Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0C07986gna 1ON38138118550.0
KLLA0C04433gna 1ON36738510731e-145
KLTH0E15862gna 1ON36838110411e-140
Kwal_27.9830na 1ON36938310001e-134
Ecym_5262na 1ON3543708881e-117
Kpol_1023.645.585ON37952780.33
Suva_13.1215.585ON44159695.1
TPHA0K002205.585ON40030695.1
Kpol_1060.256.274ON28344677.0
NDAI0C007505.585ON47754687.3
KNAG0B033605.585ON40740677.9
ZYRO0E08888g3.538ON36445678.3
Skud_13.1135.585ON44151678.5
Smik_2.2723.397ON59745679.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0C07986g
         (381 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0C07986g Chr3 (742551..743696) [1146 bp, 381 aa] {ON} conser...   719   0.0  
KLLA0C04433g Chr3 (405523..406626) [1104 bp, 367 aa] {ON} conser...   417   e-145
KLTH0E15862g Chr5 complement(1406851..1407957) [1107 bp, 368 aa]...   405   e-140
Kwal_27.9830 s27 (76603..77712) [1110 bp, 369 aa] {ON} [contig 4...   389   e-134
Ecym_5262 Chr5 (544088..545152) [1065 bp, 354 aa] {ON} similar t...   346   e-117
Kpol_1023.64 s1023 complement(147038..148177) [1140 bp, 379 aa] ...    35   0.33 
Suva_13.121 Chr13 complement(192780..194105) [1326 bp, 441 aa] {...    31   5.1  
TPHA0K00220 Chr11 complement(36900..38102) [1203 bp, 400 aa] {ON...    31   5.1  
Kpol_1060.25 s1060 complement(63581..64432) [852 bp, 283 aa] {ON...    30   7.0  
NDAI0C00750 Chr3 complement(143572..145005) [1434 bp, 477 aa] {O...    31   7.3  
KNAG0B03360 Chr2 complement(649975..651198) [1224 bp, 407 aa] {O...    30   7.9  
ZYRO0E08888g Chr5 complement(708203..709297) [1095 bp, 364 aa] {...    30   8.3  
Skud_13.113 Chr13 complement(189116..190441) [1326 bp, 441 aa] {...    30   8.5  
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...    30   9.4  

>SAKL0C07986g Chr3 (742551..743696) [1146 bp, 381 aa] {ON} conserved
           hypothetical protein
          Length = 381

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/381 (94%), Positives = 360/381 (94%)

Query: 1   MKQSLVIALSAGLIVTGCINSIASKYQDNQCVRDCDGPRPVLFEQPVLQTLQMFIGESSV 60
           MKQSLVIALSAGLIVTGCINSIASKYQDNQCVRDCDGPRPVLFEQPVLQTLQMFIGESSV
Sbjct: 1   MKQSLVIALSAGLIVTGCINSIASKYQDNQCVRDCDGPRPVLFEQPVLQTLQMFIGESSV 60

Query: 61  FVVLLLRVIAGGGSPRPRSVEKPPLPGNRVLLLALPAVCDICATTLMNVALTMIPVSVYQ 120
           FVVLLLRVIAGGGSPRPRSVEKPPLPGNRVLLLALPAVCDICATTLMNVALTMIPVSVYQ
Sbjct: 61  FVVLLLRVIAGGGSPRPRSVEKPPLPGNRVLLLALPAVCDICATTLMNVALTMIPVSVYQ 120

Query: 121 MTRGALIIFVAMFSIVFLGHRISRLEWCSLFVVVLGVTIVXXXXXXXXXXXXXXXXXXXX 180
           MTRGALIIFVAMFSIVFLGHRISRLEWCSLFVVVLGVTIV                    
Sbjct: 121 MTRGALIIFVAMFSIVFLGHRISRLEWCSLFVVVLGVTIVGCNGGSGSDGGSGGNNSLLS 180

