Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0C07414g3.165ON48248225210.0
KLTH0F06534g3.165ON46648316800.0
Kwal_33.141823.165ON46748716490.0
ZYRO0B04840g3.165ON47649116240.0
TDEL0D045803.165ON48249316240.0
Kpol_1045.443.165ON46948815790.0
CAGL0C05203g3.165ON47548615440.0
Suva_15.1033.165ON49149615310.0
NCAS0C035803.165ON49149915230.0
YOL062C (APM4)3.165ON49149615190.0
Smik_15.963.165ON49149315010.0
Skud_15.913.165ON49149615000.0
Ecym_52393.165ON46448314940.0
NDAI0G029203.165ON48650414890.0
TPHA0P006603.165ON47348614330.0
TBLA0F008403.165ON48148814040.0
KNAG0K011503.165ON47448813600.0
KLLA0C03894g3.165ON47549113380.0
ADR315W3.165ON49245112221e-164
KAFR0C010203.165ON42849910721e-142
NDAI0E036807.127ON4444915521e-64
Ecym_83507.127ON4454835484e-64
KLTH0F12584g7.127ON4414885475e-64
SAKL0F05346g7.127ON4474925451e-63
KLLA0D14311g7.127ON4434855372e-62
Kwal_55.208437.127ON4414875266e-61
NCAS0E021407.127ON4814985297e-61
Suva_16.457.127ON4785175253e-60
YPL259C (APM1)7.127ON4755195243e-60
ADL017C7.127ON4434975206e-60
TBLA0A009507.127ON4695095155e-59
Smik_6.4667.127ON4765275156e-59
KAFR0L004707.127ON4655045147e-59
ZYRO0C05236g7.127ON4474885111e-58
KNAG0L009507.127ON4615005121e-58
Kpol_1062.567.127ON4504905111e-58
CAGL0K00539g7.127ON4564985102e-58
TDEL0H028907.127ON4424975083e-58
TPHA0C043207.127ON4545005023e-57
Skud_16.197.127ON4765254973e-56
SAKL0D13090g2.555ON4995052442e-21
KLTH0D07502g2.555ON5044942353e-20
ABR047W2.555ON4983582264e-19
TDEL0B064302.555ON5255072169e-18
KLLA0F25432g2.555ON5073482151e-17
Ecym_45912.555ON5013352132e-17
Skud_8.262.555ON5963642123e-17
ZYRO0E05874g2.555ON5493292123e-17
Kwal_26.81462.555ON5054812095e-17
KAFR0A020602.555ON5403442096e-17
TPHA0I023902.555ON5593522052e-16
Suva_8.332.555ON5963652043e-16
Kpol_1056.132.555ON5413431972e-15
YHL019C (APM2)2.555ON6053661972e-15
CAGL0K03223g2.555ON5982361963e-15
TBLA0B067602.555ON6572391883e-14
Kwal_26.79572.522ON4563171864e-14
Smik_8.232.555ON6033661865e-14
NCAS0A126502.555ON5883581865e-14
KNAG0C055502.555ON5823531831e-13
KLTH0D06556g2.522ON4563281821e-13
KLLA0E18789g2.522ON4971471793e-13
KAFR0D035602.522ON4553191766e-13
NDAI0B016102.555ON6722321661e-11
SAKL0A09218g2.522ON4731381534e-10
TDEL0A029702.522ON4961531491e-09
TBLA0I006202.522ON6091541464e-09
AGL061W2.522ON4111351402e-08
NCAS0A048702.522ON4891701276e-07
ZYRO0B01738g2.522ON4921481268e-07
Smik_2.4302.522ON4841381204e-06
Ecym_72662.522ON5172921205e-06
Kpol_1018.422.522ON5751521205e-06
Suva_4.5482.522ON4841511171e-05
YBR288C (APM3)2.522ON4831381161e-05
NDAI0K019302.522ON6121721162e-05
CAGL0L02145g2.522ON5431611133e-05
TPHA0C041302.522ON5331461108e-05
Skud_2.4192.522ON4841391044e-04
Kwal_55.21751singletonOFF7950780.064
Smik_7.3713.575ON598192770.79
KAFR0B017808.76ON19048731.4
YFR051C (RET2)3.575ON546190741.5
KNAG0A069702.522ON505148732.0
Ecym_13001.406ON1508135732.5
KAFR0A077602.44ON425108722.8
NCAS0F040103.575ON54752714.1
TDEL0C00160singletonON28180687.0
YEL025C1.464ON118867689.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0C07414g
         (482 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   975   0.0  
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   651   0.0  
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   639   0.0  
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   630   0.0  
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   630   0.0  
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   612   0.0  
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   599   0.0  
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   594   0.0  
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   591   0.0  
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   589   0.0  
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   582   0.0  
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   582   0.0  
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   580   0.0  
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   578   0.0  
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   556   0.0  
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   545   0.0  
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   528   0.0  
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   520   0.0  
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   475   e-164
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   417   e-142
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   217   1e-64
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   215   4e-64
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   215   5e-64
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   214   1e-63
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   211   2e-62
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   207   6e-61
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   208   7e-61
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   206   3e-60
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   206   3e-60
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   204   6e-60
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   202   5e-59
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   202   6e-59
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   202   7e-59
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   201   1e-58
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   201   1e-58
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   201   1e-58
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   201   2e-58
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   200   3e-58
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   197   3e-57
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   196   3e-56
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...    99   2e-21
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...    95   3e-20
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...    92   4e-19
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...    88   9e-18
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...    87   1e-17
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...    87   2e-17
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...    86   3e-17
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...    86   3e-17
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...    85   5e-17
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...    85   6e-17
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...    84   2e-16
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...    83   3e-16
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...    80   2e-15
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...    80   2e-15
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...    80   3e-15
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    77   3e-14
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    76   4e-14
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...    76   5e-14
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...    76   5e-14
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...    75   1e-13
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    75   1e-13
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    74   3e-13
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    72   6e-13
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    69   1e-11
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    64   4e-10
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    62   1e-09
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    61   4e-09
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    59   2e-08
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    54   6e-07
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    53   8e-07
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    51   4e-06
Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]...    51   5e-06
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    51   5e-06
Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON...    50   1e-05
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    49   1e-05
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    49   2e-05
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    48   3e-05
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    47   8e-05
Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON...    45   4e-04
Kwal_55.21751 s55 (964248..964487) [240 bp, 79 aa] {OFF} [contig...    35   0.064
Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON...    34   0.79 
KAFR0B01780 Chr2 (348976..349548) [573 bp, 190 aa] {ON} Anc_8.76...    33   1.4  
YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}  ...    33   1.5  
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    33   2.0  
Ecym_1300 Chr1 (608031..612557) [4527 bp, 1508 aa] {ON} similar ...    33   2.5  
KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa] ...    32   2.8  
NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {O...    32   4.1  
TDEL0C00160 Chr3 (16995..17840) [846 bp, 281 aa] {ON}                  31   7.0  
YEL025C Chr5 complement(102581..106147) [3567 bp, 1188 aa] {ON} ...    31   9.4  

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  975 bits (2521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/482 (98%), Positives = 473/482 (98%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSS 60
           MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSS
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSS 60

Query: 61  SNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLENGVP 120
           SNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLENGVP
Sbjct: 61  SNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLENGVP 120

Query: 121 VDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXXXXXXXP 180
           VDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKG         P
Sbjct: 121 VDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGSRSSSSVSSP 180

Query: 181 ANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDLTTHLS 240
           ANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDLTTHLS
Sbjct: 181 ANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDLTTHLS 240

Query: 241 GTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLN 300
           GTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLN
Sbjct: 241 GTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLN 300

