbjct: 108 WTEFDGLGALIISPTRELAMQTYEVLTKIGRYSSFSAGLVIGGKDVKFELERI-SKINIL 166

Query: 259 IATPGRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSA 317
           + TPGR L H+   + L+   V+ +V DEADR  +MGF++ L+ +++ LPP RQTLLFSA
Sbjct: 167 VGTPGRILQHMDQAVGLNTSNVQVLVLDEADRCLDMGFKKTLDAIVSNLPPVRQTLLFSA 226

Query: 318 TLPHSLVDFAKAGLTN 333
           T   SL D A+  LT+
Sbjct: 227 TQSQSLADLARLSLTD 242

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 50/97 (51%), Gaps = 2/97 (2%)

Query: 431 ILFVPTRHHVEYVSQLLK--DSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAA 488
           I+F+ +   V +V +  +    G  + +++G   Q AR + L  F     + L  TDV A
Sbjct: 293 IVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQHTCLFATDVVA 352

Query: 489 RGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSG 525
           RG+D P +  V+    P S   +IHRVGR+AR G  G
Sbjct: 353 RGIDFPAVDWVVQADCPESVDTYIHRVGRSARYGKQG 389

>KNAG0H01520 Chr8 complement(267709..269574) [1866 bp, 621 aa] {ON}
           Anc_8.614 YOR204W
          Length = 621

 Score =  145 bits (367), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 79/244 (32%), Positives = 138/244 (56%), Gaps = 19/244 (7%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL-------- 196
           + +N+ R GF +PTP+Q+ +IP++   RD++G A+TGSGKT  F  P++ ++        
Sbjct: 147 LFDNVQRAGFSKPTPVQKYSIPIVTAGRDLMGCAQTGSGKTGGFLFPILSEMFTAGPAPK 206

Query: 197 -----KGHSA--KIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFG 249
                 G+S   K+   A++L+P+RELA Q ++  ++F+  S +R  ++ GG  +  Q G
Sbjct: 207 PQAASGGYSYQRKVYPTALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGAPVGAQMG 266

Query: 250 MMMGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELL--AALP 307
            +    D+++ATPGR   L     + L  ++Y+  DEADR+ +MGF+ Q+  ++    +P
Sbjct: 267 ELERGCDLLVATPGRLNDLLERGKISLANIKYLTLDEADRMLDMGFEPQIRHIVEDCDMP 326

Query: 308 PT--RQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANL 365
           P   RQTL+FSAT P  +   A+  L + + + +      SEN+    L   + ++++ L
Sbjct: 327 PVNERQTLMFSATFPRDIQHLARDFLNDYIFLSVGRVGSTSENITQKVLYVDDMDKKSAL 386

Query: 366 LYLL 369
           L LL
Sbjct: 387 LDLL 390

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 61/103 (59%)

Query: 430 TILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAAR 489
           T++FV T+   + ++  L       + I+G   Q  R++ L  F+SG   +LV T VAAR
Sbjct: 398 TLIFVETKRMADQLTDFLIMQNIRATAIHGDRTQMERERALGAFKSGTADVLVATAVAAR 457

Query: 490 GVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           G+DIP +  VIN+ LP     ++HR+GRT RAGN+G A S  +
Sbjct: 458 GLDIPNVTLVINYDLPGDIDDYVHRIGRTGRAGNTGTAISFFN 500

>ZYRO0G08580g Chr7 complement(695127..696746) [1620 bp, 539 aa] {ON}
           similar to uniprot|P20447 Saccharomyces cerevisiae
           YGL078C DBP3 Putative ATP-dependent RNA helicase of the
           DEAD-box family involved in ribosomal biogenesis
          Length = 539

 Score =  144 bits (363), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 117/198 (59%), Gaps = 4/198 (2%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL--KGHSAKIGVRAVILS 211
           F +PTPIQ  + P +L  RD++G+A TGSGKT AF +P I++L   G + +  V+ +++S
Sbjct: 146 FPKPTPIQSVSWPYLLSGRDVIGVAETGSGKTFAFGVPAIDQLVSNGDAKRKSVKVLVIS 205

Query: 212 PSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVE 271
           P+RELA QTY      +    L    + GG   +EQ   +  N  VV+ATPGR L L  E
Sbjct: 206 PTRELASQTYDNLIILTNKVGLECCCVYGGVPKQEQRNQLR-NSQVVVATPGRLLDLINE 264

Query: 272 MNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPP-TRQTLLFSATLPHSLVDFAKAG 330
            ++DL  V+Y+V DEADR+ E GF+E +  ++       RQTL+F+AT P  + + A   
Sbjct: 265 QSVDLSQVQYLVLDEADRMLEKGFEEDIKNIINQTNSRDRQTLMFTATWPKEVRELASTF 324

Query: 331 LTNPVLVRLDAESKVSEN 348
           + +PV V +    ++S N
Sbjct: 325 MRDPVKVSIGNRDELSAN 342

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 66/103 (64%)

Query: 430 TILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAAR 489
            ++F   +     V   LK +GY V+ I+G L Q  R   L +F++G +++L+ TDVAAR
Sbjct: 378 VLIFALYKKEASRVENNLKYNGYDVAAIHGDLSQQQRTSALNDFKAGKSNLLLATDVAAR 437

Query: 490 GVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           G+DIP +  VIN + P + + ++HR+GRT RAG +G A+++ +
Sbjct: 438 GLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFT 480

>TBLA0C00690 Chr3 complement(136694..138508) [1815 bp, 604 aa] {ON}
           Anc_8.87 YFL002C
          Length = 604

 Score =  144 bits (364), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 112/407 (27%), Positives = 180/407 (44%), Gaps = 76/407 (18%)

Query: 149 ISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSA------K 202
           I   GF + TP+Q  TIP++   +D+V  + TGSGKT AF +P++EK+    A      K
Sbjct: 22  IDVMGFERMTPVQASTIPMLAGNKDVVVDSVTGSGKTIAFVIPVLEKIISEQANNVKFKK 81

Query: 203 IGVRAVILSPSRELAMQTYKVFKEFSRGSD-----LRSVLLTGGDS--LEEQFGMMMGN- 254
                +I++P+REL+ Q   V   F          +RS LL G ++  + +     + + 
Sbjct: 82  GHFHTLIIAPTRELSKQIQAVIDSFLDHYPEGLYPIRSKLLVGTNTRTVRDDVAQFLDDR 141

Query: 255 PDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLL 314
           P +++ TPGR L       +   +   V+ DEADRL +  F   +  +L  LP  R+T L
Sbjct: 142 PQILVGTPGRILDFLGNPTVKTSSCSMVILDEADRLLDGSFLGDVENILGILPKQRRTGL 201

Query: 315 FSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIR 374
           FSAT+  +  +  K GL NP+ + ++++    ++L + +   K  ++   LL LL     
Sbjct: 202 FSATINSAGENIFKTGLRNPIKITVNSKQSAPQSLNIDYAVVKLEKKLEYLLTLL----- 256

Query: 375 IPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFV 434
                                                          N    +K  + F 
Sbjct: 257 -----------------------------------------------NNYKFKKCIVYF- 268

Query: 435 PTRHHVEYVSQLLK--------DSGYLVSYIYGTLDQNARKQQLFNFRSGL-TSILVVTD 485
           PT   V Y+    +        +S   +  ++G L  ++R + L +F      +IL+ TD
Sbjct: 269 PTCIFVNYIYNFFQHLQKSKVIESKLSIFSLHGKLQTSSRMKTLDSFTQTFDNAILLTTD 328

Query: 486 VAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           VAARG+DIP +  VI    P+ S +F+HR GRT RA   G A   +S
Sbjct: 329 VAARGIDIPDVDLVIQVDPPTDSDVFLHRCGRTGRANRIGKAIVFLS 375

>Ecym_8261 Chr8 complement(528229..530556) [2328 bp, 775 aa] {ON}
           similar to Ashbya gossypii ACR040W
          Length = 775

 Score =  146 bits (368), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 80/192 (41%), Positives = 121/192 (63%), Gaps = 6/192 (3%)

Query: 146 LNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL--KGHSAKI 203
           L  +   GF + T IQR +IP+ L+  DI+G A+TGSGKT AF +P+IEKL  +  +   
Sbjct: 53  LKGLKESGFIKLTDIQRDSIPMALKGHDILGAAKTGSGKTLAFLIPVIEKLYREKWTEFD 112

Query: 204 GVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGM-MMGNPDVVIATP 262
           G+ A+I+SP+RELAMQ Y+V  +  + +   + L+ GG  +  +F M  +   +++I TP
Sbjct: 113 GLGALIISPTRELAMQIYEVLIKIGKHTSFSAGLVIGGKDV--KFEMDRISKINILIGTP 170

Query: 263 GRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           GR L H+   + L    ++ +V DEADR  +MGF++ L+ +++ LPP RQTLLFSAT   
Sbjct: 171 GRILQHMDQAVGLTSSNLQILVLDEADRCLDMGFKKTLDAIVSNLPPDRQTLLFSATQSQ 230

Query: 322 SLVDFAKAGLTN 333
           SL D A+  L +
Sbjct: 231 SLADLARLSLVD 242

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 50/98 (51%), Gaps = 2/98 (2%)

Query: 430 TILFVPTRHHVEYVSQLLK--DSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
           T++F+ +   V +V +  +    G  + +++G   Q AR + L  F     + L  TDV 
Sbjct: 291 TVVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQHACLFSTDVV 350

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSG 525
           ARG+D P +  V+    P     +IHR GR+AR G SG
Sbjct: 351 ARGIDFPTVDWVVQVDCPEDVDTYIHRAGRSARYGKSG 388

>YDR194C Chr4 complement(845952..847946) [1995 bp, 664 aa] {ON}
           MSS116DEAD-box protein required for efficient splicing
           of mitochondrial Group I and II introns; non-polar RNA
           helicase that also facilities strand annealing
          Length = 664

 Score =  145 bits (365), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 121/398 (30%), Positives = 182/398 (45%), Gaps = 65/398 (16%)

Query: 149 ISRKGFRQPTPIQRKTIPLILQT--RDIVGMARTGSGKTAAFTLPMIEKLKG--HSAKIG 204
           I+R  F   TP+Q+KTI  IL +   D++  A+TG+GKT AF +P+ + L      ++  
Sbjct: 121 ITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYM 180

Query: 205 VRAVILSPSRELAMQT---YKVFKEFSRG-SDLRSVLLTGGDSLEEQFGMMMG-NPDVVI 259
           V+AVI++P+R+LA+Q     K   + + G      V L GG         M    P++VI
Sbjct: 181 VKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVI 240

Query: 260 ATPGRFLH-LKVEMNLDLKTVEYVVFDEADRLFEMGFQEQ-------LNELLAALPPTRQ 311
           ATPGR +  L+   N   + V+Y V DEADRL E+GF++        LNE  +      +
Sbjct: 241 ATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIK 300

Query: 312 TLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVS-ENLEMLFLTTKNGEREANLLYLLQ 370
           TLLFSATL   +   A   +     + LD   K   E  E +  +    E+ AN ++   
Sbjct: 301 TLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAV 360

Query: 371 EVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKAT 430
           E I+         KQ++                                   E  S    
Sbjct: 361 EHIK---------KQIK-----------------------------------ERDSNYKA 376

Query: 431 ILFVPTRHHVEYVSQLLKDS---GYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
           I+F PT     ++  +LK+       +   +G + QN R   +  F+   + ILV TDV 
Sbjct: 377 IIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVG 436

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSG 525
           ARG+D P +  V+   +PS    +IHR+GRTAR+G  G
Sbjct: 437 ARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEG 474

>ACR078W Chr3 (501241..502644) [1404 bp, 467 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR046C (DBP5)
          Length = 467

 Score =  141 bits (356), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 104/387 (26%), Positives = 183/387 (47%), Gaps = 68/387 (17%)

Query: 154 FRQPTPIQRKTIPLILQT--RDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILS 211
           F++P+ IQ + +PL+L    R+++  +++G+GKTAAF+L M+ ++    A    +A+ L+
Sbjct: 99  FQKPSKIQERALPLLLYNPPRNMIAQSQSGTGKTAAFSLTMLSRV--DVAVPATQAICLA 156

Query: 212 PSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVE 271
           PSR LA QT +V +E  + + + S L+   DS E+   +   N  +++ TPG  L L   
Sbjct: 157 PSR-LARQTLEVIQEMGKFTKIASQLIVP-DSYEKNKAI---NAHIIVGTPGTVLDLMRR 211

Query: 272 MNLDLKTVEYVVFDEADRLFE-MGFQEQLNELLAALPPTRQTLLFSATLPHSLVDFAKAG 330
             + L  V+  V DEAD + +  G  +Q   +   LP   Q +LFSAT   S+ ++A+  
Sbjct: 212 KMIQLGKVKTFVLDEADNMLDKQGLGDQCIRVKKFLPKDTQLVLFSATFDDSVREYARRV 271

Query: 331 LTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLKQLRALX 390
           + N   + L         ++ LF+   +   +  +L  L  ++ I               
Sbjct: 272 VPNANSLELQRNEVNVSAIKQLFMDCNDERHKFTVLCDLYGLLTI--------------- 316

Query: 391 XXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVEYVSQLLKDS 450
                                                 ++I+FV T+     +   LK  
Sbjct: 317 -------------------------------------GSSIIFVQTKQTANMLYTELKRE 339

Query: 451 GYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSLPSSSK- 509
           G+ VS ++G L    R + + +FR G + +L+ T+V ARG+DIP ++ V+N+ LP ++  
Sbjct: 340 GHQVSILHGDLQSADRDRLIGDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPMTANG 399

Query: 510 -----IFIHRVGRTARAGNSGWAYSIV 531
                 ++HR+GRT R G +G A S +
Sbjct: 400 QPDPSTYVHRIGRTGRFGRTGVAISFI 426

>Kpol_1004.13 s1004 (25289..27595) [2307 bp, 768 aa] {ON}
           (25289..27595) [2307 nt, 769 aa]
          Length = 768

 Score =  145 bits (365), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 80/192 (41%), Positives = 123/192 (64%), Gaps = 6/192 (3%)

Query: 146 LNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL--KGHSAKI 203
           L  ++   F + T IQR +IP+ L+  DI+G A+TGSGKT AF +P++EKL  +  +   
Sbjct: 53  LKGLNDSAFLKLTDIQRDSIPMSLKGYDILGAAKTGSGKTLAFLIPVLEKLYRERWTEFD 112