Query: 181 XVATARLSSSLFAGVFLILIAQLFMASQFVIEEHIMSRWTMMPVKLVGFEGVFGGSITLA 240
            VATARLSSSLFAGVFLILIAQLFMASQFVIEEHIMSRWTMMPVKLVGFEGVFGGSITLA
Sbjct: 181 SVATARLSSSLFAGVFLILIAQLFMASQFVIEEHIMSRWTMMPVKLVGFEGVFGGSITLA 240

Query: 241 VMLLGHLTFASGNPHSPFNVVQAFTDMFASPRVLYSSVAIMFSIACFNFFGISITNSVNA 300
           VMLLGHLTFASGNPHSPFNVVQAFTDMFASPRVLYSSVAIMFSIACFNFFGISITNSVNA
Sbjct: 241 VMLLGHLTFASGNPHSPFNVVQAFTDMFASPRVLYSSVAIMFSIACFNFFGISITNSVNA 300

Query: 301 TARSTIDTCRTLMVWCVSLSIGWESFKFGQLFGFVLLILGTLVFNGAIKLRRESLPRFLA 360
           TARSTIDTCRTLMVWCVSLSIGWESFKFGQLFGFVLLILGTLVFNGAIKLRRESLPRFLA
Sbjct: 301 TARSTIDTCRTLMVWCVSLSIGWESFKFGQLFGFVLLILGTLVFNGAIKLRRESLPRFLA 360

Query: 361 EDYPQDYERLIDVVDEEVDRF 381
           EDYPQDYERLIDVVDEEVDRF
Sbjct: 361 EDYPQDYERLIDVVDEEVDRF 381

>KLLA0C04433g Chr3 (405523..406626) [1104 bp, 367 aa] {ON} conserved
           hypothetical protein
          Length = 367

 Score =  417 bits (1073), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 225/385 (58%), Positives = 279/385 (72%), Gaps = 22/385 (5%)

Query: 1   MKQSLVIALSAGLIVTGCINSIASKYQDNQCVRDCDGPRPVLFEQPVLQTLQMFIGESSV 60
           M++ LVI  +  LIVTGCINSIA+KYQDNQCVRDCD   PVLFEQPVLQTLQMFIGE S+
Sbjct: 1   MRKELVIVTALSLIVTGCINSIATKYQDNQCVRDCDSISPVLFEQPVLQTLQMFIGEISL 60

Query: 61  -FVVLLLRVIAGGGS---PRPRSVEKPPLPGNRVLLLALPAVCDICATTLMNVALTMIPV 116
            FV+   +  +  G    P   S+ K  LP  +   LALPA+CDIC TTLMN+ALTMIPV
Sbjct: 61  MFVMFWQKYNSRNGYEAVPSAESLNKTKLPSRQSYALALPAICDICGTTLMNLALTMIPV 120

Query: 117 SVYQMTRGALIIFVAMFSIVFLGHRISRLEWCSLFVVVLGVTIVXXXXXXXXXXXXXXXX 176
           S+YQMTRG LI+FVA+FS+ FL H+ISR EW SLF+VV GV +V                
Sbjct: 121 SIYQMTRGVLILFVALFSVFFLKHKISRFEWLSLFIVVFGVFLVGYSGN----------- 169

Query: 177 XXXXXVATARLSSSLFAGVFLILIAQLFMASQFVIEEHIMSRWTMMPVKLVGFEGVFGGS 236
                     +  SL  GV LI++AQ+  A+QFV+EEHIMS+W + P  LV FEG++G S
Sbjct: 170 ------VGVTVDVSLVTGVLLIVLAQVCTATQFVLEEHIMSKWIIPPSTLVAFEGIYGAS 223

Query: 237 ITLAVMLLGHLTFASGNPHSPFNVVQAFTDMFASPRVLYSSVAIMFSIACFNFFGISITN 296
           ITL  ML+  +TFA    +S FN+V +  DMF +PRVLYSS+ IM SIACFNFFGI++TN
Sbjct: 224 ITLLTMLIASVTFAQNKQNSSFNIVYSLQDMFVNPRVLYSSIIIMISIACFNFFGITLTN 283