Query: 301 RFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVALKSLFPSK 360
           RFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVALKSLFPSK
Sbjct: 301 RFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVALKSLFPSK 360

Query: 361 LTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSALTVPMD 420
           LTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSALTVPMD
Sbjct: 361 LTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSALTVPMD 420

Query: 421 NQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYISRSGAYEV 480
           NQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYISRSGAYEV
Sbjct: 421 NQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYISRSGAYEV 480

Query: 481 RY 482
           RY
Sbjct: 481 RY 482

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/483 (66%), Positives = 388/483 (80%), Gaps = 18/483 (3%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSS 60
           ML+ALF+FS +GEL++SK +R ++ +S++EIFRIQVINNLDVRSPVLTLGSTTFHH++S 
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60

Query: 61  SNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLENGVP 120
            NLWIVAV+RSNADSAAIWEFLYK +ALLEA+GL+SE  LKE+FMTCYELLD+VLE+GVP
Sbjct: 61  GNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLEDGVP 120

Query: 121 VDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXXXXXXXP 180
           VDTELSSVASKMS +P  S E     +  + S     +    + +FL             
Sbjct: 121 VDTELSSVASKMSVKPSASAER---INTFIESGNGGTNRILPVAQFLRARSSSSNLH--- 174

Query: 181 ANGDEHGD-PCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDLTTHL 239
              D H   P   PWR +GIKYKKNE+FL+VNERI+ILVSKDGSILKSYVDG+V+ TTHL
Sbjct: 175 ---DSHSKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHL 231

Query: 240 SGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQL 299
           SG P+C+FGLNDSLS+   T   D    +E    NKKAIPKAAAGSV LEDCKFHQCVQL
Sbjct: 232 SGMPVCRFGLNDSLSV--STPFGD----NESPTTNKKAIPKAAAGSVMLEDCKFHQCVQL 285

Query: 300 NRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVALKSLFPS 359
           ++F ++R I F+PPDGSFELM+YHVR+NLNLPFKITP+ ++   N +++YRV +KSLFPS
Sbjct: 286 DKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKAN-SIDYRVTIKSLFPS 344

Query: 360 KLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSALTVPM 419
           KLTAKDV LRIPVPP TVDC I+TSNGRC+FVPEE+A++WKF+KYQGLTEN+LSA  VPM
Sbjct: 345 KLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPM 404

Query: 420 DNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYISRSGAYE 479
            + S+LN+ QWS+PPMSL FEI+MFSNSGLVVRFF VSE D +Y  VKW+KY+S+SGAYE
Sbjct: 405 KD-SALNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSGAYE 463

Query: 480 VRY 482
           VRY
Sbjct: 464 VRY 466

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/487 (64%), Positives = 390/487 (80%), Gaps = 25/487 (5%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSS 60
           MLNALF++S +GEL++SK ++ ++++S++EIFRIQVINNLDVRSPVLTLGSTTFHHI+S+
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKSA 60

Query: 61  SNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLENGVP 120
            NLWIVAV+RSNADSAAIWEFLY+ N LLEA+ L SE  LKE FM CYELLD+VLE+G+P
Sbjct: 61  KNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLEDGLP 120

Query: 121 VDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFL----NKGXXXXXX 176
           VDTELSSVASKMS +P   ++N  +  E   +     +    + +FL    + G      
Sbjct: 121 VDTELSSVASKMSVKPNAGVDNFNMFAE---NGHGGTNRILPVSQFLRGRPSAGNLQDIA 177

Query: 177 XXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDLT 236
              P+N          PWR +GIKYKKNE+FL+VNERI+ILVSKDGSILKSYVDG+V+ T
Sbjct: 178 SEAPSN---------IPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEAT 228

Query: 237 THLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQC 296
           THLSG P+C+FGLND+LS+       D     EY+V NKKAIPKAAAGSV LEDCKFHQC
Sbjct: 229 THLSGMPVCRFGLNDALSVSTPFGDDD-----EYQVTNKKAIPKAAAGSVMLEDCKFHQC 283

Query: 297 VQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFS-VRSNNGAVEYRVALKS 355
           VQL++F ++R I F+ PDGSFELM+YHVR+NLNLPFK+TPI + VRSN  +++Y++ +KS
Sbjct: 284 VQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSN--SIDYQITIKS 341

Query: 356 LFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSAL 415
           LFPSKLTAKDV LRIPVPP TV C I+TSNG+C+FVPEE+A++WKF+KYQGLTEN++SA 
Sbjct: 342 LFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISAT 401

Query: 416 TVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYISRS 475
            VPM + S+LN++QW RPP+SL FEI+MFSNSGLVVRFF VSERD +Y  VKW+KY+S+S
Sbjct: 402 AVPMKD-STLNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKS 460

Query: 476 GAYEVRY 482
           GAYEVRY
Sbjct: 461 GAYEVRY 467

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/491 (62%), Positives = 383/491 (78%), Gaps = 24/491 (4%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRS- 59
           M+NA+F++S +GEL+VSKL  +++KRS+++IFRIQVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 60  -SSNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVL-EN 117
            S +LWIV V+R+NA+S AIWEFLYKFNA+L+AY L  EE LKE+FM CYE+LDVV+   
Sbjct: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGAG 120

Query: 118 GVPVDTELSSVASKMSRRPVVS--LENNPLTDELLMSAAANVDLG-FRMPKFL---NKGX 171
           G+P+DTEL S+ASK+S +P  S    + P +  +     +N+      MPKFL   N+  
Sbjct: 121 GIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTRNNRSM 180

Query: 172 XXXXXXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDG 231
                   P+N         +PWR +GIKYKKNE+FL VNE+INILVS+DGSILK+YVDG
Sbjct: 181 SQDLGTNYPSN---------FPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDG 231

Query: 232 SVDLTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDC 291
           ++D+TTHLSGTP+CQFGLNDS S++ G    D  ++   E  NKKA+PKAAAGSV LEDC
Sbjct: 232 TIDMTTHLSGTPICQFGLNDSPSVEFG----DSLWLDTQEFHNKKAVPKAAAGSVMLEDC 287

Query: 292 KFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRV 351
           KFHQCV L++FN +RII+FVPPDG+ ELM+Y VRDNLNLPFKITP+  V      VEYR+
Sbjct: 288 KFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPV--VTPCGSTVEYRI 345

Query: 352 ALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENT 411
            LKSLFP+KL+AKDV L IPVPPGTVDCKIN SNG+C+F  EENA++W+F KY GLTENT
Sbjct: 346 TLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENT 405

Query: 412 LSALTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKY 471
           LSA+TVP  + + L LQQW RPPMSL FEI+MFSNSGLVVR+F+VS++D  Y  VKW+KY
Sbjct: 406 LSAVTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKY 465

Query: 472 ISRSGAYEVRY 482
           IS+SG+YEVRY
Sbjct: 466 ISKSGSYEVRY 476

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/493 (62%), Positives = 379/493 (76%), Gaps = 22/493 (4%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRS- 59
           M++A+ +FS +GEL+V+K ++ ++K+S+++IFRIQVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60

Query: 60  -SSNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLE-N 117
            S +LW+VAV+RSNA+S AIWEFLYK N +++ YGL  E +LKE FM CYE+LD VLE  
Sbjct: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEEG 120

Query: 118 GVPVDTELSSVASKMSRRPVVSLENNPLT--DELLMSA-----AANVDLGFRMPKFLNKG 170
           G+PVDTEL+SV SKM+ +P   +  N L   D L MS+       +      MPKFL + 
Sbjct: 121 GIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKFLTRN 180