Query: 204 GVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGM-MMGNPDVVIATP 262
           G+ A+I+SP+RELAMQ Y+V  +    +   + L+ GG  +  +F M  +   +++I TP
Sbjct: 113 GLGALIISPTRELAMQIYEVLLKIGTSTSFSAGLVIGGKDV--KFEMERISKINILIGTP 170

Query: 263 GRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           GR L H+   + L+   ++ +V DEADR  +MGF++ L+ +++ LPPTRQTLLFSAT   
Sbjct: 171 GRILQHMDQAIGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVSNLPPTRQTLLFSATQSQ 230

Query: 322 SLVDFAKAGLTN 333
           SL D A+  LT+
Sbjct: 231 SLEDLARLSLTD 242

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 47/97 (48%), Gaps = 2/97 (2%)

Query: 431 ILFVPTRHHVEYVSQLLK--DSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAA 488
           I+F+ +   V +V +  +    G  + +++G   Q AR + L  F       L  TDV A
Sbjct: 297 IVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQKARTETLDKFNRAQHVCLFATDVVA 356

Query: 489 RGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSG 525
           RG+D P +  V+    P     +IHRVGR AR G  G
Sbjct: 357 RGIDFPAIDWVVQVDCPEDVDTYIHRVGRCARYGKQG 393

>NCAS0A01400 Chr1 (274080..276368) [2289 bp, 762 aa] {ON} Anc_5.241
          Length = 762

 Score =  145 bits (365), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 78/191 (40%), Positives = 122/191 (63%), Gaps = 4/191 (2%)

Query: 146 LNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL--KGHSAKI 203
           L  +S   F + T IQR++IP+ L+  D++G A+TGSGKT AF +P++EKL  +  +   
Sbjct: 53  LKGLSEAAFLKLTDIQRESIPVSLKGYDVLGSAKTGSGKTLAFLIPVLEKLYRERWTEFD 112

Query: 204 GVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPG 263
           G+ A+I+SP+RELAMQ Y+V  +    +   + L+ GG  ++ +   +    +++I TPG
Sbjct: 113 GLGALIISPTRELAMQIYEVLIKIGSHTSFSAGLVIGGKDVKFELERI-SRINILIGTPG 171

Query: 264 RFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHS 322
           R L HL   + L+   ++ +V DEADR  +MGF++ L+ ++  LPP+RQTLLFSAT   S
Sbjct: 172 RILQHLDQAVGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVGNLPPSRQTLLFSATQSQS 231

Query: 323 LVDFAKAGLTN 333
           L D A+  LT+
Sbjct: 232 LADLARLSLTD 242

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 49/97 (50%), Gaps = 2/97 (2%)

Query: 431 ILFVPTRHHVEYVSQLLK--DSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAA 488
           I+F+ +   V +V +  +    G  + +++G   Q AR + L  F       L  TDV A
Sbjct: 295 IVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQKARTETLDKFSRAQQVCLFATDVVA 354

Query: 489 RGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSG 525
           RG+D P +  VI    P  +  +IHRVGR+AR G  G
Sbjct: 355 RGIDFPSVDWVIQLDCPEDADTYIHRVGRSARYGKKG 391

>Smik_4.442 Chr4 complement(801552..803549) [1998 bp, 665 aa] {ON}
           YDR194C (REAL)
          Length = 665

 Score =  144 bits (362), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 119/403 (29%), Positives = 183/403 (45%), Gaps = 71/403 (17%)

Query: 149 ISRKGFRQPTPIQRKTIPLILQT--RDIVGMARTGSGKTAAFTLPMIEKLKG--HSAKIG 204
           I+R  F   TP+Q+KTI  IL +   D++  A+TG+GKT AF +P+ + L      ++  
Sbjct: 121 ITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLMNTKFDSQYM 180

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLR-------SVLLTGGDSLEEQFGMMMG-NPD 256
           V+AVI++P+R+LA+Q   +  E  +  D+         V L GG         M    P+
Sbjct: 181 VKAVIVAPTRDLALQ---IESEVKKIHDMNYGLKKYGCVSLVGGTDFRAAMNKMNKLRPN 237

Query: 257 VVIATPGRFLH-LKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTR----- 310
           +VIATPGR +  L+   N   + V+Y V DEADRL E+GF++ L  +   L         
Sbjct: 238 IVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSVD 297

Query: 311 --QTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVS-ENLEMLFLTTKNGEREANLLY 367
             +TLLFSATL   +   A   +     + LD   K   E  E +  +    E+ AN ++
Sbjct: 298 NIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIF 357

Query: 368 LLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSE 427
              E I+         KQ++                                   E  S 
Sbjct: 358 AAVEHIK---------KQIK-----------------------------------ERESN 373

Query: 428 KATILFVPTRHHVEYVSQLLKDS---GYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVT 484
              I+F PT     ++  +L++       +   +G + QN R   +  F+   + ILV T
Sbjct: 374 YKAIIFAPTVKFTSFLCNILQNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCT 433

Query: 485 DVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWA 527
           DV ARG+D P +  V+   +PS    +IHR+GRTAR+G  G +
Sbjct: 434 DVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSS 476

>NCAS0B03030 Chr2 (522163..524217) [2055 bp, 684 aa] {ON} Anc_8.402
          Length = 684

 Score =  144 bits (362), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 120/407 (29%), Positives = 187/407 (45%), Gaps = 81/407 (19%)

Query: 148 NISRKGFRQPTPIQRKTIPLILQTR---DIVGMARTGSGKTAAFTLPMIEKLKGH--SAK 202
           +ISR  F   TP+Q++TI  IL T    D++  A+TG+GKT AF +PM + L      ++
Sbjct: 133 SISRMNFPGLTPVQQRTIKPILTTSTSDDVIARAKTGTGKTFAFLIPMFQHLINTKLDSQ 192

Query: 203 IGVRAVILSPSRELAMQTYKVFKEFSRGS----DLRSVLLTGGDSLEEQFGMMMGN---- 254
             V+ VI++P+R+LA+Q     K+    +        V L GG +    FGM M      
Sbjct: 193 NMVKCVIVAPTRDLALQIEAEVKKIHDNNYGLKKFGCVSLVGGTN----FGMAMRKMDQL 248

Query: 255 -PDVVIATPGRFLHLKVEMNLDL-KTVEYVVFDEADRLFEMGFQEQ-------LNELLAA 305
            P+++I TPGR + +  + +    K V++ + DEADRL E+GF+E        LN + A 
Sbjct: 249 RPNIIIGTPGRLIDVMDKYSDKFFKYVDFKILDEADRLLEIGFKEDLEYISSTLNRINAV 308

Query: 306 LPPTRQTLLFSATLPHSLVDFAKAGLTNPVLVRLDA----ESKVSENLEMLFLTTKNGER 361
                +TLLFSATL   +   A   +     + LD     E +  E ++   + T   + 
Sbjct: 309 GKDHIRTLLFSATLDEKVQVLANNIMNKEQCLFLDTVDKNEPEAHEKIDQAVVLT---DH 365

Query: 362 EANLLYLLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSA 421
            A+ +Y   E +R+ +    + K                                     
Sbjct: 366 FAHNIYAAIEHLRLKIKEDPEYK------------------------------------- 388

Query: 422 NELPSEKATILFVPTRHHVEYVSQLLKD---SGYLVSYIYGTLDQNARKQQLFNFRSGLT 478
                   TI+F PT    ++ SQLLK    S   +   +G ++Q  R + + +F+    
Sbjct: 389 --------TIVFTPTVKFTKFFSQLLKKEFGSQLPIYEFHGQIEQRRRTRIVGDFKRVKA 440

Query: 479 SILVVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSG 525
            +LV TDV ARG+D P +  VI   +PS    +IHR+GRTAR+G  G
Sbjct: 441 GLLVCTDVGARGMDFPNVKEVIQVGVPSELANYIHRIGRTARSGKEG 487

>NDAI0C04680 Chr3 complement(1077391..1079541) [2151 bp, 716 aa]
           {ON} Anc_8.402
          Length = 716

 Score =  143 bits (361), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 126/407 (30%), Positives = 189/407 (46%), Gaps = 83/407 (20%)

Query: 149 ISRKGFRQPTPIQRKTIPLILQTR---DIVGMARTGSGKTAAFTLPMIEKLKGH--SAKI 203
           ISR GF   +P+Q++TI  IL +    D++  A+TG+GKT AF +PM + L      ++ 
Sbjct: 176 ISRMGFPGLSPVQQRTIKPILSSTTNDDVIARAKTGTGKTFAFLIPMFQHLINTQLDSRY 235

Query: 204 GVRAVILSPSRELAMQT---YKVFKEFSRG-SDLRSVLLTGGDSLEEQFGMMMGN----- 254
            V+ VI++P+R+LA+Q     K   + + G      V L GG +    FGM M       
Sbjct: 236 MVKCVIVAPTRDLALQIEAEVKKIHDHNYGLKKFGCVSLVGGTN----FGMAMRRMDQIR 291

Query: 255 PDVVIATPGRFLH-LKVEMNLDLKTVEYVVFDEADRLFEMGFQEQ-------LNELLAAL 306
           P++VIATPGR +  L+   N   K V++ + DEADRL E+GF+E        LN++ A  
Sbjct: 292 PNIVIATPGRLIDVLQKYGNKFFKYVDFKILDEADRLLEIGFKEDLEFVSGYLNDINAKA 351

Query: 307 PPTRQTLLFSATLPHSLVDFAKAGLTNPVLVRLDA----ESKVSENLEMLFLTTKNGERE 362
               +TLLFSATL   +   A   +     + LD     E +  E ++   + T +    
Sbjct: 352 KDHIRTLLFSATLDEKVQVLANEIMNKDQCLFLDTVDKNEPEAHEKIDQAVVVTNHF--- 408

Query: 363 ANLLYLLQEVIRIPVATAEQL-KQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSA 421
           A  +Y          AT + L KQ+ A                                 
Sbjct: 409 AESVY----------ATLDHLQKQIVA--------------------------------- 425

Query: 422 NELPSEKATILFVPTRHHVEYVSQLLK---DSGYLVSYIYGTLDQNARKQQLFNFRSGLT 478
              P  K  + F PT     ++++LL+    +   V   +G LDQ  R   + NF+    
Sbjct: 426 --DPGYKGIL-FAPTVKFTRFIAKLLQKEFTNDLPVLEFHGQLDQRRRTNLVNNFKKMEK 482

Query: 479 SILVVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSG 525
            +LV TDV ARG+D P +  V+   +PS    +IHR+GRTAR+G  G
Sbjct: 483 GLLVCTDVGARGMDFPNVKEVLQVGVPSELPNYIHRIGRTARSGKEG 529

>Kwal_56.24005 s56 complement(809954..811555) [1602 bp, 533 aa] {ON}
           YGL078C (DBP3) - ATP-dependent RNA helicase CA3 of the
           DEAD/DEAH box family [contig 168] FULL
          Length = 533

 Score =  140 bits (354), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 120/206 (58%), Gaps = 5/206 (2%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSA-KI 203
           I + IS+  F +PTPIQ  + P +L  +D+VG+A TGSGKT AF +P +  L    A K 
Sbjct: 134 IQHEISK--FPKPTPIQSVSWPYLLSGKDVVGVAETGSGKTFAFGVPAVNNLMSADAKKK 191

Query: 204 GVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPG 263
           G++ +++SP+RELA QTY      ++ + +    + GG   +EQ   +     VV+ATPG
Sbjct: 192 GIQVLVISPTRELASQTYDNLISLTKKAGVNCCCVYGGVPKDEQRAQLK-KAHVVVATPG 250

Query: 264 RFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHS 322
           R L L  E +  L  V+Y+V DEADR+ E GF+E +  ++ +     RQTL+F+AT P  
Sbjct: 251 RLLDLIEEGSARLSNVDYLVLDEADRMLEKGFEEDIKRIIGSTKSAGRQTLMFTATWPKE 310

Query: 323 LVDFAKAGLTNPVLVRLDAESKVSEN 348
           + + A   + NPV V +    ++S N
Sbjct: 311 VRELASTFMNNPVKVSIGNRDELSAN 336

 Score = 91.3 bits (225), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 67/102 (65%)

Query: 431 ILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARG 490
           ++F   +     V + LK +GY V+ I+G L Q  R Q L  F+SG +++L+ TDVAARG
Sbjct: 373 LIFALYKKEAARVERNLKYNGYSVAAIHGDLSQQQRTQALNEFKSGASNLLLATDVAARG 432

Query: 491 VDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           +DIP +  VIN + P + + ++HR+GRT RAG +G A+++ +
Sbjct: 433 LDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGLTGTAHTLFT 474

>KNAG0F02610 Chr6 complement(488956..491244) [2289 bp, 762 aa] {ON}
           Anc_5.241 YJL033W
          Length = 762

 Score =  143 bits (361), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 78/192 (40%), Positives = 120/192 (62%), Gaps = 4/192 (2%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL--KGHSAK 202
           +L  +S   F + T IQR++IP+ LQ  D++  A+TGSGKT AF +P++EKL  +  +  
Sbjct: 52  VLKGLSASAFVKLTAIQRESIPVSLQGHDVLAAAKTGSGKTLAFLVPVLEKLYRERWTEF 111

Query: 203 IGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATP 262
            G+ A+I+SP+RELAMQ Y+V  +        + L+ GG  ++ +    +   +++I TP
Sbjct: 112 DGLGALIISPTRELAMQIYEVLVKVGSQCSFSAGLVIGGKDVKYE-SERISKINILIGTP 170

Query: 263 GRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           GR L HL   + L+   ++ +V DEADR  +MGF++ L+ ++  LPP RQTLLFSAT   
Sbjct: 171 GRILQHLDQAVGLNASNLQMLVLDEADRCLDMGFKKTLDAIVGNLPPMRQTLLFSATQSA 230

Query: 322 SLVDFAKAGLTN 333
           SL D A+  LT+
Sbjct: 231 SLADLARLSLTD 242

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 52/104 (50%), Gaps = 2/104 (1%)

Query: 431 ILFVPTRHHVEYVSQLLK--DSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAA 488
           I+F+ +   V ++ +  +    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 297 IVFLSSGKQVHFIYETFRKMQPGISLMHLHGRQKQTARTDTLDKFVRAQQVCLFATDVVA 356

Query: 489 RGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           RG+D P +  V+    P  +  +IHRVGR+AR G  G A  +++
Sbjct: 357 RGIDFPAVDWVVQVDCPEDADTYIHRVGRSARYGKKGKALIMLT 400