Query: 297 SVNATARSTIDTCRTLMVWCVSLSIGWESFKFGQLFGFVLLILGTLVFNGAIKLRRESLP 356
           S+NAT RSTIDTCRTL+VW VSLS+GWESFK  Q  GFVLL+LGTL+FNGAI + ++ LP
Sbjct: 284 SMNATVRSTIDTCRTLLVWLVSLSLGWESFKLTQFNGFVLLVLGTLLFNGAITIDKKRLP 343

Query: 357 RFLAEDYPQDYERLIDVVDEEVDRF 381
           ++L +DYP D +R+I+V+DEEV+RF
Sbjct: 344 QWLTKDYPGD-DRIINVIDEEVERF 367

>KLTH0E15862g Chr5 complement(1406851..1407957) [1107 bp, 368 aa]
           {ON} conserved hypothetical protein
          Length = 368

 Score =  405 bits (1041), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 203/381 (53%), Positives = 266/381 (69%), Gaps = 13/381 (3%)

Query: 1   MKQSLVIALSAGLIVTGCINSIASKYQDNQCVRDCDGPRPVLFEQPVLQTLQMFIGESSV 60
           M Q  +  +  G++V G +NS+ +KYQDNQCVRDC G  PV F QPVLQTLQMFIGE S+
Sbjct: 1   MGQLFIPVICIGVVVCGGVNSLMTKYQDNQCVRDCQGASPVYFNQPVLQTLQMFIGEMSM 60

Query: 61  FVVLLLRVIAGGGSPRPRSVEKPPLPGNRVLLLALPAVCDICATTLMNVALTMIPVSVYQ 120
             +   + + G G  +     KP + G   +LLALPA+CDI ATTLMN+AL MIPVS+YQ
Sbjct: 61  LALWWFQ-LRGTGRQQHEFDNKPLIKGRSYVLLALPAICDIIATTLMNLALVMIPVSIYQ 119

Query: 121 MTRGALIIFVAMFSIVFLGHRISRLEWCSLFVVVLGVTIVXXXXXXXXXXXXXXXXXXXX 180
           M RGA++ FVA+FS++FLG ++ RLEW  L  +V GV +V                    
Sbjct: 120 MVRGAIVFFVALFSVLFLGRQVCRLEWAYLATIVAGVAVVGYSGQSADT----------- 168

Query: 181 XVATARLSSSLFAGVFLILIAQLFMASQFVIEEHIMSRWTMMPVKLVGFEGVFGGSITLA 240
            V+    SSSL  GV LIL A LFMA+QF++EEH+MSRW + PV L+G EG+FG SIT+A
Sbjct: 169 -VSEQSFSSSLLVGVLLILFALLFMATQFIVEEHVMSRWAVSPVGLIGHEGLFGSSITVA 227

Query: 241 VMLLGHLTFASGNPHSPFNVVQAFTDMFASPRVLYSSVAIMFSIACFNFFGISITNSVNA 300
           ++++G+      + +S FN+ QAF+DMFA P VL SS  IM SIA FNFFG+SIT +V+A
Sbjct: 228 LLVVGNYMGGYRDVNSTFNMKQAFSDMFARPAVLNSSFVIMVSIALFNFFGVSITKNVSA 287

Query: 301 TARSTIDTCRTLMVWCVSLSIGWESFKFGQLFGFVLLILGTLVFNGAIKLRRESLPRFLA 360
           T+RST+DTCRTL+VWCVSLS+GWESFKF QL GF LL++GTL+FN AI++  + LP +  
Sbjct: 288 TSRSTVDTCRTLLVWCVSLSLGWESFKFTQLCGFALLVIGTLLFNNAIEIPDKYLPSYFL 347

