Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0C08008g3.187ON1451453865e-48
KLTH0E15840g3.187ON113271394e-11
Kwal_YGOB_Anc_3.1873.187ON112271376e-11
Klac_YGOB_Anc_3.1873.187ON119231231e-08
TBLA0B016803.187ON40261162e-08
TDEL0D043403.187ON120241194e-08
YDL012C3.187ON107251151e-07
Suva_4.2373.187ON103251132e-07
Skud_4.2413.187ON106251113e-07
KAFR0C008803.187ON121221107e-07
ZYRO0A04972g3.187ON122261108e-07
Ecym_52633.187ON124271091e-06
NCAS0I019003.187ON93261062e-06
Smik_2.1353.187ON127261072e-06
CAGL0I04510g3.187ON116261054e-06
Skud_2.1283.187ON127221002e-05
AER212W3.187ON113106993e-05
CAGL0K01903g3.187ON10126965e-05
Suva_2.1443.187ON11923967e-05
KNAG0K012853.187ON12626967e-05
Kpol_1036.513.187ON7926680.31
NOTE: 3 genes in the same pillar as SAKL0C08008g were not hit in these BLAST results
LIST: Smik_4.222 TBLA0F00730 YBR016W

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0C08008g
         (145 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0C08008g Chr3 complement(743966..744268,744380..744514) [438...   153   5e-48
KLTH0E15840g Chr5 (1406256..1406303,1406400..1406693) [342 bp, 1...    58   4e-11
Kwal_YGOB_Anc_3.187 s27 complement(77867..78157,78226..78273) [3...    57   6e-11
Klac_YGOB_Anc_3.187 Chr3 complement(406964..407278,407429..40747...    52   1e-08
TBLA0B01680 Chr2 complement(375921..376043) [123 bp, 40 aa] {ON}...    49   2e-08
TDEL0D04340 Chr4 (792565..792609,792675..792992) [363 bp, 120 aa...    50   4e-08
YDL012C Chr4 complement(431108..431386,431473..431517) [324 bp, ...    49   1e-07
Suva_4.237 Chr4 complement(424387..424653,424741..424785) [312 b...    48   2e-07
Skud_4.241 Chr4 complement(425844..426119,426211..426255) [321 b...    47   3e-07
KAFR0C00880 Chr3 (178337..178375,178475..178801) [366 bp, 121 aa...    47   7e-07
ZYRO0A04972g Chr1 (400197..400235,400324..400653) [369 bp, 122 a...    47   8e-07
Ecym_5263 Chr5 complement(545614..545943,546179..546223) [375 bp...    47   1e-06
NCAS0I01900 Chr9 (349882..350163) [282 bp, 93 aa] {ON} Anc_3.187...    45   2e-06
Smik_2.135 Chr2 (250473..250856) [384 bp, 127 aa] {ON} YBR016W (...    46   2e-06
CAGL0I04510g Chr9 complement(403225..403527,403675..403722) [351...    45   4e-06
Skud_2.128 Chr2 (243786..244169) [384 bp, 127 aa] {ON} YBR016W (...    43   2e-05
AER212W Chr5 (1027712..1027753,1027805..1028104) [342 bp, 113 aa...    43   3e-05
CAGL0K01903g Chr11 complement(169669..169974) [306 bp, 101 aa] {...    42   5e-05
Suva_2.144 Chr2 (249704..250063) [360 bp, 119 aa] {ON} YBR016W (...    42   7e-05
KNAG0K01285 Chr11 complement(253589..253930,254081..254119) [381...    42   7e-05
Kpol_1036.51 s1036 (140002..140004,140137..140373) [240 bp, 79 a...    31   0.31 

>SAKL0C08008g Chr3 complement(743966..744268,744380..744514) [438
           bp, 145 aa] {ON} similar to uniprot|Q12489 Saccharomyces
           cerevisiae YDL012C Plasma membrane protein of unknown
           function
          Length = 145