>Skud_4.458 Chr4 complement(812448..814442) [1995 bp, 664 aa] {ON}
           YDR194C (REAL)
          Length = 664

 Score =  142 bits (358), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 118/398 (29%), Positives = 179/398 (44%), Gaps = 65/398 (16%)

Query: 149 ISRKGFRQPTPIQRKTIPLIL--QTRDIVGMARTGSGKTAAFTLPMIEKLKGH--SAKIG 204
           I+R  F   TP+Q+KTI  IL  Q  D++  A+TG+GKT AF +P+ + L      ++  
Sbjct: 120 ITRMEFPGLTPVQQKTIKPILSSQEHDVIARAKTGTGKTFAFLIPIFQHLINTKLDSQYM 179

Query: 205 VRAVILSPSRELAMQT---YKVFKEFSRG-SDLRSVLLTGGDSLEEQFGMMMG-NPDVVI 259
           V+AVI++P+R+LA+Q     K   + + G      V L GG         M    P++VI
Sbjct: 180 VKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVI 239

Query: 260 ATPGRFLH-LKVEMNLDLKTVEYVVFDEADRLFEMGFQEQ-------LNELLAALPPTRQ 311
            TPGR +  L+   N   + V+Y V DEADRL E+GF++        LNE  +      +
Sbjct: 240 GTPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGLLNEKNSKSADNIK 299

Query: 312 TLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVS-ENLEMLFLTTKNGEREANLLYLLQ 370
           TL+FSATL   +   A   +     + LD   K   E  E +  +    E+ AN ++   
Sbjct: 300 TLMFSATLDDKVQKLANNIMNKSECLFLDTVDKNEPEAHERIDQSVVISEKFANSIF--- 356

Query: 371 EVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKAT 430
                  A  E +K+                                     E  S    
Sbjct: 357 -------AAVEHIKK----------------------------------QVKERESNYKA 375

Query: 431 ILFVPTRHHVEYVSQLLKDS---GYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVA 487
           I+F PT     ++  +L++       +   +G + QN R   +  F+   + ILV TDV 
Sbjct: 376 IIFAPTVKFTSFLCNILQNEFKKDLPILEFHGKITQNRRTSLVKKFKKDESGILVCTDVG 435

Query: 488 ARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSG 525
           ARG+D P +  V+   +PS    +IHR+GRTAR+G  G
Sbjct: 436 ARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEG 473

>ZYRO0A10802g Chr1 complement(869465..871780) [2316 bp, 771 aa] {ON}
           similar to uniprot|P20448 Saccharomyces cerevisiae
           YJL033W HCA4 Putative nucleolar DEAD box RNA helicase
           high- copy number suppression of a U14 snoRNA processing
           mutant suggests an involvement in 18S rRNA synthesis
          Length = 771

 Score =  143 bits (360), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 121/192 (63%), Gaps = 4/192 (2%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL--KGHSAK 202
           +L  +    + + T IQR +IP+ L+  D++G A+TGSGKT AF +P++EKL  +  +  
Sbjct: 50  VLRGLKDASYVKLTDIQRDSIPVSLKGNDVLGAAKTGSGKTLAFLIPVLEKLYRERWTEY 109

Query: 203 IGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATP 262
            GV A+I+SP+RELAMQ Y+V  +        + L+ GG  ++ +    +   +++I TP
Sbjct: 110 DGVGALIISPTRELAMQIYEVLIKIGTHCSFSAGLVIGGKDVKFE-AERISKINILIGTP 168

Query: 263 GRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           GR L HL   + L++  ++ +V DEADR  +MGF++ L+ +++ LPP RQTLLFSAT   
Sbjct: 169 GRLLQHLDQSVGLNIDNLQMLVLDEADRCLDMGFKKTLDAIVSNLPPIRQTLLFSATQSQ 228

Query: 322 SLVDFAKAGLTN 333
           SL D A+  LT+
Sbjct: 229 SLNDLARLSLTD 240

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 49/97 (50%), Gaps = 2/97 (2%)

Query: 431 ILFVPTRHHVEYVSQLLK--DSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAA 488
           I+F  +   V +V +  +    G  + +++G   Q AR + L  F       L+ TDV +
Sbjct: 290 IVFFSSSKQVHFVYETFRKLQPGISLMHLHGRQKQRARTETLDKFSRAQQVCLIATDVVS 349

Query: 489 RGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSG 525
           RG+D P +  V+    P +   +IHRVGR+AR G  G
Sbjct: 350 RGIDFPAVDWVVQVDCPENVDTYIHRVGRSARYGKQG 386

>KNAG0I02050 Chr9 complement(399547..399554,399758..401021) [1272
           bp, 423 aa] {ON} Anc_2.164 YNL112W
          Length = 423

 Score =  138 bits (348), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 75/216 (34%), Positives = 125/216 (57%), Gaps = 8/216 (3%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHS---A 201
           +L  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  +   +    
Sbjct: 121 VLTEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQALLQP 180

Query: 202 KIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIAT 261
             G   ++L+P+RELA+Q  K   +F   S +R+  + GG    +Q   +    ++VIAT
Sbjct: 181 GDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPRGQQIRDLNRGSEIVIAT 240

Query: 262 PGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           PGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  + P RQTL++SAT P 
Sbjct: 241 PGRLIDMLELGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 300

Query: 322 SLVDFAKAGLTNPVLVR-----LDAESKVSENLEML 352
            +   A   L++P+ V+     L A   +++ +E++
Sbjct: 301 EVKQLAADYLSDPIQVQIGSLELAASHTITQRVEVV 336

 Score = 52.4 bits (124), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 44/73 (60%), Gaps = 1/73 (1%)

Query: 420 SANELPSEKATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTS 479
           +A++ P  K  ++F  T+   + +++ L++ G+    I+G  DQ  R   L  FR+G + 
Sbjct: 351 TASQNPESK-ILVFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLNEFRTGRSP 409

Query: 480 ILVVTDVAARGVD 492
           I+V TDVAARG+D
Sbjct: 410 IMVATDVAARGID 422

>TDEL0C01160 Chr3 complement(198802..200613) [1812 bp, 603 aa] {ON}
           Anc_8.87 YFL002C
          Length = 603

 Score =  141 bits (355), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 107/395 (27%), Positives = 179/395 (45%), Gaps = 59/395 (14%)

Query: 153 GFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSA------KIGVR 206
           GF   TP+Q  TIPL  + +D+V  + TGSGKT AF +P++E++    A      K    
Sbjct: 26  GFDAMTPVQASTIPLFSRNKDVVVESVTGSGKTVAFVVPILERIISDGANSTAFKKGHFH 85

Query: 207 AVILSPSRELAMQTYKVFKEF-----SRGSDLRSVLLTGGDS---LEEQFGMMMGNPDVV 258
           ++I++P+REL+ Q   V + F          ++S LL G       ++    +   P ++
Sbjct: 86  SLIVTPTRELSNQIQSVIQSFLDHYPGDSYPIKSQLLVGTSQKTVRDDVTKFLEERPQIL 145

Query: 259 IATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSAT 318
           + TPGR L      ++   +   VV DEADRL +  F + + ++L  LP  R+T LFSAT
Sbjct: 146 VGTPGRVLDFLQMPSVKTLSCNMVVLDEADRLLDSDFFKDVEKILRTLPKQRRTGLFSAT 205

Query: 319 LPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVA 378
           +  +     K GL NPV V +++  K   +L + +      E+   L+ +L         
Sbjct: 206 ISEAGNQIFKTGLRNPVKVTVNSSKKGPASLGLFYTVIDPQEKLLQLINILNNY------ 259

Query: 379 TAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRH 438
              + K+  A                                    P+  +   F     
Sbjct: 260 ---KFKKCIAY----------------------------------FPTCISVTFFYSFLQ 282

Query: 439 HVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLT-SILVVTDVAARGVDIPMLA 497
           +++   +LL D   +V  ++G L   +R + L NF   +  ++L+ TDVAARG+DI  + 
Sbjct: 283 YLQREKKLLSDE-VMVYSLHGKLQTASRMKTLENFTDTVNKAVLLTTDVAARGIDISDVD 341

Query: 498 NVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
            V+    P+ + + +HR GRT RA   G A + ++
Sbjct: 342 LVVQLDPPTDTSVLLHRCGRTGRANRIGKAITFIN 376

>KLTH0G07766g Chr7 complement(626094..628388) [2295 bp, 764 aa] {ON}
           highly similar to uniprot|P20448 Saccharomyces
           cerevisiae YJL033W HCA4 Putative nucleolar DEAD box RNA
           helicase high-copy number suppression of a U14 snoRNA
           processing mutant suggests an involvement in 18S rRNA
           synthesis
          Length = 764

 Score =  142 bits (358), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 76/191 (39%), Positives = 120/191 (62%), Gaps = 4/191 (2%)

Query: 146 LNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL--KGHSAKI 203
           L  +    F + T IQ+ +IP+ L+  D++  A+TGSGKT AF +P+IEKL  +  +   
Sbjct: 53  LKGLRDSAFIKMTEIQKMSIPVSLKGHDLLAAAKTGSGKTLAFLIPVIEKLYREKWTEFD 112

Query: 204 GVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPG 263
           G+ A+I+SP+RELAMQTY+V  +  R +   + L+ GG  ++ +   +    ++++ TPG
Sbjct: 113 GLGALIISPTRELAMQTYEVLTKIGRYTSFSAGLVIGGKEVKFELDRI-SKINILVGTPG 171

Query: 264 RFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHS 322
           R L H+   + L+   ++ +V DEADR  +MGF++ L+ ++  LPP RQTLLFSAT   S
Sbjct: 172 RILQHMDQAVGLNTSNLQVLVLDEADRCLDMGFKKTLDAIVMNLPPVRQTLLFSATQSQS 231

Query: 323 LVDFAKAGLTN 333
           L D A+  LT+
Sbjct: 232 LADLARLSLTD 242

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 54/104 (51%), Gaps = 2/104 (1%)

Query: 431 ILFVPTRHHVEYVSQLLK--DSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAA 488
           I+F+ +   V +V +  +    G  + +++G   Q AR + L  F     + L  TDV A
Sbjct: 293 IVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQHTCLFATDVVA 352

Query: 489 RGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           RG+D P +  V+    P +   +IHRVGR+AR G  G +  +++
Sbjct: 353 RGIDFPAVDWVVQADCPENVDTYIHRVGRSARYGKQGKSLVMLT 396

>AFL221C Chr6 complement(22711..23108,23775..25050) [1674 bp, 557
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YNL112W (DBP2); 1-intron
          Length = 557

 Score =  140 bits (353), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 117/198 (59%), Gaps = 3/198 (1%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGH---SA 201
           +L  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  +      S 
Sbjct: 125 VLKEVKEEGFEKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLSP 184

Query: 202 KIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIAT 261
             G   ++L+P+RELA+Q  K   +F R S +R+  + GG    +Q   +    +++IAT
Sbjct: 185 GDGPVVLVLAPTRELAVQIQKECSKFGRSSRIRNTCVYGGVPKSQQIRDLQRGVEILIAT 244

Query: 262 PGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321
           PGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  + P RQTL++SAT P 
Sbjct: 245 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 304

Query: 322 SLVDFAKAGLTNPVLVRL 339
            +   A+  L +P+ V +
Sbjct: 305 EVQQLARDYLHDPIQVNI 322

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 58/102 (56%)

Query: 431 ILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARG 490
           I+   T+   + ++  L+  G+    I+G          L ++R+G + I+V TDV ARG
Sbjct: 365 IILHSTKRTCDEITSYLRQDGWPALAIHGPTPLQDIDCTLNDYRTGRSPIMVATDVVARG 424

Query: 491 VDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           +D+  +  VIN+ +P + + ++HR+GRT RAG +G A S  +
Sbjct: 425 IDVKGINFVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 466

>Ecym_2213 Chr2 (419873..421537) [1665 bp, 554 aa] {ON} similar to
           Ashbya gossypii AFL080W
          Length = 554

 Score =  140 bits (353), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 120/209 (57%), Gaps = 7/209 (3%)

Query: 146 LNNISRK---GFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL--KGHS 200
           LNN  +K    F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P +  +   G +
Sbjct: 150 LNNEVQKVVAKFPKPTPIQAVSWPYLLSGKDVIGVAETGSGKTFAFGVPAVNNIVSSGDA 209

Query: 201 AKIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIA 260
           +   V+ +I+SP+RELA Q Y    E +    L    L GG   + Q  + + N  +V+A
Sbjct: 210 SNKNVQCLIISPTRELASQIYDNLVELTNKVSLNCCCLYGGVPKDAQ-RLQLKNSQIVVA 268

Query: 261 TPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATL 319
           TPGR L L  E   DL  V+Y+V DEADR+ E GF+E + +++     T RQTL+F+AT 
Sbjct: 269 TPGRLLDLIQEGYADLSQVQYLVLDEADRMLEKGFEEDIKKIIKETDVTRRQTLMFTATW 328

Query: 320 PHSLVDFAKAGLTNPVLVRLDAESKVSEN 348
           P  + + A   + +PV + +    ++S N
Sbjct: 329 PKEVRELASTFMKHPVKISIGNRDELSAN 357

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 68/103 (66%)

Query: 430 TILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAAR 489
            ++F   +     V + L+ +GY V+ I+G L Q  R Q L +F+SG T++L+ TDVAAR
Sbjct: 393 VLIFALYKKEASRVERNLQYNGYNVAAIHGDLSQQQRTQALDDFKSGKTNLLLATDVAAR 452

Query: 490 GVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           G+DIP +  VIN + P + + ++HR+GRT RAG SG A+++ +
Sbjct: 453 GLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGASGTAHTLFT 495

>ADL024C Chr4 complement(657270..658979) [1710 bp, 569 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL171W
           (ROK1)
          Length = 569

 Score =  140 bits (352), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 88/246 (35%), Positives = 146/246 (59%), Gaps = 15/246 (6%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSA-KI 203
           +L+N+    F +PTPIQ + IP+ LQ RDIV  A TGSGKT AF +P+++++    A   
Sbjct: 134 LLSNLIENNFTEPTPIQCEAIPISLQNRDIVACAPTGSGKTLAFLIPLLQQVISDKAVGT 193

Query: 204 GVRAVILSPSRELAMQTY--------KVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNP 255
           GV+ +I+SP++ELA Q +        ++F E  R   +  +  +    L+ Q  +     
Sbjct: 194 GVKGLIISPTKELANQIFDECSKLAQRIFLEKKRPLSVALLSKSLAAKLKNQI-VSDKKY 252