Query: 361 EDYPQDYERLIDVVDEEVDRF 381
           ED   + +RLI+ +DEEV+RF
Sbjct: 348 EDKSGESQRLINTIDEEVERF 368

>Kwal_27.9830 s27 (76603..77712) [1110 bp, 369 aa] {ON} [contig 43]
           FULL
          Length = 369

 Score =  389 bits (1000), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 208/383 (54%), Positives = 268/383 (69%), Gaps = 16/383 (4%)

Query: 1   MKQSLVIALSAGLIVTGCINSIASKYQDNQCVRDCDGPRPVLFEQPVLQTLQMFIGESSV 60
           M +  + ++  G+IV GC+NS+A+KYQDNQCVRDCDG  P+ F QPVLQTLQMFIGE ++
Sbjct: 1   MSRLYIASICVGVIVFGCVNSLATKYQDNQCVRDCDGDNPIYFNQPVLQTLQMFIGEMAM 60

Query: 61  FVVLLLRVIAGGGSPRPRSVE-KPPLPGNRVLLLALPAVCDICATTLMNVALTMIPVSVY 119
                LR       P  +    KP +     LLLALPAVCDI ATTLMN AL MIPVS+Y
Sbjct: 61  LA--FLRGQQRSKLPLEQGFRGKPAISLQGYLLLALPAVCDIIATTLMNWALVMIPVSIY 118

Query: 120 QMTRGALIIFVAMFSIVFLGHRISRLEWCSLFVVVLGVTIVXXXXXXXXXXXXXXXXXXX 179
           QMTRGA++ FVA+FS+VFL  R++R EW SL ++V GV +V                   
Sbjct: 119 QMTRGAIVFFVALFSVVFLHRRVTRFEWASLAIIVAGVAVVGYSGQEDEV---------- 168

Query: 180 XXVATARLSSSLFAGVFLILIAQLFMASQFVIEEHIMSRWTMMPVKLVGFEGVFGGSITL 239
             ++   +S+S   G+ LIL+A  FMA+QF++EEHI+SRW + PV LVGFEG FG SITL
Sbjct: 169 --LSEEVISTSSVFGISLILVALFFMATQFIVEEHILSRWEINPVGLVGFEGFFGTSITL 226

Query: 240 AVMLLGHLTFASGNPHSPFNVVQAFTDMFASPRVLYSSVAIMFSIACFNFFGISITNSVN 299
           A +L+G++   + N +S FN+ QAF DM+    VL SS+ IM SIA FNF G+SIT  V+
Sbjct: 227 AFLLVGNVAGGNRNKNSSFNMKQAFMDMYEHSAVLISSIIIMISIALFNFTGVSITKHVS 286

Query: 300 ATARSTIDTCRTLMVWCVSLSIGWESFKFGQLFGFVLLILGTLVFNGAIKLRRESLPRFL 359
           AT+RST+DTCRTL+VWCVSL +GWESFKF QL GFVLL+LGTL+FNGAI++  + LPR+ 
Sbjct: 287 ATSRSTVDTCRTLLVWCVSLILGWESFKFMQLCGFVLLVLGTLLFNGAIEIPPKYLPRYF 346

Query: 360 AEDYPQ-DYERLIDVVDEEVDRF 381
            ED  + + +RLID +DEEV+RF
Sbjct: 347 KEDSSEGERQRLIDTIDEEVERF 369

>Ecym_5262 Chr5 (544088..545152) [1065 bp, 354 aa] {ON} similar to
           KLLA0C04433g - Kluyveromyces lactis
          Length = 354

 Score =  346 bits (888), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 182/370 (49%), Positives = 245/370 (66%), Gaps = 21/370 (5%)

Query: 1   MKQSLVIALSAGLIVTGCINSIASKYQDNQCVRDCDGPRPVLFEQPVLQTLQMFIGESSV 60
           M+QS VI L  G+I+TGCINSIA+KYQD QCVR+C    P L +QPVLQT+QMF+GE+S 
Sbjct: 1   MRQSFVILLCLGMIITGCINSIATKYQDKQCVRNCLTDSPELLQQPVLQTVQMFLGEASA 60