Query: 171 XXXXXXXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVD 230
                       G  +  P    WR  GIKYKKNE+ L+VNE+I+ILVS+DGSILKSYVD
Sbjct: 181 NRSMSQDL----GSNY--PSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVD 234

Query: 231 GSVDLTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYE-VKNKKAIPKAAAGSVQLE 289
           G++DLTTHLSG P+CQFGLNDSLS++ G      D ISE E   NKKAIPKAAAG V LE
Sbjct: 235 GTIDLTTHLSGMPICQFGLNDSLSVEFGD-----DSISEVEDFANKKAIPKAAAGRVMLE 289

Query: 290 DCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEY 349
           DCKFHQCV L++FN DR+I+FVPPDGS ELM+Y VRDNLNLPFK+TPI +       ++Y
Sbjct: 290 DCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDY 349

Query: 350 RVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTE 409
           RV LKSLFP KL+AKDV LRIPVPPGTVDC+IN SNG+C+FVPEE+A++WKF KY GLTE
Sbjct: 350 RVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTE 409

Query: 410 NTLSALTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWV 469
           NTLSA+TVP  + + L +QQW RPPMSL FEI+MFSNSGLVVR+FKVS++D  Y T KW+
Sbjct: 410 NTLSAVTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWI 469

Query: 470 KYISRSGAYEVRY 482
           KYIS+SG+YE+RY
Sbjct: 470 KYISKSGSYEIRY 482

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/488 (61%), Positives = 384/488 (78%), Gaps = 25/488 (5%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSS 60
           M+N + V++ KGEL+VSK  +   KRS+++IFR+QVINNLDVRSP+LTLGSTTFHHIRS+
Sbjct: 1   MINGVLVYTGKGELIVSKFSKSNAKRSISDIFRVQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  S--NLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLE-N 117
           S  +LW+VAVTRSNA+S AIWEFLYKF++LL A+GL++E +LKEEFMTCYELLD++L  +
Sbjct: 61  SRDHLWLVAVTRSNANSGAIWEFLYKFDSLLNAFGLDNETTLKEEFMTCYELLDLMLNVD 120

Query: 118 GVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXXXXX 177
           GVP+DTELSSV++KMS +P+ S+ +   +     S+  ++       KFLN+        
Sbjct: 121 GVPLDTELSSVSAKMSTKPLHSINSPSDSSLDNSSSPLSIS------KFLNRNNRSMSVD 174

Query: 178 XXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDLTT 237
                   + +P  YPWR +GIKYKKNEIFL++NE+I+ILVSKD +ILK+YVDG+VDLT+
Sbjct: 175 TM------NTEPSNYPWRPNGIKYKKNEIFLNINEKISILVSKDETILKAYVDGTVDLTS 228

Query: 238 HLSGTPLCQFGLNDSLSLDGGTL--SRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQ 295
           HLSGTP CQFGLNDSLS+D      S D  F      +N++ IP+A AG+V LEDCKFH+
Sbjct: 229 HLSGTPTCQFGLNDSLSVDEPNYYNSDDNGF------RNQQNIPRATAGTVVLEDCKFHE 282

Query: 296 CVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITP-IFSVRSNNGAVEYRVALK 354
           CV L++FN DRII+FVPPDG  ELM+YHVRDN+NLPFK+TP + + RS  G ++YR+ LK
Sbjct: 283 CVSLDKFNRDRIIKFVPPDGHIELMKYHVRDNINLPFKVTPNVINSRSRTG-LDYRITLK 341

Query: 355 SLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSA 414
           SLFPSKL+A DVVL+IPVP  TVDCK+N SNG+CRFVPEE+ ++WKFAKY GLTEN LSA
Sbjct: 342 SLFPSKLSANDVVLKIPVPSSTVDCKLNVSNGKCRFVPEESCIIWKFAKYNGLTENKLSA 401

Query: 415 LTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYISR 474
           +TV  ++ + L LQQW+RPP+SL FEI+MFSNSGLVVR+ K+ E+D  Y TVKW+KYISR
Sbjct: 402 VTVSSNDTTQLMLQQWARPPISLDFEIMMFSNSGLVVRYLKIMEKDQKYRTVKWIKYISR 461

Query: 475 SGAYEVRY 482
           SG+YEVRY
Sbjct: 462 SGSYEVRY 469

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/486 (59%), Positives = 365/486 (75%), Gaps = 15/486 (3%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSS 60
           M++A+ VFS +GEL+VSK  ++ +KRS+++IFRIQVINNLDVRSP+LTLGSTTF HIRS+
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60

Query: 61  ---SNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVL-E 116
               +LW+V+VTRSN +  A+WEFLYKF+ +LE YGLN+EE LKEEFM CYELLDV+L E
Sbjct: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120

Query: 117 NGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXXXX 176
           NG P+DT+ ++V  KMS +P     +    +   +S         ++PKFL +       
Sbjct: 121 NGTPMDTDPATVIKKMSVKP-----SKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQ 175

Query: 177 XXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDLT 236
                +          PWR  GI +KKNEIFL VNE+I+ILVSK+GSILKSYVDG++DL 
Sbjct: 176 ESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLV 235

Query: 237 THLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQC 296
           THLSGTP+CQFGLNDSLS+         D+I     KNKKAIPKAAAGSV LEDCKFHQC
Sbjct: 236 THLSGTPVCQFGLNDSLSVKNDDYGDSFDYI-----KNKKAIPKAAAGSVLLEDCKFHQC 290

Query: 297 VQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVALKSL 356
           V L +F+ DRII+FVPPDGS ELM+YHVR N+NLPFK++PI +  S+  AVEYR+ LKSL
Sbjct: 291 VSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSL 350

Query: 357 FPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSALT 416
           FPSKLTAK+V ++IPVPP T+DCKI+ SNG C+F PEE A+LW F KY GLTENTLSA+T
Sbjct: 351 FPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAVT 410

Query: 417 VPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYISRSG 476
           +   +   LN+QQW +PP+SL FEI+MFSNSGLVVR+F + E +  Y TVKW++Y+S+SG
Sbjct: 411 ITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESER-YKTVKWIRYVSKSG 469

Query: 477 AYEVRY 482
           +YE+RY
Sbjct: 470 SYEIRY 475

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/496 (58%), Positives = 376/496 (75%), Gaps = 19/496 (3%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRS- 59
           M++ + V+S +GEL+++K  ++++KRS+++IFR+QVINNLDVRSPVLTLGSTTFHHIRS 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSM 60

Query: 60  -SSNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLE-N 117
              NLW+V +TRSNA+SAAIWEFLYK ++++ AY L+ EE+LKEEFM  +E+LD++L  N
Sbjct: 61  RGDNLWLVTITRSNANSAAIWEFLYKLDSVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 118 GVPVDTELSSVASKMSRRP---VVSLENNPLTDELLMSAAANVDLG--FRMPKFLNKGXX 172
           G+P+DTEL+SV ++MS +P   V  L  +P + ++L S ++   +G     PKFL K   
Sbjct: 121 GIPIDTELNSVIAQMSVKPIRNVGGLLESPDSIDMLSSTSSPSSVGGELHFPKFLKKRSS 180

Query: 173 XXXXXXXPANGDEHGD---PCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYV 229
                     GD H D        WR  GI +KK+E+FL VNER+NILVS+DGSILKSYV
Sbjct: 181 SFL-----GQGDSHSDFSDGNKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSILKSYV 235