Query: 256 DVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALP-PTRQTLL 314
           D++I+TP R + +    +LDL  V+Y++FDEAD+LF+  F EQ +++L+A   P    +L
Sbjct: 253 DIIISTPLRLIDIVKSESLDLSAVKYLIFDEADKLFDKTFVEQTDDILSACSHPNISKVL 312

Query: 315 FSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLE--MLFLTTKNGEREANLLYLLQE- 371
           FSATLP S+ + A++ +T+PV V +  +   + N+E  ++F   + G+  A +  L+QE 
Sbjct: 313 FSATLPSSVEELAQSIMTDPVRVIIGHKEAANTNIEQKLVFCGNEEGKLVA-IRQLIQEG 371

Query: 372 VIRIPV 377
           + R PV
Sbjct: 372 MFRPPV 377

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 78/163 (47%), Gaps = 16/163 (9%)

Query: 454 VSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSLPSSSKIFIH 513
           V  I+    Q  R++ +  F+SG    L+ TDV ARG+D   +  VIN+ +P S++ ++H
Sbjct: 401 VDVIHAERTQVQREKIIERFKSGDLWCLICTDVLARGIDFKGINLVINYDVPRSAQAYVH 460

Query: 514 RVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYDATCELMRKQWVAE--- 570
           R+GRT R G  G A +  +                K ++  M  + CE+    W+     
Sbjct: 461 RIGRTGRGGRKGTAVTFFTKQDAIAV---------KPIVNVMKQSGCEVA--AWMENIAK 509

Query: 571 -GKQESEFVAPRVSYTNRMVLGSCPRLEMESMGDLYKNLVESS 612
             K+E E +    ++ +R  + + P++ ++      K ++E+S
Sbjct: 510 MTKREKEMIKKGKAFVDRKQISTVPKI-LKQKKRQQKEMIEAS 551

>KLTH0H04466g Chr8 (399689..401350) [1662 bp, 553 aa] {ON} similar
           to uniprot|P20447 Saccharomyces cerevisiae YGL078C DBP3
           Putative ATP-dependent RNA helicase of the DEAD-box
           family involved in ribosomal biogenesis
          Length = 553

 Score =  139 bits (351), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 117/197 (59%), Gaps = 3/197 (1%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKI-GVRAVILSP 212
           F +PTPIQ  + P +L  +D+VG+A TGSGKT AF +P I  LK   AK  GV+ +++SP
Sbjct: 161 FPKPTPIQAVSWPYLLSGKDVVGVAETGSGKTFAFGVPAIHNLKTADAKSQGVQVLVISP 220

Query: 213 SRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEM 272
           +RELA Q Y      ++ + +    + GG   +EQ   +  +  VV+ATPGR L L  E 
Sbjct: 221 TRELASQIYDNLILLTKKAGVNCCCVYGGVPKDEQRSQLKKS-QVVVATPGRLLDLIEEG 279

Query: 273 NLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAGL 331
           +  L  V+Y+V DEADR+ E GF+E +  ++ +   T RQTL+F+AT P  + + A   +
Sbjct: 280 SARLSNVKYLVLDEADRMLEKGFEEDIKRIIGSTKATGRQTLMFTATWPKEVRELANTFM 339

Query: 332 TNPVLVRLDAESKVSEN 348
            +PV + +    ++S N
Sbjct: 340 DSPVKISIGNRDELSAN 356

 Score = 90.1 bits (222), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 67/102 (65%)

Query: 431 ILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARG 490
           ++F   +     V + LK +GY V+ I+G L Q  R Q L  F+SG +++L+ TDVAARG
Sbjct: 393 LIFALYKKEAARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFKSGESNMLLATDVAARG 452

Query: 491 VDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           +DIP +  VIN + P + + ++HR+GRT RAG +G A+++ +
Sbjct: 453 LDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGLTGTAHTLFT 494

>NCAS0A14060 Chr1 (2765451..2766983) [1533 bp, 510 aa] {ON}
           Anc_7.336
          Length = 510

 Score =  138 bits (348), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 72/195 (36%), Positives = 115/195 (58%), Gaps = 2/195 (1%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  I   GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAF +P +EK+K    KI 
Sbjct: 54  LLMGIFEAGFEKPSPIQEESIPIAITGRDILARAKNGTGKTAAFVIPTLEKIKPKLNKI- 112

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A+I+ P+RELA+QT +V +   +   +  ++ TGG +L +    +  +  V++ TPGR
Sbjct: 113 -QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNESVHVLVGTPGR 171

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
            L L      DL   +  + DEAD++    F+  + ++L  LP   Q+LLFSAT P ++ 
Sbjct: 172 VLDLASRKVADLSDCQLFIMDEADKMLSRDFKTIIEQILIFLPKKHQSLLFSATFPLTVK 231

Query: 325 DFAKAGLTNPVLVRL 339
           +F    LTNP  + L
Sbjct: 232 EFMVKHLTNPYEINL 246

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 59/102 (57%)

Query: 431 ILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARG 490
           I+F  + + VE +++ + D GY   Y +  + Q  R +    FR G    LV +D+  RG
Sbjct: 284 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 343

Query: 491 VDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           +DI  +  VINF  P +S+ ++HR+GR+ R G+ G A ++++
Sbjct: 344 IDIQAVNVVINFDFPKTSETYLHRIGRSGRFGHLGLAINLIN 385

>TDEL0F01090 Chr6 (196968..198623) [1656 bp, 551 aa] {ON} Anc_8.124
           YGL171W
          Length = 551

 Score =  138 bits (348), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 111/389 (28%), Positives = 185/389 (47%), Gaps = 82/389 (21%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL--KGHSAK 202
           +LNN+    F +PTPIQ + IPL L  RDIV  A TGSGKT AF +P+++ +   G  + 
Sbjct: 126 LLNNLIENHFTEPTPIQSEGIPLALNNRDIVACAPTGSGKTLAFLIPLLQLIISDGKDSN 185

Query: 203 IGVRAVILSPSRELAMQTY--------KVFKEFSRGSDLRSVLLTGGDSLEEQF---GMM 251
            G++ +I+SP++ELA Q +        KVF    R   L+  LL+   SL  +     + 
Sbjct: 186 -GLKGLIISPTKELANQIFIECSKLAQKVF--LDRKRPLQVALLSK--SLNAKLKNKAVS 240

Query: 252 MGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAAL--PPT 309
               D+++ TP R + +     LDL  V++++FDEAD+LF+  F EQ +++L++   P  
Sbjct: 241 DKKYDILVTTPLRLIDVVKNEALDLSGVKHIIFDEADKLFDKTFVEQTDDILSSCNNPKL 300

Query: 310 RQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLL 369
           R++ +FSAT+P ++ + A + + +PV V +  +   + N++   +    G  E  L+ + 
Sbjct: 301 RKS-MFSATIPSNVEEIANSIMMDPVRVIIGHKDAANANIKQDVIYC--GNEEGKLIAIR 357

Query: 370 QEV----IRIPVAT-AEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANEL 424
           Q V     R PV    E + + +AL                                   
Sbjct: 358 QLVQEGEFRPPVIIFLESITRAKALY---------------------------------- 383

Query: 425 PSEKATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVT 484
                        H + Y        G  V  I+    Q  R++ + +F+SG    L+ T
Sbjct: 384 -------------HELMY-------DGLNVDVIHAERTQIQREKIIESFKSGELWCLICT 423

Query: 485 DVAARGVDIPMLANVINFSLPSSSKIFIH 513
           DV ARGVD   +  VIN+ +P +++ ++H
Sbjct: 424 DVLARGVDFKGVNLVINYDVPRTAQAYVH 452

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 49/88 (55%)

Query: 430 TILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAAR 489
            I+F+ +    + +   L   G  V  I+    Q  R++ + +F+SG    L+ TDV AR
Sbjct: 369 VIIFLESITRAKALYHELMYDGLNVDVIHAERTQIQREKIIESFKSGELWCLICTDVLAR 428

Query: 490 GVDIPMLANVINFSLPSSSKIFIHRVGR 517
           GVD   +  VIN+ +P +++ ++HR+GR
Sbjct: 429 GVDFKGVNLVINYDVPRTAQAYVHRIGR 456

>Kpol_1072.50 s1072 complement(115009..116961) [1953 bp, 650 aa]
           {ON} complement(115009..116961) [1953 nt, 651 aa]
          Length = 650

 Score =  139 bits (351), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 79/242 (32%), Positives = 134/242 (55%), Gaps = 17/242 (7%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEK--------- 195
           +L NI    F +PTP+Q+ ++P++ + RD++  A+TGSGKT  F  P++ +         
Sbjct: 171 LLENIILARFTKPTPVQKYSVPIVSRGRDLMACAQTGSGKTGGFLFPVLSESFKNGPSPM 230

Query: 196 ----LKGHSAKIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMM 251
                K    K    A++L+P+RELA Q Y   K+F+  S +R  ++ GG  +  Q   +
Sbjct: 231 PESARKSFVKKAYPTALVLAPTRELATQIYDEAKKFTYRSWVRPTVVYGGSDIGSQIRDL 290

Query: 252 MGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELL--AALPPT 309
               D+++ATPGR   L     + L  V+Y+V DEADR+ +MGF+ Q+ +++    +PP 
Sbjct: 291 SRGCDLLVATPGRLSDLLERGRVSLANVKYLVLDEADRMLDMGFEPQIRQIVDGCDMPPV 350

Query: 310 --RQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLY 367
             RQTL+FSAT P  +   A+  L++ + + +      SEN+    L  ++ ++++ LL 
Sbjct: 351 GERQTLMFSATFPDDIQHLARDFLSDYIFLSVGKVGSTSENITQRILYVEDMDKKSTLLD 410

Query: 368 LL 369
           LL
Sbjct: 411 LL 412

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 64/98 (65%)

Query: 430 TILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAAR 489
           T++FV T+   + ++  L    +  + I+G   Q+ R++ L  F++G  ++LV T VAAR
Sbjct: 420 TLIFVETKRMADELTDFLIMQDFRATAIHGDRTQSERERALAAFKNGNANLLVATAVAAR 479

Query: 490 GVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWA 527
           G+DIP + +V+N+ LPS    ++HR+GRT RAGN+G A
Sbjct: 480 GLDIPNVTHVVNYDLPSDIDDYVHRIGRTGRAGNTGVA 517

>YDL160C Chr4 complement(170410..171930) [1521 bp, 506 aa] {ON}
           DHH1Cytoplasmic DExD/H-box helicase, stimulates mRNA
           decapping; coordinates distinct steps in mRNA function
           and decay, interacts with both the decapping and
           deadenylase complexes, may have a role in mRNA export
           and translation; C-terminus of Dhh1p interacts with
           Ngr1p and promotes POR1, but not EDC1 mRNA decay
          Length = 506

 Score =  137 bits (345), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 114/198 (57%), Gaps = 2/198 (1%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  I   GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAF +P +EK+K    KI 
Sbjct: 57  LLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKVKPKLNKI- 115

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A+I+ P+RELA+QT +V +   +   +  ++ TGG +L +    +     +++ TPGR
Sbjct: 116 -QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNETVHILVGTPGR 174

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
            L L      DL      + DEAD++    F+  + ++L+ LPPT Q+LLFSAT P ++ 
Sbjct: 175 VLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQSLLFSATFPLTVK 234

Query: 325 DFAKAGLTNPVLVRLDAE 342
           +F    L  P  + L  E
Sbjct: 235 EFMVKHLHKPYEINLMEE 252

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 59/102 (57%)

Query: 431 ILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARG 490
           I+F  + + VE +++ + D GY   Y +  + Q  R +    FR G    LV +D+  RG
Sbjct: 287 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 346

Query: 491 VDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 347 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 388

>Suva_4.86 Chr4 complement(158173..159699) [1527 bp, 508 aa] {ON}
           YDL160C (REAL)
          Length = 508

 Score =  137 bits (345), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 73/198 (36%), Positives = 114/198 (57%), Gaps = 2/198 (1%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  I   GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAF +P +EK+K    KI 
Sbjct: 57  LLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKVKPKLNKI- 115

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A+I+ P+RELA+QT +V +   +   +  ++ TGG +L +    +     V++ TPGR
Sbjct: 116 -QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNETVHVLVGTPGR 174

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
            L L      DL      + DEAD++    F+  + ++L+ LPPT Q+LLFSAT P ++ 
Sbjct: 175 VLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQSLLFSATFPLTVK 234

Query: 325 DFAKAGLTNPVLVRLDAE 342
           +F    L  P  + L  E
Sbjct: 235 EFMVKHLHKPYEINLMEE 252

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 59/102 (57%)

Query: 431 ILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARG 490
           I+F  + + VE +++ + D GY   Y +  + Q  R +    FR G    LV +D+  RG
Sbjct: 287 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 346

Query: 491 VDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 347 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 388

>KAFR0H02820 Chr8 (537121..538956) [1836 bp, 611 aa] {ON} Anc_8.614
           YOR204W
          Length = 611

 Score =  139 bits (349), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 79/242 (32%), Positives = 135/242 (55%), Gaps = 17/242 (7%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMI----------- 193
           +L NI    F +PTP+Q+ +IP++ + RD++G A+TGSGKT  F  P++           
Sbjct: 148 LLENIKLARFTKPTPVQKYSIPIVSKNRDLMGCAQTGSGKTGGFLFPILSEMFINGPLNV 207

Query: 194 -EKLKGHSAKIGV-RAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMM 251
            +K + H  + G   A++L+P+RELA Q ++  ++F+  S +R  ++ GG  +  Q   +
Sbjct: 208 PDKSRNHYMRKGYPTALVLAPTRELATQIFEESRKFTYRSWVRPCVVYGGAPIGNQMREL 267

Query: 252 MGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELL--AALPPT 309
               D+++ATPGR   L     + L  V Y++ DEADR+ +MGF+ Q+  ++    +P  
Sbjct: 268 DRGCDLLVATPGRLNDLLERGKISLMNVRYLILDEADRMLDMGFEPQIRHIVEDCDMPEV 327

Query: 310 --RQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLY 367
             RQTL+FSAT P  +   A+  L N V + +      SEN+    +  ++ ++++ LL 
Sbjct: 328 QDRQTLMFSATFPRDIQHLARDFLKNYVFLSVGRVGSTSENITQKIIMVEDMDKKSALLD 387

Query: 368 LL 369
           LL
Sbjct: 388 LL 389

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 64/106 (60%)