Query: 61  FVVLLLRVIAGGGSPRPRSVEKPPLPGNRVLLLALPAVCDICATTLMNVALTMIPVSVYQ 120
                L      G+    SV K  L     +LL++PAVCDIC TT+M++ALT++PVS+YQ
Sbjct: 61  LFAFYLL-----GARPSTSVTKFLLQNKNTVLLSIPAVCDICGTTMMHLALTLVPVSIYQ 115

Query: 121 MTRGALIIFVAMFSIVFLGHRISRLEWCSLFVVVLGVTIVXXXXXXXXXXXXXXXXXXXX 180
           M RG+L+I VA FS+VFL  +++R EW SL+ V+ G+ IV                    
Sbjct: 116 MVRGSLVIVVATFSVVFLNKKLTRGEWLSLYTVMFGIGIVGLTGFDDW------------ 163

Query: 181 XVATARLSSSLFAGVFLILIAQLFMASQFVIEEHIMSRWTMMPVKLVGFEGVFGGSITLA 240
              + + +++   G+ LIL+AQLFMA+Q+VIEEH++SR+    +++VGFEG+FGG+ITL 
Sbjct: 164 --NSDKPAANTLLGITLILVAQLFMAAQYVIEEHLISRYPFDSLEVVGFEGLFGGAITLF 221

Query: 241 VMLLGHLTFASGNPHSPFNVVQAFTDMFASPRVLYSSVAIMFSIACFNFFGISITNSVNA 300
            +LLG  T A  +P SP N+ Q   D+  S  ++ SS  IM SIA +NFFGI+ITN +NA
Sbjct: 222 FLLLGTFTIAWKDPSSPLNLFQGLKDVSYSGNLMVSSFTIMISIAFYNFFGIAITNHMNA 281

Query: 301 TARSTIDTCRTLMVWCVSLSIGWESFKFGQLFGFVLLILGTLVFNGAIKLRRESLPRFLA 360
           T+RSTIDT RTL+VW VSL +GWE F F QL GF L ++GTL+FNGAI      +P+   
Sbjct: 282 TSRSTIDTSRTLLVWLVSLILGWERFSFLQLIGFALSVVGTLIFNGAISFANYQVPQRQH 341

Query: 361 EDYPQDYERL 370
           + Y   YE L
Sbjct: 342 DYY--GYEEL 349

>Kpol_1023.64 s1023 complement(147038..148177) [1140 bp, 379 aa]
           {ON} complement(147038..148177) [1140 nt, 380 aa]
          Length = 379

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 4/52 (7%)

Query: 106 LMNVALTMIPVSVYQMTRGALIIFVAMFSIVFLGHRISRLEWCSLFVVVLGV 157
           L NV+   +P+++Y + + A I+FV +F  +F   RI R  W  L +V LG+
Sbjct: 98  LSNVSFKFVPLTIYTILKSASIVFVLLFGCLF---RIERYHW-KLSLVTLGM 145

>Suva_13.121 Chr13 complement(192780..194105) [1326 bp, 441 aa] {ON}
           YML038C (REAL)
          Length = 441

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query: 97  AVCDICATTLMNVALTMIPVSVYQMTRGALIIFVAMFSIVFLGHRISRLEWCSLFVVVL 155
           A+       L NV+   +P++VY + + + I FV +F  +F   ++ R  W    VV +
Sbjct: 88  AIASAGDVGLSNVSFKYVPLTVYTIIKSSSIAFVLLFGCIF---KLERFHWKLAIVVTI 143

>TPHA0K00220 Chr11 complement(36900..38102) [1203 bp, 400 aa] {ON}
           Anc_5.585 YML038C
          Length = 400

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 22/30 (73%)

Query: 108 NVALTMIPVSVYQMTRGALIIFVAMFSIVF 137
           N +L  IP+S++ + R A ++F+ +FS++F
Sbjct: 112 NTSLKYIPLSIFTIIRSANVVFILLFSVLF 141