Query: 230 DGSVDLTTHLSGTPLCQFGLNDSLSL---DGGTLSRDLDFISEYEVKNKKAIPKAAAGSV 286
           DG++D+TTHLSGTP+C+FGLNDSL +   D        D  S    +NK   PKAAAGSV
Sbjct: 236 DGTIDITTHLSGTPVCRFGLNDSLGMQSEDQENWLSQQDQHSHNGFENKNCFPKAAAGSV 295

Query: 287 QLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGA 346
            LEDCKFH+CV +++FN + II FVPPDGS ELM+YHVRDN+NLPFKITPI +  + +  
Sbjct: 296 LLEDCKFHECVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNINLPFKITPIVAHSARDNE 355

Query: 347 VEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQG 406
           V+YR+ LKSLFP KL+AKDV+L IPVPP TVDCKI+ SNG C+FVPEENA++W+F K+ G
Sbjct: 356 VDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVPEENAMIWRFNKFNG 415

Query: 407 LTENTLSALTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTV 466
           LTENTLSA+TV   + + L+LQQW+RPPMSL FE++MFSNSGLVVR+F +S RD  +  V
Sbjct: 416 LTENTLSAVTVSTSDTTQLSLQQWTRPPMSLDFEVMMFSNSGLVVRYFTISSRDSKHRAV 475

Query: 467 KWVKYISRSGAYEVRY 482
           KW+KYIS+SG+YEVRY
Sbjct: 476 KWIKYISKSGSYEVRY 491

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/499 (58%), Positives = 371/499 (74%), Gaps = 25/499 (5%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSS 60
           M+NAL +F+ +GELVVSKL + ++KRS+A+IFRIQVINNLDVRSP+LTLGSTTFHHI+S+
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIKST 60

Query: 61  --SNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVL--E 116
              NLWIVAV+R+N DSAAIWEFLYK ++LL++YGLN EE LKEEFM  +ELLDV++   
Sbjct: 61  RGDNLWIVAVSRNNVDSAAIWEFLYKLDSLLDSYGLNHEEYLKEEFMIVHELLDVMMCGS 120

Query: 117 NGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANV------DLGFRMPKFLNKG 170
            G+P+ TE S V S+MS +P  S+     +     +  +N       DL    PK L + 
Sbjct: 121 GGIPMLTENSLVISRMSVKPSKSILEAQNSGNGSSNTNSNNNNNNVPDLLMSGPKLLRRN 180

Query: 171 XXXXXXXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVD 230
                                + WR  GI +KKNE+ L VNERINILVSKDGS+LK+YVD
Sbjct: 181 SASLSQDLSILTD--------FKWRPKGIVHKKNEVILHVNERINILVSKDGSVLKAYVD 232

Query: 231 GSVDLTTHLSGTPLCQFGLNDSLSLDG------GTLSRDLDFIS-EYEVKNKKAIPKAAA 283
           GS+DL THLSGTP+CQFGLNDSLS+ G      G+ + +  F    ++  +KK +  A+ 
Sbjct: 233 GSIDLETHLSGTPICQFGLNDSLSVSGVDSDMYGSHNHNHHFGDVNFDKTDKKQLSMASV 292

Query: 284 GSVQLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSN 343
           GSV LEDCKFHQCV L++F+ DRII+FVPPDGS ELM+YHVRDNLNLPFK++PI +   N
Sbjct: 293 GSVILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKVSPIVTNTRN 352

Query: 344 NGAVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAK 403
             A+EYR+ +KSLFP +L+AK+V L IPVPP T+DCKIN +NG C+F+PEE+A++W+F K
Sbjct: 353 GTALEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEESAMIWRFNK 412

Query: 404 YQGLTENTLSALTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSY 463
           + GLTENTLSA+T+P  + + L+LQQWS+PPMSL FEILMFSNSGLVVR+F ++ERD  Y
Sbjct: 413 FNGLTENTLSAVTIPTKDNTQLSLQQWSKPPMSLDFEILMFSNSGLVVRYFTITERDQKY 472

Query: 464 HTVKWVKYISRSGAYEVRY 482
             VKW+KYISRSG+YE+RY
Sbjct: 473 KAVKWIKYISRSGSYEIRY 491

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/496 (58%), Positives = 377/496 (76%), Gaps = 19/496 (3%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRS- 59
           M++ + V+S +GELV++K  ++++KRS+++IFR+QVINNLDVRSPVLTLGSTTFHHIRS 
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60

Query: 60  -SSNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLE-N 117
              NLW+V +TRSNA+SAAIWEFLYK +A++ AY L+ EE+LKEEFM  +E+LD++L  N
Sbjct: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 118 GVPVDTELSSVASKMSRRPVVS---LENNPLTDELLMSAAANVDLG--FRMPKFLNKGXX 172
           G+P+DTEL+SV ++MS +PV +   L ++P  +++L S+++          PKFL K   
Sbjct: 121 GIPIDTELNSVIAQMSVKPVRNMGGLLDSPDGNDVLSSSSSPTSSAGELHFPKFLTKRSS 180

Query: 173 XXXXXXXPANGDEHGD---PCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYV 229
                     GD   D        WR  GI +KK+E+FL VNERINILVS+DGSILKSYV
Sbjct: 181 SFL-----GQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILKSYV 235

Query: 230 DGSVDLTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEY---EVKNKKAIPKAAAGSV 286
           DG++D+TTHLSGTP+C+FGLNDSL +      + L     +   +  NK  IPKAAAGSV
Sbjct: 236 DGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQRHSGSDFGNKNFIPKAAAGSV 295

Query: 287 QLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGA 346
            LEDCKFH+CV L++FN + II FVPPDGS ELM+YHVRDN+NLPFK+TPI +  + +  
Sbjct: 296 LLEDCKFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNINLPFKVTPIVTHSTRDNE 355

Query: 347 VEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQG 406
           ++YR+ LKSLFP KL+AKDVVL IPVPP TVDCKI+ SNG C+FVPEENA++W+F KY G
Sbjct: 356 IDYRITLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNG 415

Query: 407 LTENTLSALTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTV 466
           LTENTLSA+TV   + + LNLQQW+RPP+SL FE++MFSNSGLVVR+F +S +D  +  V
Sbjct: 416 LTENTLSAVTVSTSDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFTISGKDSKHRAV 475

Query: 467 KWVKYISRSGAYEVRY 482
           KW+KYIS++G+YEVRY
Sbjct: 476 KWIKYISKAGSYEVRY 491

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/493 (57%), Positives = 374/493 (75%), Gaps = 13/493 (2%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRS- 59
           M++ + ++S +GELV++K  ++++KRS+++IFR+QVINNLDVRSPVLTLGSTTFHHIRS 
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60

Query: 60  -SSNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLE-N 117
              NLW+V +TRSNA+SAAIWEFLYK + ++ AY L+ EE+LKEEFM  +E+LD++L  N
Sbjct: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 118 GVPVDTELSSVASKMSRRPVVS---LENNPLTDELLMSAAANVDLG--FRMPKFLNKGXX 172
           G+P+DTEL+SV ++MS +PV +   L ++P  +++L S+++   +      PKFL K   
Sbjct: 121 GIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDMLSSSSSPSSVSGELHFPKFLKKSSS 180

Query: 173 XXXXXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGS 232
                   A+    G+     WR  GI +KK+E+FL VNER+NILVS+DGSILKSYVDG+
Sbjct: 181 SFLGQGDSASDFYDGNKIT--WRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGT 238

Query: 233 VDLTTHLSGTPLCQFGLNDSLSLDGGTLSRDL---DFISEYEVKNKKAIPKAAAGSVQLE 289
           +D+TTHLSGTP+C+FGLNDSL +      + L      S    ++K  I KAAAGSV LE
Sbjct: 239 IDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLE 298