Query: 427 EKATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDV 486
           E  T++FV T+   + ++  L    +  + I+G   Q  R++ L  F++G   ILV T V
Sbjct: 394 EGLTLIFVETKRMADQLTDFLIMQNFNATAIHGDRTQEERERALGAFKAGRADILVATAV 453

Query: 487 AARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           AARG+DIP +  VINF LPS    ++HR+GRT RAGN+G A S  +
Sbjct: 454 AARGLDIPNVTLVINFDLPSDIDDYVHRIGRTGRAGNTGVAISFFN 499

>TPHA0L00960 Chr12 complement(194538..196568) [2031 bp, 676 aa] {ON}
           Anc_8.402 YDR194C
          Length = 676

 Score =  139 bits (351), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 122/412 (29%), Positives = 193/412 (46%), Gaps = 77/412 (18%)

Query: 145 ILNN-----ISRKGFRQPTPIQRKTIPLILQTR--DIVGMARTGSGKTAAFTLPMIEKL- 196
           ILN+     ++  GF   TP+Q+KTI  IL+    D++  A+TG+GKT AF LP++E L 
Sbjct: 139 ILNDDLYEAVNAMGFPSLTPVQQKTIKPILENDKVDVITRAKTGTGKTFAFLLPIMEHLM 198

Query: 197 -KGHSAKIGVRAVILSPSRELAMQTYKVFKE-FSRGSDLR---SVLLTGGDSLEEQFGMM 251
               +    VR+VI++P+R+LA+Q  +  ++ +S+  +LR   S+ L GG        ++
Sbjct: 199 RSNVAGSDSVRSVIVAPTRDLALQIEEELRKIYSKNRELRKFGSLSLVGGTDYRRAIRIL 258

Query: 252 MG-NPDVVIATPGRFLHLKVEMNLD-LKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT 309
           +   P +VI TPGR +    E      K V++ V DEADRL E+GF+  L  + + L   
Sbjct: 259 LDKQPSIVIGTPGRLIQTLDEYGEQCFKDVDFKVLDEADRLLEIGFKTDLEYISSTLNKL 318

Query: 310 R-------QTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESK----VSENLEMLFLTTKN 358
                   +TLLFSATL   +   A   +     + LD   K      EN++   + T  
Sbjct: 319 NSKGEAHIRTLLFSATLDDKVQILANDIMNKDECLFLDTVDKNAPEAHENIDQSVVMT-- 376

Query: 359 GEREANLLYLLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXM 418
            +  A+ L+          AT + +K                                  
Sbjct: 377 -DSYADSLF----------ATIQHIKN--------------------------------- 392

Query: 419 PSANELPSEKATILFVPTRHHVEYV-SQLLKDSG--YLVSYIYGTLDQNARKQQLFNFRS 475
              +  P  KA ILF PT     Y+ ++L K  G  + +   +G + Q  R   + +F+ 
Sbjct: 393 -KVDTEPEYKA-ILFSPTVKLTTYICNRLYKVFGRSFPILEFHGKISQARRTYLVKDFKK 450

Query: 476 GLTSILVVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWA 527
             + +LV TDV ARG+D P +  V+   +P+    ++HR+GRTARAG  G +
Sbjct: 451 IKSGLLVCTDVGARGMDFPNVGEVLQLGVPTELANYVHRIGRTARAGKEGAS 502

>KNAG0F02050 Chr6 (392126..393727) [1602 bp, 533 aa] {ON} Anc_6.204
           YGL078C
          Length = 533

 Score =  137 bits (345), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 114/197 (57%), Gaps = 3/197 (1%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKI-GVRAVILSP 212
           F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P +  +   S  + G++A+I+SP
Sbjct: 141 FPKPTPIQSVSWPYLLSGKDVIGVAETGSGKTLAFGVPAVNHIIETSKTVSGIQALIISP 200

Query: 213 SRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEM 272
           +RELA Q Y      +    L    + GG   +EQ  M +    +V+ATPGR L L  E 
Sbjct: 201 TRELASQIYDNLIPLTDKVGLECCCVYGGVPKDEQ-RMKLRKCHIVVATPGRLLDLLQEG 259

Query: 273 NLDLKTVEYVVFDEADRLFEMGFQEQLNELL-AALPPTRQTLLFSATLPHSLVDFAKAGL 331
           +++L  V Y+V DEADR+ E GF+E +  ++    P  RQTL+F+AT P  + + A   +
Sbjct: 260 SVNLSKVNYLVLDEADRMLEKGFEEDIKNIIRETAPHGRQTLMFTATWPKEVRELAATFM 319

Query: 332 TNPVLVRLDAESKVSEN 348
             PV V +    ++S N
Sbjct: 320 NQPVKVSIGNRDELSAN 336

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 67/106 (63%)

Query: 427 EKATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDV 486
           ++  ++F   +     V + LK +GY V  I+G L Q  R   L  F++G +++L+ TDV
Sbjct: 369 DEKVLIFALYKKEAARVERNLKYNGYNVVAIHGDLTQQQRTHALNEFKTGSSNLLLATDV 428

Query: 487 AARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           AARG+DIP +  VIN + P + + ++HR+GRT RAG +G A+++ +
Sbjct: 429 AARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGVAHTLFT 474

>TPHA0B02850 Chr2 complement(650888..652774) [1887 bp, 628 aa] {ON}
           Anc_8.614 YOR204W
          Length = 628

 Score =  138 bits (348), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 82/242 (33%), Positives = 134/242 (55%), Gaps = 17/242 (7%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMI----------- 193
           +L NI    F +PTP+Q+ ++P++ Q RD++  A+TGSGKT  F  P++           
Sbjct: 166 LLENIHLARFTKPTPVQKYSVPIVAQGRDLMACAQTGSGKTGGFLFPVLSQSFKNGPAPV 225

Query: 194 -EKLKGHSAKIG-VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMM 251
            E LK    + G   A++L+P+RELA Q Y   K+F+  S +R V++ GG  +  Q   +
Sbjct: 226 PEDLKRSFLRKGNPTALVLAPTRELATQIYDEAKKFTYRSWVRPVVIYGGSDVGTQIREL 285

Query: 252 MGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELL--AALPP- 308
               D+++ATPGR   L     + L  V+Y+V DEADR+ +MGF+ Q+  ++    +P  
Sbjct: 286 ERGCDLLVATPGRLNDLLERGRVSLANVKYLVLDEADRMLDMGFEPQIRHIVDGCDMPDA 345

Query: 309 -TRQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLY 367
             RQTL+FSAT P  +   A+  L + + + +      SEN+    L  ++ ++++ LL 
Sbjct: 346 NNRQTLMFSATFPDDIQHLARDFLNDYIFLSVGRVGSTSENITQRILYVEDMDKKSALLD 405

Query: 368 LL 369
           LL
Sbjct: 406 LL 407

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 64/101 (63%)

Query: 430 TILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAAR 489
           T++FV T+   + ++  L    ++ + I+G   Q  R++ L  F+ G  ++LV T VAAR
Sbjct: 415 TLIFVETKRMADELTDFLIMQDFMATAIHGDRTQIERERALAAFKGGRANVLVATAVAAR 474

Query: 490 GVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSI 530
           G+DIP + +VIN+ LP+    ++HR+GRT RAGN+G A S 
Sbjct: 475 GLDIPNVTHVINYDLPTDIDDYVHRIGRTGRAGNTGVATSF 515

>NDAI0C02320 Chr3 (527244..529538) [2295 bp, 764 aa] {ON} Anc_5.241
          Length = 764

 Score =  139 bits (351), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 76/191 (39%), Positives = 123/191 (64%), Gaps = 4/191 (2%)

Query: 146 LNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL--KGHSAKI 203
           L  ++   F + T IQR++IP+ L+  D++G A+TGSGKT AF +P++EKL  +  +   
Sbjct: 53  LKGLNGAAFLKLTDIQRESIPISLKGYDVLGSAKTGSGKTLAFLIPILEKLYREKWTEFD 112

Query: 204 GVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPG 263
           G+ A+++SP+RELAMQ Y+V  +    + L + L+ GG  ++ +    +   +++I TPG
Sbjct: 113 GLGALVISPTRELAMQIYEVLLKIGTYTSLSAGLVIGGKDVKFE-SERLSKINILIGTPG 171

Query: 264 RFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHS 322
           R L HL   + L+   ++ +V DEADR  +MGF++ L+ +++ LP +RQTLLFSAT   S
Sbjct: 172 RILQHLDQAIALNTSNLQMLVLDEADRCLDMGFKKTLDAIVSNLPASRQTLLFSATQSQS 231

Query: 323 LVDFAKAGLTN 333
           L D A+  LT+
Sbjct: 232 LGDLARLSLTD 242

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 48/97 (49%), Gaps = 2/97 (2%)

Query: 431 ILFVPTRHHVEYVSQLLK--DSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAA 488
           I+F+ +   V +V +  +    G  + +++G   Q AR + L  F       L  TDV A
Sbjct: 295 IVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQKARTETLDKFSRAQQVCLFATDVVA 354

Query: 489 RGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSG 525
           RG+D P +  VI    P  +  +IHRVGR AR G  G
Sbjct: 355 RGIDFPSVDWVIQVDCPEDADTYIHRVGRAARYGKKG 391

>SAKL0F11088g Chr6 complement(866571..868064) [1494 bp, 497 aa] {ON}
           highly similar to uniprot|P39517 Saccharomyces
           cerevisiae YDL160C DHH1 Cytoplasmic DExD/H-box helicase
           stimulates mRNA decapping coordinates distinct steps in
           mRNA function and decay interacts with both the
           decapping and deadenylase complexes may have a role in
           mRNA export and translation
          Length = 497

 Score =  136 bits (343), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 112/195 (57%), Gaps = 2/195 (1%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  I   GF +P+PIQ + IP+ L  RDI+  A+ G+GKTAAF +P +EK+K    KI 
Sbjct: 40  LLMGIFEAGFEKPSPIQEEAIPIALAGRDILARAKNGTGKTAAFVIPTLEKIKPKVNKI- 98

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A+IL P+RELA+QT +V +   +   +  ++ TGG +L +    +     V++ TPGR
Sbjct: 99  -QALILVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDIMRLHEPVHVLVGTPGR 157

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
            L L      DL      V DEAD++    F+  + ++L+  P +RQ+LLFSAT P ++ 
Sbjct: 158 VLDLASRKVADLSECPLFVMDEADKMLSRDFKSIIEQILSFFPQSRQSLLFSATFPLTVK 217

Query: 325 DFAKAGLTNPVLVRL 339
           +F    L  P  + L
Sbjct: 218 EFMVNHLNKPYEINL 232

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 59/102 (57%)

Query: 431 ILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARG 490
           I+F  + + VE +++ + D GY   Y +  + Q  R +    FR G    LV +D+  RG
Sbjct: 270 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 329

Query: 491 VDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 330 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 371

>KLLA0D09504g Chr4 complement(801783..804095) [2313 bp, 770 aa] {ON}
           highly similar to uniprot|P20448 Saccharomyces
           cerevisiae YJL033W HCA4 Putative nucleolar DEAD box RNA
           helicase high-copy number suppression of a U14 snoRNA
           processing mutant suggests an involvement in 18S rRNA
           synthesis
          Length = 770

 Score =  139 bits (350), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 77/193 (39%), Positives = 120/193 (62%), Gaps = 8/193 (4%)

Query: 146 LNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL--KGHSAKI 203
           L  +    F + T IQR++IPL L+  D++G A+TGSGKT AF +P+IEKL  +  +   
Sbjct: 53  LKGLKEAAFIKLTEIQRESIPLSLKGHDVLGAAKTGSGKTLAFLIPVIEKLYREKWTDMD 112

Query: 204 GVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGD--SLEEQFGMMMGNPDVVIAT 261
           G+ A+I+SP+RELAMQ Y+V  +  + +   + L+ GG   + E++    +   +++I T
Sbjct: 113 GLGALIISPTRELAMQIYEVLSKIGKHTTFSAGLVIGGKDVTFEKE---RISRINILIGT 169

Query: 262 PGRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLP 320
           PGR L H+   +  +   ++ +V DEADR  +MGF+  L+ ++  LP +RQTLLFSAT  
Sbjct: 170 PGRILQHMDQAVGFNTSNLQLLVLDEADRCLDMGFKRTLDAIINNLPASRQTLLFSATQS 229

Query: 321 HSLVDFAKAGLTN 333
            SL D A+  LT+
Sbjct: 230 QSLDDLARLSLTD 242

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 47/97 (48%), Gaps = 2/97 (2%)

Query: 431 ILFVPTRHHVEYVSQLLK--DSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAA 488
           I+F+ +   V +V +  +    G  + +++G   Q AR + L  F       L  TDV A
Sbjct: 293 IVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQHVCLFSTDVVA 352

Query: 489 RGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSG 525
           RG+D P +  VI    P     +IHRVGR AR G  G
Sbjct: 353 RGIDFPSVDWVIQVDCPEDVDTYIHRVGRAARFGKEG 389

>Ecym_4165 Chr4 (350595..352571) [1977 bp, 658 aa] {ON} similar to
           Ashbya gossypii AGL112C
          Length = 658

 Score =  138 bits (348), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 117/407 (28%), Positives = 185/407 (45%), Gaps = 83/407 (20%)

Query: 149 ISRKGFRQPTPIQRKTI-PLILQTRDIVGMARTGSGKTAAFTLPMIEKL----KGHSAKI 203
           +  + F   TP+Q++TI P+++ + D+V  A+TG+GKT AF +PM ++L      +S K 
Sbjct: 130 VKMQNFESLTPVQQRTIKPILMTSNDVVARAKTGTGKTMAFLIPMFQRLFMTQNEYSDK- 188

Query: 204 GVRAVILSPSRELAMQT-YKVFKEFSRGSDLR---SVLLTGGDSLEEQFGMMMGN-PDVV 258
            V+ V+++P+R+LA Q  ++V K       LR   S+ L GG SL      M  + P +V
Sbjct: 189 -VKCVVVAPTRDLAEQIQFEVLKLQKANKALRKFSSICLIGGTSLVNSMRRMDRHAPSIV 247

Query: 259 IATPGRFLH-LKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQ------ 311
           IATPGR L  +    +     V++ V DEAD L ++GF+  L  + + L    Q      
Sbjct: 248 IATPGRLLDVMGNSGDKYFNAVDFKVLDEADTLLDIGFKADLQRISSTLNSLNQKGAEHI 307