>Kpol_1060.25 s1060 complement(63581..64432) [852 bp, 283 aa] {ON}
           complement(63581..64432) [852 nt, 284 aa]
          Length = 283

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 92  LLALPAVCDICATTLMNVALTMIPVSVYQMTRGALI-IFVAMFS 134
           LL  P V    A  L N    MIP+++++MT G L  +F  MFS
Sbjct: 60  LLTYPLVHLSLAHLLFNSMAMMIPLNIFEMTHGTLYTLFTLMFS 103

>NDAI0C00750 Chr3 complement(143572..145005) [1434 bp, 477 aa] {ON}
           Anc_5.585 YML038C
          Length = 477

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 31/54 (57%), Gaps = 4/54 (7%)

Query: 108 NVALTMIPVSVYQMTRGALIIFVAMFSIVFLGHRISRLEW-CSLFVVVLGVTIV 160
           NV+   +P+++Y   + + I FV +FS +F   +I +  W  S+ V ++ + +V
Sbjct: 124 NVSFKFVPLTIYTTIKSSSIAFVLLFSCIF---KIEKFHWKLSMIVSIMFIGVV 174

>KNAG0B03360 Chr2 complement(649975..651198) [1224 bp, 407 aa] {ON}
           Anc_5.585 YML038C
          Length = 407

 Score = 30.4 bits (67), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 24/40 (60%), Gaps = 3/40 (7%)

Query: 108 NVALTMIPVSVYQMTRGALIIFVAMFSIVFLGHRISRLEW 147
           NV+   +P+SVY + + + I FV +FS +F   ++ +  W
Sbjct: 96  NVSFKFVPLSVYTIVKSSSIAFVLLFSCLF---KLEKFHW 132

>ZYRO0E08888g Chr5 complement(708203..709297) [1095 bp, 364 aa] {ON}
           similar to uniprot|P40107 Saccharomyces cerevisiae
           YGL225W VRG4 May regulate Golgi function and
           glycosylation in Golgi Golgi GDP-mannose transporter
          Length = 364

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 26/45 (57%)

Query: 110 ALTMIPVSVYQMTRGALIIFVAMFSIVFLGHRISRLEWCSLFVVV 154
           AL ++PV +Y + +   II +A   ++F G  ++ +E  S  ++V
Sbjct: 103 ALNLLPVPIYTIFKNLTIILIAYGEVLFFGGSVTSMELSSFLLMV 147

>Skud_13.113 Chr13 complement(189116..190441) [1326 bp, 441 aa] {ON}
           YML038C (REAL)
          Length = 441

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 30/51 (58%), Gaps = 4/51 (7%)

Query: 106 LMNVALTMIPVSVYQMTRGALIIFVAMFSIVFLGHRISRLEW-CSLFVVVL 155
           L NV+L  +P++VY + + + I FV +F   F   ++ +  W  +L V+++
Sbjct: 97  LSNVSLQYVPLTVYTIIKSSSIAFVLLFGCAF---KLEKFHWKLALLVIIM 144

>Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON}
           YBR132C (REAL)
          Length = 597

 Score = 30.4 bits (67), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query: 330 QLFGFVLLILGTLVFNGAIKLRRESLPRFLAEDYPQDYERLIDVV 374
           QL  FV+L +  L F  A +++++SLPR     + Q Y  +I +V
Sbjct: 468 QLINFVVLCIIYLFFRRAYRVQQDSLPRLPFRSWGQPYTAIIGLV 512

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.142    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,024,591
Number of extensions: 1172126
Number of successful extensions: 3620
Number of sequences better than 10.0: 25
Number of HSP's gapped: 3673
Number of HSP's successfully gapped: 25
Length of query: 381
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 270
Effective length of database: 40,753,473
Effective search space: 11003437710
Effective search space used: 11003437710
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 67 (30.4 bits)