 Score =  153 bits (386), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 83/145 (57%)

Query: 1   MCFRKTIKSFTIIHPLFATHPPHPTRKXXXXXXXXXXXXXXXKQTYQRPTGAPPSGDFSS 60
           MCFRKTIKSFTIIHPLFATHPPHPTRK               KQTYQRPTGAPPSGDFSS
Sbjct: 1   MCFRKTIKSFTIIHPLFATHPPHPTRKAMSAADYYSGAAADSKQTYQRPTGAPPSGDFSS 60

Query: 61  SRGYPQQNSGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRP 120
           SRGYPQQNSGT                                               RP
Sbjct: 61  SRGYPQQNSGTQQYYQQPPQQAYYTQQQPPQYYGQQTQQQQQPGYYQQQQQPVYVQQQRP 120

Query: 121 TSNNQDCLTACLAGMCLCCTLDMLF 145
           TSNNQDCLTACLAGMCLCCTLDMLF
Sbjct: 121 TSNNQDCLTACLAGMCLCCTLDMLF 145

>KLTH0E15840g Chr5 (1406256..1406303,1406400..1406693) [342 bp, 113
           aa] {ON} similar to uniprot|Q12489 Saccharomyces
           cerevisiae YDL012C Plasma membrane protein of unknown
           function
          Length = 113

 Score = 58.2 bits (139), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 25/27 (92%), Positives = 26/27 (96%)

Query: 119 RPTSNNQDCLTACLAGMCLCCTLDMLF 145
           RPT+NN DCLTACLAGMCLCCTLDMLF
Sbjct: 87  RPTNNNSDCLTACLAGMCLCCTLDMLF 113

>Kwal_YGOB_Anc_3.187 s27 complement(77867..78157,78226..78273) [339
           bp, 112 aa] {ON} ANNOTATED BY YGOB -
          Length = 112

 Score = 57.4 bits (137), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 25/27 (92%), Positives = 26/27 (96%)

Query: 119 RPTSNNQDCLTACLAGMCLCCTLDMLF 145
           RPT+NN DCLTACLAGMCLCCTLDMLF
Sbjct: 86  RPTNNNSDCLTACLAGMCLCCTLDMLF 112

>Klac_YGOB_Anc_3.187 Chr3 complement(406964..407278,407429..407473)
           [360 bp, 119 aa] {ON} ANNOTATED BY YGOB -
          Length = 119

 Score = 52.0 bits (123), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 22/23 (95%), Positives = 22/23 (95%)

Query: 123 NNQDCLTACLAGMCLCCTLDMLF 145
           NN DCLTACLAGMCLCCTLDMLF
Sbjct: 97  NNSDCLTACLAGMCLCCTLDMLF 119

>TBLA0B01680 Chr2 complement(375921..376043) [123 bp, 40 aa] {ON}
           Anc_3.187 YDL012C
          Length = 40

 Score = 49.3 bits (116), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 21/26 (80%), Positives = 24/26 (92%)

Query: 120 PTSNNQDCLTACLAGMCLCCTLDMLF 145
           PTSNN DC+TACLA +C+CCTLDMLF
Sbjct: 15  PTSNNDDCMTACLAALCVCCTLDMLF 40

>TDEL0D04340 Chr4 (792565..792609,792675..792992) [363 bp, 120 aa]
           {ON} Anc_3.187 YDL012C
          Length = 120

 Score = 50.4 bits (119), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 21/24 (87%), Positives = 22/24 (91%)

Query: 122 SNNQDCLTACLAGMCLCCTLDMLF 145
           S NQDCLTACLA MC+CCTLDMLF
Sbjct: 97  SGNQDCLTACLAAMCICCTLDMLF 120

>YDL012C Chr4 complement(431108..431386,431473..431517) [324 bp, 107
           aa] {ON} Tail-anchored plasma membrane protein
           containing a conserved CYSTM module, possibly involved
           in response to stress; may contribute to non-homologous
           end-joining (NHEJ) based on ydl012c htz1 double null
           phenotype
          Length = 107