Query: 312 -TLLFSATLPHSLVDFAKAGLTNPVLVRLD--------AESKVSENLEMLFLTTKNGERE 362
            TLLFSAT+  ++ + A   +     + +D        A  K+++NL +        E  
Sbjct: 308 RTLLFSATISSNVQELANNIMNGDTCLFIDTVHKDEPEAHEKITQNLIV-------SESY 360

Query: 363 ANLLYLLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSAN 422
           A+ L         PV T E+  + R                                   
Sbjct: 361 AHNLV-------APVETIEKHLKKRKF--------------------------------- 380

Query: 423 ELPSEKATILFVPTRHHVEYVSQLLKD--SGYLVSYIYGTLDQNARKQQLFNFRSGLTSI 480
                KA +   PT   VE+   LLK       +S  +G + Q  R + +  F++    +
Sbjct: 381 -----KAILFL-PTVKSVEFYGNLLKKLFRSLPISLFHGKVSQQRRSRLVKEFKASKHGL 434

Query: 481 LVVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWA 527
            + TDV ARG+D P + +V    +PS    ++HR+GRTAR G  G A
Sbjct: 435 FICTDVGARGMDFPEVDHVYQLGVPSGLSNYVHRIGRTARGGREGEA 481

>KLLA0F06941g Chr6 complement(665970..667862) [1893 bp, 630 aa] {ON}
           similar to uniprot|P53734 Saccharomyces cerevisiae
           YNR038W DBP6 Essential protein involved in ribosome
           biogenesis, putative ATP-dependent RNA helicase of the
           DEAD-box protein family
          Length = 630

 Score =  138 bits (347), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 118/414 (28%), Positives = 195/414 (47%), Gaps = 65/414 (15%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLI---------LQTR---DIVGMARTGSGKTAAFTLPM 192
           I +N S + F   T +  K +PL+         L TR   DI+  A TGSGKT A+++P+
Sbjct: 190 ITSNFSSETFPIQTILFDKVLPLLNSSFKANRKLFTRRVGDILVNASTGSGKTLAYSVPL 249

Query: 193 IEKLKGHSAKIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMM 252
           ++ L+  +    VRA+IL P++ L  Q Y    + S+G+ L   +    +SL+E+    +
Sbjct: 250 VQILRSRTVN-KVRAIILVPTKILIHQVYDCLSKLSQGTSLNVSMSKLENSLKEEHNKFL 308

Query: 253 GN-PDVVIATPGRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTR 310
            N PD++I TPGR + HL++E + DLKT++++V DEADRL    FQ     L   L   +
Sbjct: 309 YNSPDILIITPGRLVDHLQME-SFDLKTLKFLVLDEADRLLNQSFQNWNQVLFHHLTNDK 367

Query: 311 QT--------LLFSATLPHSLVDFAKAGLTNPVLVRLDAES--KVSENLEMLFLTTKNGE 360
           Q         ++FSATL  +        L NP +   D+     + + L+ L +     +
Sbjct: 368 QDKRPGNVIKMVFSATLTTNAEKLYNLYLHNPKIFLTDSVKLYSIPKKLQELNVNIPTAK 427

Query: 361 REANLLYLLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPS 420
                L LL+ +  I  + +   K L                                  
Sbjct: 428 SLFKPLLLLRIIHDIKSSASRNAKIL------------------------------VFVK 457

Query: 421 ANELPSEKATILFVPTRHHVEYVSQLLKDS-GYLVSYIYGTLDQNARKQQLFNFRSG--L 477
           +NE      ++L      H    S +++D     +S I+  + + + ++ +  F S    
Sbjct: 458 SNEASIRLESLL------HAMLGSGIIEDEYNMFLSSIHSNISKGSSRKLIQEFASSEQK 511

Query: 478 TSILVVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
            S+L+ TD+ ARG+DI  + +VIN+ LP SS+ ++HR GRTARA   G A +++
Sbjct: 512 KSVLISTDIMARGIDINEITHVINYDLPISSQQYVHRCGRTARANTEGIAINLL 565

>Kpol_2001.67 s2001 (185153..186607) [1455 bp, 484 aa] {ON}
           (185153..186607) [1455 nt, 485 aa]
          Length = 484

 Score =  135 bits (341), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 111/195 (56%), Gaps = 2/195 (1%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  I   GF +P+PIQ ++IP+ L  RDI+  A+ G+GKTAAF +P +EK+K    KI 
Sbjct: 45  LLMGIFEAGFEKPSPIQEESIPVALAGRDILARAKNGTGKTAAFVIPTLEKVKSKHNKI- 103

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A+I+ P+RELA+QT +V +   +   +  ++ TGG +L +    +     +++ TPGR
Sbjct: 104 -QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNETVHILVGTPGR 162

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
            L L      DL      + DEAD++    F+  + ++L  LP   Q+LLFSAT P S+ 
Sbjct: 163 VLDLASRKVADLSECNLFIMDEADKMLSRDFKSIIEQILVFLPKNHQSLLFSATFPLSVK 222

Query: 325 DFAKAGLTNPVLVRL 339
           +F    L  P  + L
Sbjct: 223 EFMVNHLHKPYEINL 237

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 59/102 (57%)

Query: 431 ILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARG 490
           I+F  + + VE +++ + D GY   Y +  + Q  R +    FR G    LV +D+  RG
Sbjct: 275 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 334

Query: 491 VDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 335 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 376

>CAGL0J01045g Chr10 (101282..103579) [2298 bp, 765 aa] {ON} highly
           similar to uniprot|P20448 Saccharomyces cerevisiae
           YJL033w HCA4
          Length = 765

 Score =  139 bits (349), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 76/191 (39%), Positives = 116/191 (60%), Gaps = 4/191 (2%)

Query: 146 LNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL--KGHSAKI 203
           L  ++   F + T IQR +I   LQ  D+ G A+TGSGKT AF +P++EKL  +  +   
Sbjct: 53  LKGLNEASFIKMTDIQRDSIVTSLQGHDVFGTAKTGSGKTLAFLVPVLEKLYRERWTEFD 112

Query: 204 GVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPG 263
           G+ A+I+SP+RELAMQ Y+V  +    +   + L+ GG  +  +   +    +++I TPG
Sbjct: 113 GLGALIISPTRELAMQIYEVLVKIGSHTQFSAGLVIGGKDVNFELERI-AKINILIGTPG 171

Query: 264 RFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHS 322
           R L H+   + L+   ++ +V DEADR  +MGFQ+ L+ ++  LPP RQTLLFSAT   S
Sbjct: 172 RILQHMDQAVGLNTSNLQMLVLDEADRCLDMGFQKTLDAIVGNLPPDRQTLLFSATQSQS 231

Query: 323 LVDFAKAGLTN 333
           + D A+  LT+
Sbjct: 232 ISDLARLSLTD 242

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 50/104 (48%), Gaps = 2/104 (1%)

Query: 431 ILFVPTRHHVEYVSQLLK--DSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAA 488
           I+F  +   V +V +  +    G  + +++G   Q AR + L  F       L  TDV A
Sbjct: 291 IVFFSSSKQVHFVYETFRKMQPGISLLHLHGRQKQRARTETLDKFFRAQQVCLFATDVVA 350

Query: 489 RGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           RG+D P +  VI    P     +IHRVGR AR G  G +  I++
Sbjct: 351 RGIDFPAVDWVIQVDCPEDVDTYIHRVGRAARYGKKGRSLIILT 394

>Skud_16.161 Chr16 complement(295968..297827) [1860 bp, 619 aa] {ON}
           YPL119C (REAL)
          Length = 619

 Score =  137 bits (345), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 80/242 (33%), Positives = 135/242 (55%), Gaps = 17/242 (7%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL-------- 196
           ++ NI   GF +PTP+Q+ +IP++ + RD++  A+TGSGKT  F  P+  +L        
Sbjct: 165 LMENIKLAGFNKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTELFQIGPSSV 224

Query: 197 --KGHS--AKIGV-RAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMM 251
             K HS  ++ G   A++L+P+RELA Q ++  ++F+  S +R  ++ GG  +  Q   +
Sbjct: 225 PEKAHSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGAPIGNQMREV 284

Query: 252 MGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELL--AALPP- 308
               D+++ATPGR   L     + L   +Y+V DEADR+ +MGF+ Q+  ++    +P  
Sbjct: 285 DRGCDLLVATPGRLNDLLERGKISLANTKYLVLDEADRMLDMGFEPQIRHIVEECDMPSV 344

Query: 309 -TRQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLY 367
             RQTL+FSAT P  +   A+  L N + + +      SEN+    L   + ++++ LL 
Sbjct: 345 GNRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVGSTSENITQRILYVDDMDKKSALLD 404

Query: 368 LL 369
           LL
Sbjct: 405 LL 406

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 64/103 (62%)

Query: 430 TILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAAR 489
           T++FV T+   + ++  L    +  + I+G   Q  R++ L  F++ +  ILV T VAAR
Sbjct: 414 TLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALSAFKANIADILVATAVAAR 473

Query: 490 GVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           G+DIP + +VIN+ LPS    ++HR+GRT RAGN+G A S  +
Sbjct: 474 GLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATSFFN 516

>Suva_2.362 Chr2 complement(636909..638903) [1995 bp, 664 aa] {ON}
           YDR194C (REAL)
          Length = 664

 Score =  137 bits (345), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 116/406 (28%), Positives = 184/406 (45%), Gaps = 77/406 (18%)

Query: 149 ISRKGFRQPTPIQRKTIPLILQT--RDIVGMARTGSGKTAAFTLPMIEKLKGH--SAKIG 204
           I+R  F   TP+Q+KTI  IL +   D++  A+TG+GKT AF +P+ + L      ++  
Sbjct: 121 ITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKLDSQYM 180

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLR-------SVLLTGGDSLEEQFGMMMG-NPD 256
           V+AVI++P+R+LA+Q   +  E  +  D+         V L GG         M    P+
Sbjct: 181 VKAVIVAPTRDLALQ---IEAEVKKIHDMNYGLKKYGCVSLVGGTDFRGAMDKMNKLRPN 237

Query: 257 VVIATPGRFLH-LKVEMNLDLKTVEYVVFDEADRLFEMGFQEQ-------LNELLAALPP 308
           ++IATPGR +  L+   N   + V+Y V DEADRL E+GF++        LNE  +    
Sbjct: 238 IIIATPGRLIDVLERYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSTD 297

Query: 309 TRQTLLFSATLPHSLVDFAKAGLTNPVLVRLDA----ESKVSENLEMLFLTTKNGEREAN 364
             +TLLFSATL   +   A   +     + LD     E +  E ++   + +K   + A+
Sbjct: 298 NIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISK---KFAD 354

Query: 365 LLYLLQEVIRIPVATAEQLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANEL 424
            ++          A  E +K+                                     E 
Sbjct: 355 NIF----------AAVEHIKK----------------------------------QITER 370

Query: 425 PSEKATILFVPTRHHVEYVSQLLKDS---GYLVSYIYGTLDQNARKQQLFNFRSGLTSIL 481
            S    I+F PT     ++  +L++       +   +G + QN R   +  F+   + IL
Sbjct: 371 ESNYKAIIFAPTVKFTSFLCGILQNEFKKKLPILEFHGKITQNKRTSLVKRFKKEESGIL 430

Query: 482 VVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWA 527
           V TDV ARG+D P +  V+   +PS    +IHR+GRTAR+G  G +
Sbjct: 431 VCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGAS 476

>TBLA0C00640 Chr3 (129301..131040) [1740 bp, 579 aa] {ON} Anc_8.124
           YGL171W
          Length = 579

 Score =  136 bits (343), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 76/224 (33%), Positives = 133/224 (59%), Gaps = 8/224 (3%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +LNN+    F +PTPIQ + IP+ L  RDIV  A TGSGKT AF +P+++++      +G
Sbjct: 140 LLNNLIDNHFTEPTPIQSEAIPIALLDRDIVACAPTGSGKTMAFLIPLLQQIIDEKKVVG 199

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRG------SDLRSVLLTGGDSLEEQFGMMMGNP-DV 257
           ++ +I+SP++ELA Q +    + SR         L+  LL+   S + +  ++  +  D+
Sbjct: 200 LKGLIISPTKELANQIFLECVKLSRSIFFEKKRPLQVALLSKSLSAKLKNKVISNSKYDI 259

Query: 258 VIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALP-PTRQTLLFS 316
           +I+TP R + +    +LDL  V++++FDEAD+LF+  F EQ +++L++   P  +  +FS
Sbjct: 260 IISTPLRLIDVVRNESLDLSKVKHLIFDEADKLFDKTFVEQTDDILSSCTDPALRKSMFS 319

Query: 317 ATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGE 360
           AT+P S+ D A++ + +PV V +  +   + N+E   +   N E
Sbjct: 320 ATIPSSVEDIAQSLMNDPVRVVIGHKEAANSNIEQKLIFCGNEE 363

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 70/144 (48%), Gaps = 9/144 (6%)

Query: 454 VSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSLPSSSKIFIH 513
           V  I+       R + +  F+SG    L+ TDV ARGVD   +  VIN+ +P SS+ ++H
Sbjct: 406 VDVIHAERTTIQRNKIIERFKSGELWCLICTDVLARGVDFKGVNLVINYDVPRSSQAYVH 465

Query: 514 RVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYDATCELMRKQWVAEGKQ 573
           R+GRT RAG  G A ++ +                K ++  M  + CE+         K+
Sbjct: 466 RIGRTGRAGRKGKAITLYTKQDALAV---------KPIINVMKQSGCEVAEWMDTKLTKR 516

Query: 574 ESEFVAPRVSYTNRMVLGSCPRLE 597
           E E +    ++ +R+ + + P+++
Sbjct: 517 EKESIKKGKAHKDRLQISTVPKVD 540

>ZYRO0F11440g Chr6 (939613..941184) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q75BS4 Ashbya gossypii ACR197W DHH1
           ATP-dependent RNA helicase DHH1 and similar to YDL160C
           uniprot|P39517 Saccharomyces cerevisiae YDL160C DHH1
           Cytoplasmic DExD/H-box helicase stimulates mRNA
           decapping coordinates distinct steps in mRNA function
           and decay interacts with both the decapping and
           deadenylase complexes may have a role in mRNA export and
           translation
          Length = 523

 Score =  135 bits (341), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 113/198 (57%), Gaps = 2/198 (1%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  I   GF +P+PIQ ++IP+ L  RDI+  A+ G+GKTAAF +P +EK+K    KI 
Sbjct: 41  LLMGIFEAGFEKPSPIQEESIPVALAGRDILARAKNGTGKTAAFVIPTLEKVKPKINKI- 99