Query: 290 DCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEY 349
           DCKFH+CV L++FN +  I FVPPDGS ELM+YHVRDN+NLPFKITPI +  + +  ++Y
Sbjct: 299 DCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDY 358

Query: 350 RVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTE 409
           R+ LKSLFP KL+AKDV L IPVPP TVDCKI+ SNG C+FVPEENA++W+F KY GLTE
Sbjct: 359 RITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTE 418

Query: 410 NTLSALTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWV 469
           NTLSA+TV   + + LNLQQW+RPPMSL FE++MFSNSGLVVR+F +  +D  +  VKW+
Sbjct: 419 NTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWI 478

Query: 470 KYISRSGAYEVRY 482
           KYISRSG+YEVRY
Sbjct: 479 KYISRSGSYEVRY 491

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/496 (57%), Positives = 372/496 (75%), Gaps = 19/496 (3%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRS- 59
           M++ + V+S +GEL+++K  ++++KRS+++IFR+QVINNLDVRSPVLTLGSTTFHHIRS 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSK 60

Query: 60  -SSNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLE-N 117
              NLW+V +TRSNA+SAAIWEFLYK +A++ AY L+ EE+LKEEFM  +E+LD++L  N
Sbjct: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 118 GVPVDTELSSVASKMSRRPVVS----LENNPLTDELLMSAAANVDLG-FRMPKFLNKGXX 172
           G+P+DTEL+SV ++MS +P+ +    L+    +D L  S++ +   G    PKFL K   
Sbjct: 121 GIPIDTELNSVVARMSVKPMRNTGGLLDGADGSDILSSSSSPSSAGGELHFPKFLKKSSS 180

Query: 173 XXXXXXXPANGDEHGD---PCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYV 229
                     GD   D        WR++GI +KK+E+FL VNER+NILVS+DGSILKSYV
Sbjct: 181 SFL-----GQGDSTSDFYDSNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILKSYV 235

Query: 230 DGSVDLTTHLSGTPLCQFGLNDSLSL---DGGTLSRDLDFISEYEVKNKKAIPKAAAGSV 286
           DG++D+ THL+GTP+C+FGLNDSL +   D           S  +  NK  +PKAAAGSV
Sbjct: 236 DGTIDIVTHLNGTPVCRFGLNDSLGMQSEDEKNWLAQQHQHSRSDFGNKNFLPKAAAGSV 295

Query: 287 QLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGA 346
            LEDCKFH+CV + +FN + II F+PPDGS ELM+YHVRDN+NLPFKITPI S  + +  
Sbjct: 296 LLEDCKFHECVSIEKFNKNHIIEFIPPDGSMELMKYHVRDNINLPFKITPIVSHSTRDNE 355

Query: 347 VEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQG 406
           ++YR+ LKSLFP KL+AKDV+L IPVPP TVDCKI+ SNG C+FVPEENA++W+F KY G
Sbjct: 356 IDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNG 415

Query: 407 LTENTLSALTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTV 466
           LTENTLSA TV   + + L+ QQW+RPPMSL FE++MFSNSGLVVR+F +S +D  +  V
Sbjct: 416 LTENTLSAATVSTSDTTQLSFQQWTRPPMSLDFEVMMFSNSGLVVRYFTISGKDSKHRAV 475

Query: 467 KWVKYISRSGAYEVRY 482
           KW+KYIS+SG+YEVRY
Sbjct: 476 KWIKYISKSGSYEVRY 491

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/483 (60%), Positives = 359/483 (74%), Gaps = 20/483 (4%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSS 60
           M++ALF++S +G+L++SKLI+D IK  V+EIFRIQVINNLDVRSP+LTLGSTTFHHIRS+
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  SNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLENGVP 120
             LW+V V+R N DSA IWEFLY FN LLE Y +NSE+SL+ +FM CYE+LD+VL+NG+P
Sbjct: 61  GGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLDNGIP 120

Query: 121 VDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXXXXXXXP 180
            DTEL+ +   +S++P+   EN   +D++L + +  V  G R     N G          
Sbjct: 121 RDTELTHIMPYISKKPLS--ENLLGSDDILNTPSWLVKAGARGMSSENLGLTSK------ 172

Query: 181 ANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDLTTHLS 240
                  D C   WRS GI+YKKNE++LDV E I+ILV+KDG+ILKSYVDGSV    HLS
Sbjct: 173 -------DMCL--WRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLS 223

Query: 241 GTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLN 300
           G P+CQFG ND LS    T S   D  +E E    KAI  A  GSV LEDCKFHQCVQL+
Sbjct: 224 GMPVCQFGFNDYLSPSSNTQSSGNDGWAEEE-NGTKAIKNAITGSVILEDCKFHQCVQLD 282

Query: 301 RFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVALKSLFPSK 360
           +F+ +R+IRFVPPDG FELM+YHVRDNLNLPFK+TP+ +      +VEYR+ LKSLFPSK
Sbjct: 283 KFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGK-SVEYRITLKSLFPSK 341

Query: 361 LTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSALTVPMD 420
           L AKDV L IP PP TV+ KIN S+G+ +F+PEENA++WK  KY GLTEN  SA+ VPM 
Sbjct: 342 LCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMG 401

Query: 421 N-QSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYISRSGAYE 479
           N   SLNL+QWSRPP+S+ FEI MFSNSGLVVR+ KV E+D +Y+TVKWVKYIS+SGAYE
Sbjct: 402 NGNDSLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSGAYE 461

Query: 480 VRY 482
           VRY
Sbjct: 462 VRY 464

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/504 (58%), Positives = 364/504 (72%), Gaps = 40/504 (7%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSS 60
           M+N + ++S +GEL+VSKL + T+KRS+A+IFRIQVINNLDVRSP+LTLGSTTFHHIRSS
Sbjct: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60

Query: 61  S---NLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLEN 117
               NLW+VA TR+NA+SAAIWEFLYK +++L  YGLN EE LKEEFM  +ELLDV+L +
Sbjct: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120

Query: 118 -GVPVDTELSSVASKMSRRPVVSLENN--PLTDELLMSAAANVDLGFRMPKFLNKGXXXX 174
            G+P++TE S V +KMS +P     NN   L D  L S   N      MPKFL +     
Sbjct: 121 CGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNN---EISMPKFLKRNDSSQ 177

Query: 175 XXXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVD 234
                 +  D       + WR   IK+KKNE+ L VNE+INILV+KDGSILK+YVDGS+D
Sbjct: 178 SHDSNFSFND-------FSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSID 230

Query: 235 LTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKN----------------KKAI 278
           L T LSGTP+CQFGLNDSL+L     S D    SEY  +N                 K +
Sbjct: 231 LQTRLSGTPVCQFGLNDSLTLG----SND----SEYSSRNGRTGNNKSSMLDSNLSNKVL 282

Query: 279 PKAAAGSVQLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIF 338
            KA+ G+V LEDCKFHQCV L++F+ +RII+FVPPDGS ELM+YH+R+NLNLPFKITPI 
Sbjct: 283 SKASVGNVILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIV 342

Query: 339 SVRSNNGAVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVL 398
           +      A++YR+ALKSLFP +L+AK VVL IPVPPG +DC I+ SNG C+FVP ENA++
Sbjct: 343 TNSVTGDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMV 402

Query: 399 WKFAKYQGLTENTLSALTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSE 458
           WKF KY GLTENTLSA+TVP    +   LQQW+RPPMSL FEILMFSNSGLVVR+F +SE
Sbjct: 403 WKFNKYNGLTENTLSAVTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISE 462