 Score = 48.9 bits (115), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 22/25 (88%)

Query: 121 TSNNQDCLTACLAGMCLCCTLDMLF 145
           +S N+DCL  CLAG+CLCCTLDMLF
Sbjct: 83  SSGNEDCLAGCLAGLCLCCTLDMLF 107

>Suva_4.237 Chr4 complement(424387..424653,424741..424785) [312 bp,
           103 aa] {ON} YDL012C (REAL)
          Length = 103

 Score = 48.1 bits (113), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%)

Query: 121 TSNNQDCLTACLAGMCLCCTLDMLF 145
           +S NQDCLT CLAG+CLCCTLDML 
Sbjct: 79  SSGNQDCLTGCLAGLCLCCTLDMLI 103

>Skud_4.241 Chr4 complement(425844..426119,426211..426255) [321 bp,
           106 aa] {ON} YDL012C (REAL)
          Length = 106

 Score = 47.4 bits (111), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 22/25 (88%)

Query: 121 TSNNQDCLTACLAGMCLCCTLDMLF 145
           ++ N DCLT CLAG+CLCCTLDMLF
Sbjct: 82  STGNGDCLTGCLAGLCLCCTLDMLF 106

>KAFR0C00880 Chr3 (178337..178375,178475..178801) [366 bp, 121 aa]
           {ON} Anc_3.187 YDL012C
          Length = 121

 Score = 47.0 bits (110), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%)

Query: 124 NQDCLTACLAGMCLCCTLDMLF 145
           N+DCLTACLA MC+CCTLDMLF
Sbjct: 100 NEDCLTACLAAMCICCTLDMLF 121

>ZYRO0A04972g Chr1 (400197..400235,400324..400653) [369 bp, 122 aa]
           {ON} weakly similar to uniprot|P38216 Saccharomyces
           cerevisiae YBR016W
          Length = 122

 Score = 47.0 bits (110), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 22/26 (84%)

Query: 120 PTSNNQDCLTACLAGMCLCCTLDMLF 145
           P   N+DCLTACLA +C+CCTLDMLF
Sbjct: 97  PQRGNEDCLTACLAVLCVCCTLDMLF 122

>Ecym_5263 Chr5 complement(545614..545943,546179..546223) [375 bp,
           124 aa] {ON} similar to Ashbya gossypii AER212W
          Length = 124

 Score = 46.6 bits (109), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 20/27 (74%)

Query: 119 RPTSNNQDCLTACLAGMCLCCTLDMLF 145
           +P S    CL ACLAG CLCCTLDMLF
Sbjct: 98  QPESKKDSCLMACLAGACLCCTLDMLF 124

>NCAS0I01900 Chr9 (349882..350163) [282 bp, 93 aa] {ON} Anc_3.187
           YBR016W
          Length = 93

 Score = 45.4 bits (106), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 21/26 (80%)

Query: 120 PTSNNQDCLTACLAGMCLCCTLDMLF 145
           P   N+DCLT CLAG+C+CCTLDML 
Sbjct: 68  PQRGNEDCLTGCLAGLCICCTLDMLM 93

>Smik_2.135 Chr2 (250473..250856) [384 bp, 127 aa] {ON} YBR016W
           (REAL)
          Length = 127

 Score = 45.8 bits (107), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 21/26 (80%)

Query: 120 PTSNNQDCLTACLAGMCLCCTLDMLF 145
           P   N+ C+TACLA +C+CCT+DMLF
Sbjct: 102 PQKGNEGCITACLAALCICCTMDMLF 127

>CAGL0I04510g Chr9 complement(403225..403527,403675..403722) [351
           bp, 116 aa] {ON} similar to uniprot|P38216 Saccharomyces
           cerevisiae YBR016w and similar to uniprot|Q12489
           Saccharomyces cerevisiae YDL012c
          Length = 116