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A+I+ P+RELA+QT +V +   +   +  ++ TGG +L +    +     V++ TPGR
Sbjct: 100 -QALIMVPTRELALQTSQVVRTLGKHCGVSCMVTTGGTNLRDDILRLNETVHVLVGTPGR 158

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
            L L      DL      V DEAD++    F+  + ++L  LPP  Q+LLFSAT P ++ 
Sbjct: 159 VLDLASRKVADLSECSLFVMDEADKMLSRDFKTIIEQILIFLPPQHQSLLFSATFPITVK 218

Query: 325 DFAKAGLTNPVLVRLDAE 342
           +F    L  P  + L  E
Sbjct: 219 EFMVKHLHKPYEINLMEE 236

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 59/102 (57%)

Query: 431 ILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARG 490
           I+F  + + VE +++ + D GY   Y +  + Q  R +    FR G    LV +D+  RG
Sbjct: 271 IIFCNSTNRVELLAKKITDLGYSCYYSHARMRQQERNKVFHEFRQGKVRTLVCSDLLTRG 330

Query: 491 VDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 331 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 372

>KLLA0A09669g Chr1 complement(847036..848529) [1494 bp, 497 aa] {ON}
           highly similar to uniprot|Q03532 Saccharomyces
           cerevisiae YMR290C HAS1 ATP-dependent RNA helicase
           localizes to both the nuclear periphery and nucleolus
           highly enriched in nuclear pore complex fractions
          Length = 497

 Score =  135 bits (339), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 80/234 (34%), Positives = 135/234 (57%), Gaps = 11/234 (4%)

Query: 146 LNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKI-- 203
           +  I + GF Q T +Q +TIP +L  +D++G A+TGSGKT AF +P IE L  HS K   
Sbjct: 46  MKAIGKMGFTQMTAVQTRTIPPLLAGKDVLGAAKTGSGKTLAFLIPAIEML--HSLKFKP 103

Query: 204 --GVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIAT 261
             G   ++++P+RELA+Q + V +E          ++ GG +  ++   +M   +++IAT
Sbjct: 104 RNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEADKLMKGVNILIAT 163

Query: 262 PGRFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALP-PTRQTLLFSATL 319
           PGR L HL+       K ++ +V DEADR+ E+GF++++ +++  LP   RQ++LFSAT 
Sbjct: 164 PGRLLDHLQNTKGFIFKNLKALVIDEADRILEIGFEDEMRQIIKILPNEDRQSMLFSATQ 223

Query: 320 PHSLVDFAKAGL-TNPVLVRLDAESKVS--ENLEMLFLTTKNGEREANLLYLLQ 370
              + D A+  L   P+ + +D+E   S  + LE  ++  ++ +R   L   L+
Sbjct: 224 TTKVEDLARISLRPGPLFINVDSEKDTSTADGLEQGYVVCESDKRFLLLFSFLK 277

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 427 EKATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDV 486
           +K  I+F+ + + V+Y ++LL      V  ++G   Q  R    F F +    ILV TDV
Sbjct: 281 KKKVIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDV 340

Query: 487 AARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIV 531
           AARG+DIP +  +I F  P   + +IHRVGRTAR G  G   S++
Sbjct: 341 AARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 384

>Smik_6.318 Chr6 (498013..499854) [1842 bp, 613 aa] {ON} YPL119C
           (REAL)
          Length = 613

 Score =  136 bits (343), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 134/242 (55%), Gaps = 17/242 (7%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMI----------- 193
           ++ NI   GF +PTP+Q+ +IP++ + RD++  A+TGSGKT  F  P+            
Sbjct: 161 LMENIKLAGFNKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTELFRFGPSPV 220

Query: 194 -EKLKGHSAKIGV-RAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMM 251
            EK +   ++ G   A++L+P+RELA Q ++  ++F+  S +R  ++ GG  +  Q   +
Sbjct: 221 PEKTQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGAPIGNQMREV 280

Query: 252 MGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELL--AALPP- 308
               D+++ATPGR   L     + L  ++Y+V DEADR+ +MGF+ Q+  ++    +P  
Sbjct: 281 DRGCDLLVATPGRLNDLLERGKISLANIKYLVLDEADRMLDMGFEPQIRHIVEGCDMPSV 340

Query: 309 -TRQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLY 367
             RQTL+FSAT P  +   A+  L N + + +      SEN+    L   + ++++ LL 
Sbjct: 341 GNRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVGSTSENITQRILYVDDLDKKSALLD 400

Query: 368 LL 369
           LL
Sbjct: 401 LL 402

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 64/101 (63%)

Query: 430 TILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAAR 489
           T++FV T+   + ++  L    +  + I+G   Q  R++ LF F++ +  ILV T VAAR
Sbjct: 410 TLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALFAFKTNVADILVATAVAAR 469

Query: 490 GVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSI 530
           G+DIP + +VIN+ LPS    ++HR+GRT RAGN+G A S 
Sbjct: 470 GLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVASSF 510

>Smik_10.239 Chr10 (380101..382413) [2313 bp, 770 aa] {ON} YJL033W
           (REAL)
          Length = 770

 Score =  137 bits (346), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 118/191 (61%), Gaps = 4/191 (2%)

Query: 146 LNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL--KGHSAKI 203
           L  +    F + T IQ  +IP+ LQ  D++  A+TGSGKT AF +P+IEKL  +  +   
Sbjct: 53  LKGLRESSFIKLTEIQADSIPVSLQGHDVLAAAKTGSGKTLAFLIPVIEKLYREKWTEFD 112

Query: 204 GVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPG 263
           G+ A+I+SP+RELAMQ Y+V  +    +   + L+ GG  ++ +   +    +++I TPG
Sbjct: 113 GLGALIISPTRELAMQIYEVLTKIGSHTSFSAGLVIGGKDVKFELERV-SRINILIGTPG 171

Query: 264 RFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHS 322
           R L HL   + L+   ++ +V DEADR  +MGF++ L+ +++ L P+RQTLLFSAT   S
Sbjct: 172 RILQHLDQAVGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVSTLSPSRQTLLFSATQSQS 231

Query: 323 LVDFAKAGLTN 333
           + D A+  LT+
Sbjct: 232 VADLARLSLTD 242

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 47/97 (48%), Gaps = 2/97 (2%)

Query: 431 ILFVPTRHHVEYVSQLLK--DSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAA 488
           I+F+ +   V +V +  +    G  + +++G   Q AR + L  F       L  TDV A
Sbjct: 295 IVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFNRAQQVCLFATDVVA 354

Query: 489 RGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSG 525
           RG+D P +  V+    P     +IHRVGR AR G  G
Sbjct: 355 RGIDFPAVDWVVQVDCPEDVDTYIHRVGRCARYGKKG 391

>YGL171W Chr7 (182390..184084) [1695 bp, 564 aa] {ON}
           ROK1RNA-dependent ATPase; involved in pre-rRNA
           processing at sites A0, A1, and A2, and in control of
           cell cycle progression; contains two upstream open
           reading frames (uORFs) in 5' untranslated region which
           regulate translation
          Length = 564

 Score =  135 bits (341), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 80/244 (32%), Positives = 138/244 (56%), Gaps = 26/244 (10%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +LNN+   GF +PTPIQ + IP+ L  RD++    TGSGKT AF +P+++++       G
Sbjct: 133 LLNNLIENGFTEPTPIQCECIPVALNNRDVLACGPTGSGKTLAFLIPLVQQIIDDKQTAG 192

Query: 205 VRAVILSPSRELAMQ--------TYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNP- 255
           ++ +I+SP++ELA Q        +YK+F E  R   L+  LL+      +  G  + N  
Sbjct: 193 LKGLIISPTKELANQIFIECFKLSYKIFLEKKRP--LQVALLS------KSLGAKLKNKV 244

Query: 256 ------DVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAAL-PP 308
                 D++I+TP R + +     LDL  V++++FDEAD+LF+  F EQ +++L+A   P
Sbjct: 245 VSDKKYDIIISTPLRLIDVVKNEALDLSKVKHLIFDEADKLFDKTFVEQSDDILSACREP 304

Query: 309 TRQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYL 368
           + +  +FSAT+P ++ + A++ + +PV V +  +   + N+E   +    G  E  L+ +
Sbjct: 305 SLRKAMFSATIPSNVEEIAQSIMMDPVRVIIGHKEAANTNIEQKLIFC--GNEEGKLIAI 362

Query: 369 LQEV 372
            Q V
Sbjct: 363 RQLV 366

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 31/45 (68%)

Query: 473 FRSGLTSILVVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGR 517
           F++G    L+ TDV ARG+D   +  VIN+ +P SS+ ++HR+GR
Sbjct: 418 FKTGELWCLICTDVLARGIDFKGVNLVINYDVPGSSQAYVHRIGR 462

>YJL033W Chr10 (383837..386149) [2313 bp, 770 aa] {ON}  HCA4Putative
           nucleolar DEAD box RNA helicase; high-copy number
           suppression of a U14 snoRNA processing mutant suggests
           an involvement in 18S rRNA synthesis
          Length = 770

 Score =  137 bits (346), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 118/191 (61%), Gaps = 4/191 (2%)

Query: 146 LNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKL--KGHSAKI 203
           L  +    F + T IQ  +IP+ LQ  D++  A+TGSGKT AF +P+IEKL  +  +   
Sbjct: 53  LKGLRESSFIKLTEIQADSIPVSLQGHDVLAAAKTGSGKTLAFLVPVIEKLYREKWTEFD 112

Query: 204 GVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPG 263
           G+ A+I+SP+RELAMQ Y+V  +    +   + L+ GG  ++ +   +    +++I TPG
Sbjct: 113 GLGALIISPTRELAMQIYEVLTKIGSHTSFSAGLVIGGKDVKFELERI-SRINILIGTPG 171

Query: 264 RFL-HLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHS 322
           R L HL   + L+   ++ +V DEADR  +MGF++ L+ +++ L P+RQTLLFSAT   S
Sbjct: 172 RILQHLDQAVGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVSTLSPSRQTLLFSATQSQS 231

Query: 323 LVDFAKAGLTN 333
           + D A+  LT+
Sbjct: 232 VADLARLSLTD 242

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 47/97 (48%), Gaps = 2/97 (2%)

Query: 431 ILFVPTRHHVEYVSQLLK--DSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAA 488
           I+F+ +   V +V +  +    G  + +++G   Q AR + L  F       L  TDV A
Sbjct: 295 IVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFNRAQQVCLFATDVVA 354

Query: 489 RGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSG 525
           RG+D P +  V+    P     +IHRVGR AR G  G
Sbjct: 355 RGIDFPAVDWVVQVDCPEDVDTYIHRVGRCARYGKKG 391

>KLLA0C15499g Chr3 complement(1345201..1346715) [1515 bp, 504 aa]
           {ON} similar to uniprot|P20447 Saccharomyces cerevisiae
           YGL078C DBP3 Putative ATP-dependent RNA helicase of the
           DEAD-box family involved in ribosomal biogenesis
          Length = 504

 Score =  134 bits (338), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 76/197 (38%), Positives = 115/197 (58%), Gaps = 3/197 (1%)

Query: 154 FRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG-VRAVILSP 212
           F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I  +     K   V+ +++SP
Sbjct: 112 FPKPTPIQAVSWPYLLAGKDVIGIAETGSGKTFAFGVPAINNIVTSGDKSSSVKVLVISP 171

Query: 213 SRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEM 272
           +RELA Q Y      +    LRS  + GG   ++Q   +     VV+ATPGR L L  E 
Sbjct: 172 TRELASQIYDNLIVLTDACGLRSCCVYGGVPKDQQREDLR-RSQVVVATPGRLLDLIEEG 230

Query: 273 NLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-RQTLLFSATLPHSLVDFAKAGL 331
           ++DL  V Y+V DEADR+ E GF+E + +++     T RQTL+F+AT P  + + A + +
Sbjct: 231 SVDLSHVNYLVLDEADRMLEKGFEEDIKKIIRQTRSTSRQTLMFTATWPKEVRELASSFM 290

Query: 332 TNPVLVRLDAESKVSEN 348
           + PV V +    ++S N
Sbjct: 291 SEPVKVSIGNRDELSAN 307

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 65/103 (63%)

Query: 430 TILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAAR 489
            ++F   +     V + LK +GY V+ I+G L Q  R Q L  F++G  ++L+ TDVAAR
Sbjct: 343 VLIFALYKKEASRVERNLKYNGYDVAAIHGDLSQQQRTQALNEFKAGKCNLLLATDVAAR 402

Query: 490 GVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           G+DIP +  VIN + P + + ++HR+GRT RAG  G A+++ +
Sbjct: 403 GLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQYGTAHTLFT 445

>CAGL0L10021g Chr12 complement(1076197..1077711) [1515 bp, 504 aa]
           {ON} highly similar to uniprot|P20449 Saccharomyces
           cerevisiae YOR046c DBP5 RNA helicase
          Length = 504

 Score =  134 bits (338), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 104/396 (26%), Positives = 185/396 (46%), Gaps = 67/396 (16%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQT--RDIVGMARTGSGKTAAFTLPMIEKLKGHSAK 202
           +L  I    F++P+ IQ + +PL+L    R+++  +++G+GKTAAF+L M+ ++     +
Sbjct: 125 LLKGIYAMKFQKPSKIQERALPLLLSNPPRNMIAQSQSGTGKTAAFSLTMLSRV--DETQ 182

Query: 203 IGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATP 262
              +A+ L+PSRELA QT +V +E  + + + + L+   DS E+   +   N +VV+ TP
Sbjct: 183 NVPQAICLAPSRELARQTLEVIQEMGKYTKITTQLIVP-DSFEKNTKI---NANVVVGTP 238

Query: 263 GRFLHLKVEMNLDLKTVEYVVFDEADRLFE-MGFQEQLNELLAALPPTRQTLLFSATLPH 321
           G  L L     + L+ V+  V DEAD + +  G  +Q   +   LP   Q +LFSAT   
Sbjct: 239 GTLLDLIRRKLIQLQNVKIFVLDEADNMLDKQGLGDQCIRVKKFLPKDTQLVLFSATFAD 298

Query: 322 SLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAE 381
           ++  +A+  + N   + L       + ++ L++   +   +  +L  L  ++ I  +   
Sbjct: 299 AVKAYAQKVIPNANTLELQRNEVNVKAIKQLYMDCNDEAHKYEVLCELYGLLTIGSSIIF 358