Query: 459 RDHSYHTVKWVKYISRSGAYEVRY 482
              +Y  VKW+KY+S+SG+YEVR+
Sbjct: 463 GHQNYKAVKWIKYVSKSGSYEVRF 486

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/486 (54%), Positives = 363/486 (74%), Gaps = 17/486 (3%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSS 60
           M+N + ++S +G+L+V  L++ ++KR++++IF+IQVIN+L+++SP+LTLGSTTFHHIRSS
Sbjct: 1   MINGVLIYSSRGDLIVCDLLKSSLKRTISDIFKIQVINSLEMKSPILTLGSTTFHHIRSS 60

Query: 61  S--NLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVL-EN 117
           S   LWIVA+TRSNA+S  IWEFLYK +++L AY LN+EE L E+FM  YE++DV+L  N
Sbjct: 61  SESKLWIVAITRSNANSGVIWEFLYKLDSMLTAYDLNNEEKLMEKFMVYYEMIDVMLTSN 120

Query: 118 GVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXXXXX 177
            +P++TELSS+ASK+S R   ++ N+P  ++       N + G  +PKFL +        
Sbjct: 121 AMPINTELSSIASKISYRLPKTISNSPTNEK-------NNNNGLSIPKFLTRNSRSMSQE 173

Query: 178 XXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDLTT 237
                  +       PWR +GIKYKKNE+FL VNE+INILVSKD +ILK+YVDGS+DL +
Sbjct: 174 FSNITQSD------IPWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDGSIDLVS 227

Query: 238 HLSGTPLCQFGLNDSLSLDGGTLS-RDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQC 296
           HLSGTP+CQFGLND LS+ G  +S R  +F  ++      +  ++++ SV++EDC FHQC
Sbjct: 228 HLSGTPICQFGLNDYLSMTGNNISNRGDEFRHDFMDDEDLSTGRSSSSSVKIEDCTFHQC 287

Query: 297 VQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVALKSL 356
           V L++FN +R+I FVPPDGSFELMRYHVRD+LN+PFK+TP  S+ S+  ++ Y++ LKSL
Sbjct: 288 VSLDKFNDERLINFVPPDGSFELMRYHVRDDLNIPFKVTPRVSISSSRCSMRYKIILKSL 347

Query: 357 FPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSALT 416
           FP+ L+A D +L+IP+PPGTVDCKIN S+G+C F   +N  +WKF KY+GLTEN L   T
Sbjct: 348 FPTSLSAADAMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNKYKGLTENELILET 407

Query: 417 VPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYISRSG 476
           VP  +   L+LQQW+RPPMS+ FEI+MFSNSGLVV++ KV ER   Y  VKW+KY+S+SG
Sbjct: 408 VPSSSTDILSLQQWTRPPMSMNFEIIMFSNSGLVVKYLKVMERVQKYRPVKWIKYVSKSG 467

Query: 477 AYEVRY 482
           +YE+RY
Sbjct: 468 SYEIRY 473

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/488 (51%), Positives = 359/488 (73%), Gaps = 13/488 (2%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSS 60
           M+NA+ +F+ +GEL+V K+ + ++KR++++IFR+QVINN ++RSP+LTLGSTTFH IR++
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFRVQVINNDNIRSPILTLGSTTFHFIRTT 60

Query: 61  --SNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLE-N 117
             S LW+VAVTRSNADS AIWE+LYK N+L+E YGL  E+ LK+EF+ C+ELLD+ L  N
Sbjct: 61  AGSKLWLVAVTRSNADSGAIWEYLYKLNSLMEVYGLTHEDILKDEFIVCHELLDITLGMN 120

Query: 118 GVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANV---DLGFRMPKFLNKGXXXX 174
           G+P+DTELSSV  KM+ +P   L ++    ++L S+   +        MPKFL++     
Sbjct: 121 GLPMDTELSSVIGKMTLKPAQVLTSSADRSDILASSVTTLGHNSTPISMPKFLSRNSNRS 180

Query: 175 XXXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVD 234
                    +    P   PWRS  IKYKKNE+ ++V E+IN+LV KD +IL++YVDG++D
Sbjct: 181 VTQEF----ESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDGTID 236

Query: 235 LTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFH 294
           +T HLSG P+CQ G+ND  ++ GG    +  + +E    N+ A+P  +   V LE  KFH
Sbjct: 237 ITAHLSGMPMCQIGMNDLSTIQGG---ENAHWTNEDRASNRDAMPDVSGDRVILEGSKFH 293

Query: 295 QCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVALK 354
           QCV L+++N D +I F+PPDG FELM+YHV +NLNLPF+ITP  ++ S+  A+ Y + LK
Sbjct: 294 QCVALDKYNKDNVIWFIPPDGQFELMKYHVSNNLNLPFRITPQVTLTSHGTALSYAIKLK 353

Query: 355 SLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSA 414
           SLFP KL+A++VVLRIPVPPGT+DCKIN S+G+C+F+PEEN ++W F ++ G TEN L+A
Sbjct: 354 SLFPRKLSAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVWSFHRFNGSTENHLNA 413

Query: 415 LTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYISR 474
            TVP  + +S +++QW+RPPMSL F++LMFSN+GL+VR+ KV E++  Y+T+KW+KYIS 
Sbjct: 414 QTVPTQSIASQSIKQWTRPPMSLDFKVLMFSNTGLIVRYLKVQEKNMHYNTIKWIKYISA 473

Query: 475 SGAYEVRY 482
           +G+YEVRY
Sbjct: 474 AGSYEVRY 481

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  528 bits (1360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/488 (53%), Positives = 344/488 (70%), Gaps = 20/488 (4%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRS- 59
           M+NA+ V+S +GEL+VSK+ + T+KRSV +IFR+QVIN+LDVRSP+LTLGSTTFH++R+ 
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLDVRSPILTLGSTTFHYVRTP 60

Query: 60  SSNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLENG- 118
              LW+V+V+R+N +SAA WEFLYKF  +L AY L+SEE LKEEFM  +ELLD ++E G 
Sbjct: 61  GEGLWVVSVSRNNENSAATWEFLYKFATMLAAYRLDSEEVLKEEFMLAWELLDTMVEGGG 120

Query: 119 VPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXXXXXX 178
           +P +T+   + S MS +P +S  +         +  +    G   P+ L++         
Sbjct: 121 IPSETDPHRIISAMSVKPAMSPVDVRADARQQQTTTSTGAFGHAFPQLLHRASNPGGISI 180

Query: 179 XP-ANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDLTT 237
            P A GD             G + K+NEI + V E I+ILVSKDGSILK+YVDG +DLTT
Sbjct: 181 LPHATGD-------------GAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGIDLTT 227

Query: 238 HLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCV 297
            L G  +CQFGLNDSLS D  + S+     S+        +  A  G+V L DCKFHQCV
Sbjct: 228 KLEGAAVCQFGLNDSLSTDNSSNSKWDPLRSKETQGTNLEMKNAHVGTVLLRDCKFHQCV 287

Query: 298 QLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVALKSLF 357
            L RF+ DRIIRF PP+G+ ELM+YHVRDNLNLPFK+T +    +NN   +YRV +KSLF
Sbjct: 288 SLERFDRDRIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVIPTANN-ETDYRVTIKSLF 346

Query: 358 PSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSALTV 417
           P KL+AK+V +RIPVPPGT+DCKIN SNG C+F+PEENA++WKF KY GLTEN LSA+TV
Sbjct: 347 PGKLSAKNVTMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNGLTENKLSAITV 406

Query: 418 PMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHS---YHTVKWVKYISR 474
           P  + + L LQQWSRPP+SL FEILM+SN+GLVVR+F V ++ ++   + TVKW+KY+S 
Sbjct: 407 PTRDTTQLALQQWSRPPISLDFEILMYSNTGLVVRYFTVLDKHNNNTKFKTVKWIKYVSH 466