 Score = 45.1 bits (105), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 21/26 (80%)

Query: 120 PTSNNQDCLTACLAGMCLCCTLDMLF 145
           P   N DC+TACLA +C+CCTLD+LF
Sbjct: 91  PQRGNDDCMTACLAALCICCTLDLLF 116

>Skud_2.128 Chr2 (243786..244169) [384 bp, 127 aa] {ON} YBR016W
           (REAL)
          Length = 127

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 20/22 (90%)

Query: 124 NQDCLTACLAGMCLCCTLDMLF 145
           N+ C+TACLA +C+CCT+DMLF
Sbjct: 106 NEGCITACLAALCICCTMDMLF 127

>AER212W Chr5 (1027712..1027753,1027805..1028104) [342 bp, 113 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL012C and YBR016W; 1-intron
          Length = 113

 Score = 42.7 bits (99), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 36/106 (33%), Gaps = 7/106 (6%)

Query: 43  KQTYQRPTGAPPSGDFSSSRGYPQQNSGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 102
           KQ + RP  APP+GD    RGYP Q                                   
Sbjct: 12  KQQFNRPPAAPPAGD----RGYPGQGYDQGYQPQQAYYQQPAPQAMPPQGYYAEQPPMPP 67

Query: 103 XXXXXXXXXXXXXXXXRPT---SNNQDCLTACLAGMCLCCTLDMLF 145
                           +P    S N  CL ACL GMCLC TLDMLF
Sbjct: 68  PQGYYGPPPQQPIYVQQPAQAPSKNDSCLVACLGGMCLCYTLDMLF 113

>CAGL0K01903g Chr11 complement(169669..169974) [306 bp, 101 aa] {ON}
           no similarity
          Length = 101

 Score = 41.6 bits (96), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 20/26 (76%)

Query: 120 PTSNNQDCLTACLAGMCLCCTLDMLF 145
           P + N+DCL ACLA MC+C TLD+L 
Sbjct: 76  PQNGNEDCLMACLAAMCICLTLDLLI 101

>Suva_2.144 Chr2 (249704..250063) [360 bp, 119 aa] {ON} YBR016W
           (REAL)
          Length = 119

 Score = 41.6 bits (96), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 20/23 (86%)

Query: 123 NNQDCLTACLAGMCLCCTLDMLF 145
            N+ C+TACLA +C+CCT+DMLF
Sbjct: 97  GNEGCMTACLAALCICCTMDMLF 119

>KNAG0K01285 Chr11 complement(253589..253930,254081..254119) [381
           bp, 126 aa] {ON}
          Length = 126

 Score = 41.6 bits (96), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 20/26 (76%)

Query: 120 PTSNNQDCLTACLAGMCLCCTLDMLF 145
           P   N DC+TACLA +C+CC ++M+F
Sbjct: 101 PQRGNDDCMTACLAALCVCCAMNMIF 126

>Kpol_1036.51 s1036 (140002..140004,140137..140373) [240 bp, 79 aa]
           {ON} (140002..140004,140137..140373) [240 nt, 80 aa]
          Length = 79

 Score = 30.8 bits (68), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 120 PTSNNQDCLTACLAGMCLCCTLDMLF 145
           P   N+DC+TACLA +C+  TL++  
Sbjct: 54  PQRGNEDCMTACLAALCVLFTLNLFI 79

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.135    0.453 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,279,120
Number of extensions: 185584
Number of successful extensions: 481
Number of sequences better than 10.0: 26
Number of HSP's gapped: 479
Number of HSP's successfully gapped: 33
Length of query: 145
Length of database: 53,481,399
Length adjustment: 99
Effective length of query: 46
Effective length of database: 42,129,465
Effective search space: 1937955390
Effective search space used: 1937955390
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 60 (27.7 bits)