Query: 382 QLKQLRALXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSANELPSEKATILFVPTRHHVE 441
             K+                                         + A +L+   +H   
Sbjct: 359 VAKK-----------------------------------------DTANLLYGKLKHEGH 377

Query: 442 YVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVIN 501
            VS L  D           L  + R + + +FR G + +L+ T+V ARG+DIP ++ V+N
Sbjct: 378 QVSILHSD-----------LRTDERDRLIDDFREGRSKVLITTNVLARGIDIPSVSMVVN 426

Query: 502 FSLPS------SSKIFIHRVGRTARAGNSGWAYSIV 531
           + LP+          ++HR+GRT R G +G A S V
Sbjct: 427 YDLPTLPNGMPDYATYVHRIGRTGRFGRTGVAISFV 462

>NCAS0B01730 Chr2 complement(286249..288105) [1857 bp, 618 aa] {ON}
           Anc_8.614
          Length = 618

 Score =  136 bits (342), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 80/243 (32%), Positives = 131/243 (53%), Gaps = 18/243 (7%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPM-----------I 193
           +L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F  P+           +
Sbjct: 156 LLENIKLARFTKPTPVQKYSVPIVAAGRDLMACAQTGSGKTGGFLFPVLSESFKTGPTVV 215

Query: 194 EKLKGHS---AKIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGM 250
           +  + H     K    AVI++P+RELA Q +   K+F   S ++  ++ GG  +  Q   
Sbjct: 216 DNAQSHGYYQKKAYPTAVIMAPTRELATQIFDEAKKFCYRSWVQPCVVYGGSPIGNQMRE 275

Query: 251 MMGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELL--AALPP 308
           M    D+++ATPGR   L     + L  V+Y+V DEADR+ +MGF+ Q+  ++  A + P
Sbjct: 276 MDRGCDLLVATPGRLSDLIDRGKISLSNVKYLVLDEADRMLDMGFEPQIRAIVEGADMTP 335

Query: 309 T--RQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLL 366
              RQTL+FSAT P  +   A+  L + + + +      SEN+    L  +N ++++ LL
Sbjct: 336 VGERQTLMFSATFPADIQHLARDFLADYIFLSVGRVGSTSENITQRVLYVENQDKKSALL 395

Query: 367 YLL 369
            LL
Sbjct: 396 DLL 398

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 62/98 (63%)

Query: 430 TILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAAR 489
           T++FV T+   + ++  L    +  + I+G   Q  R++ L  FRSG  ++LV T VAAR
Sbjct: 406 TLIFVETKRMADQLTDFLIMQDFRATAIHGDRTQQERERALAAFRSGRANLLVATAVAAR 465

Query: 490 GVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWA 527
           G+DIP + +VIN+ LP     ++HR+GRT RAGN+G A
Sbjct: 466 GLDIPNVTHVINYDLPGDIDDYVHRIGRTGRAGNTGVA 503

>Skud_15.370 Chr15 (661915..663744) [1830 bp, 609 aa] {ON} YOR204W
           (REAL)
          Length = 609

 Score =  136 bits (342), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 79/242 (32%), Positives = 132/242 (54%), Gaps = 17/242 (7%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMI-EKLKG----- 198
           +L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F  P++ E  K      
Sbjct: 157 LLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKTGPSPQ 216

Query: 199 -------HSAKIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMM 251
                  +  K    AVI++P+RELA Q +   K+F+  S +++ ++ GG  +  Q   +
Sbjct: 217 PESQGSFYQKKAYPTAVIMAPTRELATQIFDESKKFTYRSWVKACVVYGGSPIGNQLREI 276

Query: 252 MGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-- 309
               D+++ATPGR   L     + L  V+Y+V DEADR+ +MGF+ Q+  ++     T  
Sbjct: 277 ERGCDLLVATPGRLNDLLERGKISLSNVKYLVLDEADRMLDMGFEPQIRHIVEDCDMTPV 336

Query: 310 --RQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLY 367
             RQTL+FSAT P  +   A+  L++ + + +      SEN+    L  +N ++++ LL 
Sbjct: 337 GARQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVENQDKKSALLD 396

Query: 368 LL 369
           LL
Sbjct: 397 LL 398

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 64/98 (65%)

Query: 430 TILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAAR 489
           T++FV T+   + ++  L    +  + I+G   Q+ R++ L  FRSG  S+LV T VAAR
Sbjct: 406 TLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGTASLLVATAVAAR 465

Query: 490 GVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWA 527
           G+DIP + +VIN+ LPS    ++HR+GRT RAGN+G A
Sbjct: 466 GLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGVA 503

>KLTH0H01562g Chr8 complement(140915..142390) [1476 bp, 491 aa] {ON}
           similar to uniprot|P39517 Saccharomyces cerevisiae
           YDL160C DHH1 Cytoplasmic DExD/H-box helicase stimulates
           mRNA decapping coordinates distinct steps in mRNA
           function and decay interacts with both the decapping and
           deadenylase complexes may have a role in mRNA export and
           translation
          Length = 491

 Score =  134 bits (337), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 70/195 (35%), Positives = 111/195 (56%), Gaps = 2/195 (1%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  I   GF +P+PIQ + IP+ +  RD++  A+ G+GKTAAF +P +EK+K    KI 
Sbjct: 40  LLMGIFEAGFEKPSPIQEEAIPIAIAGRDVLARAKNGTGKTAAFVVPTLEKVKPKVNKI- 98

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A+I+ P+RELA+QT +V +   +   +  ++ TGG +L +    +     +++ TPGR
Sbjct: 99  -QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNEPVHILVGTPGR 157

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
            L L      DL      V DEAD++    F+  + ++L  LPP  Q+LLFSAT P ++ 
Sbjct: 158 VLDLASRKVADLSECPLFVMDEADKMLSRDFKAIIEQILTFLPPVHQSLLFSATFPLTVK 217

Query: 325 DFAKAGLTNPVLVRL 339
           +F    L  P  + L
Sbjct: 218 EFMVKHLHKPYEINL 232

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 75/158 (47%), Gaps = 5/158 (3%)

Query: 431 ILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARG 490
           I+F  + + VE +++ + D GY   Y +  + Q+ R +    FR G    LV +D+  RG
Sbjct: 270 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQSERNKVFHEFRQGKVRTLVCSDLLTRG 329

Query: 491 VDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSXXXXXXXXXXXXXXGKKI 550
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++              G +I
Sbjct: 330 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEI 389

Query: 551 LLAPMYDATCELMRKQWVAEGKQESEFVAPRVSYTNRM 588
              P      ++ +  +VAE         P  S  N M
Sbjct: 390 AAIP-----AQIDKSLYVAEDDSAVPVPFPLASLPNTM 422

>KNAG0C03820 Chr3 complement(748934..750475) [1542 bp, 513 aa] {ON}
           Anc_7.336 YDL160C
          Length = 513

 Score =  134 bits (337), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 113/198 (57%), Gaps = 2/198 (1%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +L  I   GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAF +P +EK+K    KI 
Sbjct: 45  LLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKVKPKLNKI- 103

Query: 205 VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264
            +A+I+ P+RELA+QT +V +   +   +  ++ TGG +L +    +     +++ TPGR
Sbjct: 104 -QALIMVPTRELALQTSQVVRSLGKHCGVSCMVTTGGTNLRDDILRLNDTIHILVGTPGR 162

Query: 265 FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324
            L L      DL      V DEAD++    F+  + ++LA LP   Q+LLFSAT P ++ 
Sbjct: 163 VLDLASRKIADLSECGLFVMDEADKMLSRDFKTIIEQILAFLPKNHQSLLFSATFPLTVK 222

Query: 325 DFAKAGLTNPVLVRLDAE 342
           +F +  L  P  + L  E
Sbjct: 223 EFMEKHLNKPYEINLMEE 240

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 59/102 (57%)

Query: 431 ILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARG 490
           I+F  + + VE +++ + D GY   Y +  + Q  R +    FR G    LV +D+  RG
Sbjct: 275 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 334

Query: 491 VDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 335 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 376

>Skud_7.100 Chr7 (187842..189518) [1677 bp, 558 aa] {ON} YGL171W
           (REAL)
          Length = 558

 Score =  135 bits (339), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 80/244 (32%), Positives = 138/244 (56%), Gaps = 26/244 (10%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204
           +LNN+   GF +PTPIQ + IP+ L  RDI+    TGSGKT AF +P+++++       G
Sbjct: 134 LLNNLVENGFTEPTPIQNECIPVALNNRDILACGPTGSGKTLAFLIPLVQQIIDDKHTSG 193

Query: 205 VRAVILSPSRELAMQ--------TYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNP- 255
           ++ +I+SP++ELA Q        ++K+F E  R   L+  LL+      +  G  + N  
Sbjct: 194 LKGLIISPTKELASQIFIECFKLSHKIFLEKKR--PLQVALLS------KSLGAKLKNKV 245

Query: 256 ------DVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALP-P 308
                 D++I+TP R + +  +  LDL  V++++FDEAD+LF+  F EQ +++L+A   P
Sbjct: 246 ISDKKYDIIISTPLRLIDVVKKEALDLSRVKHLIFDEADKLFDKTFVEQSDDILSACKEP 305

Query: 309 TRQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYL 368
             +  +FSAT+P S+ + A++ + +P+ V +  +   + N+E   +    G  E  L+ +
Sbjct: 306 ALRKAMFSATIPSSVEEIAQSIMMDPIRVIIGHKEAANTNIEQKLIFC--GNEEGKLIAI 363

Query: 369 LQEV 372
            Q V
Sbjct: 364 RQLV 367

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 65/127 (51%), Gaps = 15/127 (11%)

Query: 473 FRSGLTSILVVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVS 532
           F+SG    L+ TDV ARG+D   +  VIN+ +P SS+ ++HR+GRT RAG SG A +  +
Sbjct: 419 FKSGELWCLICTDVLARGIDFKGVNLVINYDVPESSQAYVHRIGRTGRAGRSGKAVTFYT 478

Query: 533 XXXXXXXXXXXXXXGKKILLAPMYDATCELMRKQWVAE----GKQESEFVAPRVSYTNRM 588
                           K ++  M  + CE+   +W+ +     K+E E +    ++T R 
Sbjct: 479 KQDSVAI---------KPIINVMKQSGCEV--SKWMDKMAKLTKREKESIKNGKAHTERK 527

Query: 589 VLGSCPR 595
            + + P+
Sbjct: 528 QITTVPK 534

>YOR204W Chr15 (722911..724725) [1815 bp, 604 aa] {ON}
           DED1ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA
           helicase, required for translation initiation of all
           yeast mRNAs; mutations in human DEAD-box DBY are a
           frequent cause of male infertility
          Length = 604

 Score =  135 bits (340), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 79/242 (32%), Positives = 132/242 (54%), Gaps = 17/242 (7%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMI-EKLKG----- 198
           +L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F  P++ E  K      
Sbjct: 153 LLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKTGPSPQ 212

Query: 199 -------HSAKIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMM 251
                  +  K    AVI++P+RELA Q +   K+F+  S +++ ++ GG  +  Q   +
Sbjct: 213 PESQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGSPIGNQLREI 272

Query: 252 MGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPT-- 309
               D+++ATPGR   L     + L  V+Y+V DEADR+ +MGF+ Q+  ++     T  
Sbjct: 273 ERGCDLLVATPGRLNDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHIVEDCDMTPV 332

Query: 310 --RQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLY 367
             RQTL+FSAT P  +   A+  L++ + + +      SEN+    L  +N ++++ LL 
Sbjct: 333 GERQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVENQDKKSALLD 392

Query: 368 LL 369
           LL
Sbjct: 393 LL 394

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 64/98 (65%)

Query: 430 TILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAAR 489
           T++FV T+   + ++  L    +  + I+G   Q+ R++ L  FRSG  ++LV T VAAR
Sbjct: 402 TLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAATLLVATAVAAR 461

Query: 490 GVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWA 527
           G+DIP + +VIN+ LPS    ++HR+GRT RAGN+G A
Sbjct: 462 GLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLA 499

>TBLA0B04200 Chr2 complement(970057..971952) [1896 bp, 631 aa] {ON}
           Anc_8.614 YOR204W
          Length = 631

 Score =  135 bits (341), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 132/242 (54%), Gaps = 17/242 (7%)

Query: 145 ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEK--------- 195
           ++ NI    F +PTP+Q+ +IP++ Q RD++  A+TGSGKT  F  P++ +         
Sbjct: 166 LMENIKLAHFTKPTPVQKYSIPIVEQGRDLMACAQTGSGKTGGFLFPVLSESFSTGPADL 225

Query: 196 ----LKGHSAKIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMM 251
                  +  K    AVIL+P+RELA Q +   K+F+  S ++  ++ GG  +  Q   +
Sbjct: 226 PENTQSSYMRKAYPTAVILAPTRELATQIFDEAKKFTYRSWVKPCVVYGGADIRNQIREL 285

Query: 252 MGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELL--AALPPT 309
                +++ATPGR   L     + L  V+Y+V DEADR+ +MGF+ Q+  ++    +PP 
Sbjct: 286 ERGCALLVATPGRLNDLLERGRISLANVKYLVLDEADRMLDMGFEPQIRHIVDGCDMPPA 345

Query: 310 --RQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLY 367
             RQTL+FSAT P  +   A+  L++ + + +      SEN+    L  ++ ++++ LL 
Sbjct: 346 GERQTLMFSATFPDDIQHLARDFLSDYIFLSVGRVGSTSENITQHILYVEDMDKKSALLD 405

Query: 368 LL 369
           LL
Sbjct: 406 LL 407

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 63/98 (64%)

Query: 430 TILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAAR 489
           T++FV T+   + ++  L    +  + I+G   Q+ R++ L  FR+G   +LV T VAAR
Sbjct: 415 TLIFVETKRMADELTDFLIMQNFRATAIHGDRTQSERERALHAFRNGRADLLVATAVAAR 474

Query: 490 GVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWA 527
           G+DIP + +VIN+ LPS    ++HR+GRT RAGN+G A
Sbjct: 475 GLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGTA 512

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 85,645,701
Number of extensions: 3381471
Number of successful extensions: 12726
Number of sequences better than 10.0: 616
Number of HSP's gapped: 11735
Number of HSP's successfully gapped: 1110
Length of query: 1003
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 883
Effective length of database: 39,721,479
Effective search space: 35074065957
Effective search space used: 35074065957
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)