Query: 475 SGAYEVRY 482
           SG+YEVRY
Sbjct: 467 SGSYEVRY 474

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  520 bits (1338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/491 (51%), Positives = 351/491 (71%), Gaps = 25/491 (5%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHH-IRS 59
           ML+A+F+++ KG+L++SKLI+D +KRS+A++FR QVIN+  VRSP+LTLGSTTF H IR 
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60

Query: 60  SSN---LWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLE 116
           SS+   +W+VAV+RSN DS+ IWE+L+K   L+EA+G+N E+ LK+EFM  YE+L++ LE
Sbjct: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE 120

Query: 117 NGVPVDTELSSVASKMSRRPVV--SLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXX 174
           NG+P  T+L+ +  ++SR+P+   ++  +P  D+ L  + +N+    + PK   +     
Sbjct: 121 NGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFL--SGSNI---LKAPKLSKRSSSSI 175

Query: 175 XXXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVD 234
                          C  PWR SG+KYKKNE++LD+NE+I ILV KDGSI+KS+VDGSVD
Sbjct: 176 ALSSLSE--------C--PWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVD 225

Query: 235 LTTHLSGTPLCQFGLNDSLSLDGGTLSR--DLDFISEYEVKNKKAIPKAAAGSVQLEDCK 292
             +HLSG PLCQ GLND+ S+ G   S    ++ +SEY++KNKKAIP AAAGSV LEDCK
Sbjct: 226 CVSHLSGMPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDIKNKKAIPNAAAGSVILEDCK 285

Query: 293 FHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVA 352
           FHQCVQLN++  + +I+FVPPDG F+LM+Y V DN+N+PF + P   +   N  + Y+V 
Sbjct: 286 FHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEI-VKNSTLNYKVT 344

Query: 353 LKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTL 412
           L+SLFPS ++AKDV ++IPVPP T+ C  N S G+C++   E  ++WK+ KY+G TENTL
Sbjct: 345 LRSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTL 404

Query: 413 SA-LTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKY 471
           S  + +P  +    +L +WSRPP+S+ FEI+MFSNSGLVVR  K  E   +Y  VKW+KY
Sbjct: 405 SGKVAIPATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKY 464

Query: 472 ISRSGAYEVRY 482
           IS SGAYE+RY
Sbjct: 465 ISHSGAYEIRY 475

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  475 bits (1222), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 236/451 (52%), Positives = 308/451 (68%), Gaps = 31/451 (6%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSS 60
           M++A FVF+ +G L+VSKLI    K S++E+FR+QVIN L++RSPVLTLGSTTF HIR+S
Sbjct: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60

Query: 61  SNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLENGVP 120
             LW+V V R NADSAAIWEFLY  N LL+AY +N+EE+L ++FM CYELLDVVL++G+P
Sbjct: 61  GGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLDSGLP 120

Query: 121 VDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXXXXXXXP 180
            DTELS +   +SR+P      +   D+ L SA        R+ +   K           
Sbjct: 121 QDTELSHIVPLLSRKPATG--ESASGDDFLNSA--------RLRRTGTKNVSVETL---- 166

Query: 181 ANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDLTTHLS 240
               +H      PWR  GIKYKKNE++LDV E++++LV++DG+ILK+YVDG+V  T HLS
Sbjct: 167 ----DHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLS 222

Query: 241 GTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLN 300
           G PLC FG NDS SL   +  R             +        SV LEDCKFHQCVQLN
Sbjct: 223 GMPLCHFGFNDSQSLRQRSPRRQY---------APRVFGTDERESVVLEDCKFHQCVQLN 273

Query: 301 RFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVALKSLFPSK 360
           +F+ +R+IRFVPPDG FELM+YH+RD+L  PFK+TP+ S + N  ++EYR+ L+SLFP+K
Sbjct: 274 KFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVS-KVNERSIEYRITLQSLFPTK 332

Query: 361 LTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSALTVPMD 420
           L+AKDV L IP PP T+  K+N S G+C+FVPEENA++WK  K+ GLTENTLSA+T+  D
Sbjct: 333 LSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTI-AD 391

Query: 421 NQSSLN--LQQWSRPPMSLTFEILMFSNSGL 449
            Q      L QW RPP+S+  EI+MFS + L
Sbjct: 392 EQGHYAQVLDQWPRPPISMKLEIMMFSTAAL 422

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  417 bits (1072), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 222/499 (44%), Positives = 308/499 (61%), Gaps = 88/499 (17%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSS 60
           M++A+ +++ +GEL+VSKL R+ IKRS++EIFRIQVINN +VRSP+LTLGSTTFHHIRS+
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFRIQVINNFNVRSPILTLGSTTFHHIRST 60

Query: 61  SN------LWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLD-V 113
           +N      LW+V V R+NA+SAAIWEFL K N +L+ YG+ SE  LK+EFMT +E+LD +
Sbjct: 61  ANDPTDDELWLVCVNRNNANSAAIWEFLQKLNLILQQYGITSESKLKDEFMTVHEILDNM 120

Query: 114 VLENGVPVDTELSSVASKMSRRPVVSLENNPLT--------DELLMSAAANVDLGFRMPK 165
           +L  G+  +T+L S+  KMS +P+        T        + +L +  AN  L      
Sbjct: 121 LLGTGIIQNTDLKSIVDKMSVKPISRTNETTSTQTGFLKRRNTILTTPGANFSL------ 174

Query: 166 FLNKGXXXXXXXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSIL 225
                         P N  +               +KKNEIF  VNE +N+LVSKDGSIL
Sbjct: 175 -------------IPTNRHD--------------AHKKNEIFFFVNESMNLLVSKDGSIL 207

Query: 226 KSYVDGSVDLTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGS 285
           K+YVDG +++ +HL+G P CQF L D                                  
Sbjct: 208 KNYVDGKIEIKSHLNGNPTCQFELVDD--------------------------------Q 235

Query: 286 VQLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDN-LNLPFKITPIFSVRSNN 344
            ++ D KF QC++  +    R +R    DG  E++ YHVRD+ +N+PFKITPI S   + 
Sbjct: 236 TKITDFKFDQCIEKVQ---SRTVRVAATDGELEIVNYHVRDDKINIPFKITPIVSTVKD- 291

Query: 345 GAVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKY 404
             V+YR++LKSLFP  L+A DVVL IPVPP T+DCKIN SNG C+F  E+NAV+W F K+
Sbjct: 292 -TVDYRISLKSLFPKNLSATDVVLTIPVPPNTIDCKINVSNGHCKFKAEQNAVIWTFNKF 350

Query: 405 QGLTENTLSALTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERD-HSY 463
            G TENTLSA+T+  D +  +NL+ W+RP + LTFEI M+S SGL++R   ++++D   Y
Sbjct: 351 NGSTENTLSAITIA-DGRQIMNLESWTRPSIQLTFEITMYSISGLLLRNLMITDKDKRRY 409

Query: 464 HTVKWVKYISRSGAYEVRY 482
              +W+KYISR+G+YE+R+
Sbjct: 410 KASRWIKYISRAGSYEMRF 428

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  217 bits (552), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 155/491 (31%), Positives = 253/491 (51%), Gaps = 59/491 (12%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRS----PVLTLGSTTFHH 56
           M +A++    KG  ++S+  RD I  +  + F   ++ +L+  S    P LT  +T +  
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFA-SLLADLEEESSVIPPCLTYNNTQYLF 59

Query: 57  IRSSSNLWIVAVT---RSNADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLD 112
           I+ S ++++VA+T   R+N   A ++ FLYK   +L  Y     EES+++ ++  YELLD
Sbjct: 60  IQHS-DIYLVAITNLLRTNI--AEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLD 116

Query: 113 VVLENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXX 172
            +++ G+P  TE   +   ++++              L+ AA       R P  L     
Sbjct: 117 ELMDYGIPQITETKMLKQYITQKSFK-----------LVKAAKKKQNAARPPSALTDSVS 165

Query: 173 XXXXXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGS 232
                                WRS GIKYKKNE FLD+ E IN+L+++ G IL+S + G 
Sbjct: 166 ---------------------WRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGV 204

Query: 233 VDLTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCK 292
           V + + LSG P  + G+ND      G  S+ L   +E +  N     K     ++LED K
Sbjct: 205 VKIKSRLSGMPDLKLGINDK-----GIFSKQL---TEDDTNNNATSKK--QNKIELEDLK 254

Query: 293 FHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVA 352
           FHQCV+L++F T++II F+PPDG FELM Y +  ++  P     +     +N  +E    
Sbjct: 255 FHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIK-PLIWCDMNVQVHSNSRIEIHCR 313

Query: 353 LKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTL 412
            K+    K TA +V + IPVP          S+G  ++VPE++A+LWK   + G  E ++
Sbjct: 314 AKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSM 373

Query: 413 SA-LTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKY 471
           +A L +P  +  S  +Q  ++ P+ + F+I  F+ SG+ VR+ K++E    Y +  WV+Y
Sbjct: 374 AAELCLPSTSSKSEEVQ--NKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRY 431

Query: 472 ISRSG-AYEVR 481
           I++SG  Y +R
Sbjct: 432 ITQSGDDYTIR 442

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  215 bits (548), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 150/483 (31%), Positives = 254/483 (52%), Gaps = 52/483 (10%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVI---NNLDVRSPVLTLGSTTFHHI 57
           M + ++    KG+L++S+  +D I  S  E F   +I      +V  P  +     +  I
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 58  RSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLDVVL 115
           + + +L+I+ +TRS  A+ A ++ FL+    +L+ Y  +  EES+K+ F+  YELLD V+
Sbjct: 61  QHN-DLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVM 119

Query: 116 ENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXXX 175
           ++G+P  T+     +KM R+ +        + +L+ SA    ++  R P  L        
Sbjct: 120 DSGIPQITD-----TKMLRQYITQK-----SFKLIRSAKKKKNV-VRPPSSLT------- 161

Query: 176 XXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDL 235
                          A  WR  GIKYKKNE FLDV E IN+++++ G +L+S + G V +
Sbjct: 162 --------------TAVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKVKV 207

Query: 236 TTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQ 295
            + LSG P  + GLND           + +  S+  +  KK+       +++LED KFHQ
Sbjct: 208 RSRLSGMPDLKLGLNDKGIFTQSNEEEEDEPSSQPSITRKKS-------NIELEDLKFHQ 260

Query: 296 CVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVALKS 355
           CV+L++F  ++II F+PPDG FELM Y +   +           V S +  VE     K+
Sbjct: 261 CVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDAKIQVHSRS-RVEVHCRAKA 319

Query: 356 LFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSA- 414
              +K TA +V + IPVP      K   S+G  ++VPE+NA+LWK   + G  + +++A 
Sbjct: 320 QIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAE 379

Query: 415 LTVP-MDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYIS 473
           + +P +++ +  N ++    P+ + F+I  F+ SG+ VR+ K++E    Y++  WV+YI+
Sbjct: 380 MGLPSVNDIADYNFKR----PVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYIT 435

Query: 474 RSG 476
           +SG
Sbjct: 436 QSG 438

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  215 bits (547), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 146/488 (29%), Positives = 247/488 (50%), Gaps = 56/488 (11%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFR---IQVINNLDVRSPVLTLGSTTFHHI 57
           M + ++    KG++++S+  RD +  S  E F    ++      +  P LT     +  I
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 58  RSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLDVVL 115
           + + +++++ ++RS + + A ++ FLYK   +L  Y     EES+++ F+  YELLD +L
Sbjct: 61  QHN-DIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLDEML 119

Query: 116 ENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXXX 175
           + G+P  TE   +   ++++          + +L+ SA  + ++  R P  L K      
Sbjct: 120 DYGIPQITETKMLKQYITQK----------SYKLIKSAKKSKNV-IRPPSQLTKSVS--- 165

Query: 176 XXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDL 235
                             WR  GI YKKNE FLDV E IN+L++  G +L+S + G V++
Sbjct: 166 ------------------WRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVNV 207

Query: 236 TTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQ 295
            + LSG P  + GLND      G  +      S    + KK+       +++LED KFHQ
Sbjct: 208 RSRLSGMPDLKLGLNDK-----GIFTSVESASSSEATEGKKS-------NIELEDLKFHQ 255

Query: 296 CVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVALKS 355
           CV+L++F  ++II F+PPDG FELM Y +   +           V S +  +E     K+
Sbjct: 256 CVRLSKFENEKIITFIPPDGDFELMNYRLSTPIKPLIWCDAKIQVHSQS-RIEIHCRAKA 314

Query: 356 LFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSA- 414
               K TA +V + IPVP      K   S+G  ++VPE++A+LWK   + G  E + +A 
Sbjct: 315 QIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWKIKTFNGGKEYSFAAQ 374

Query: 415 LTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYISR 474
           L +P    + +     ++ P+ + F+I  F+ SG+ VR+ K++E    Y +  WV+YI++
Sbjct: 375 LGLPSMTDAEV---PRAKRPIQVKFQIPYFTTSGIQVRYLKINEPKLQYQSYPWVRYITQ 431

Query: 475 SG-AYEVR 481
           SG  Y +R
Sbjct: 432 SGDDYTIR 439

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  214 bits (545), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 148/492 (30%), Positives = 244/492 (49%), Gaps = 58/492 (11%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVI---NNLDVRSPVLTLGSTTFHHI 57
           M + ++    KG+ ++S+  +D I  +  + F + ++       V  P L      +  +
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 58  RSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLDVVL 115
           + + +L+++ +TRS + + A ++ FLYK   +L  Y  +  EES+++ F+  YELLD ++
Sbjct: 61  QHN-DLYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDEMM 119

Query: 116 ENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXXX 175
           + G+P  TE   +   ++++              LM +A       R P  L        
Sbjct: 120 DYGIPQITETKMLKQYITQKSFK-----------LMKSAKKSKNVIRPPIALTNSVS--- 165

Query: 176 XXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDL 235
                             WR  GI YKKNE FLDV E IN+L+++ G +L+S + G V +
Sbjct: 166 ------------------WRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEILGKVKV 207

Query: 236 TTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQ 295
            +HLSG P  + GLND      G  S  +    E E  +  A  K  A +++LED KFHQ
Sbjct: 208 KSHLSGMPDLKLGLNDK-----GIFSNHVSGGVEDEADDLSATGKKKA-NIELEDLKFHQ 261

Query: 296 CVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVALKS 355
           CV+L++F  ++II F+PPDG FELM Y +   +  P     I     +   +E     K+
Sbjct: 262 CVRLSKFENEKIITFIPPDGDFELMSYRLTTPIK-PLIWCDIKIQVHSKSRIEVHCRAKA 320

Query: 356 LFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSA- 414
               K TA +V + IPVP      K   S+G  ++ PE+NA+LWK   + G  E +++A 
Sbjct: 321 QIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQ 380

Query: 415 LTVPMDNQSSLNLQQWSRP----PMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVK 470
           L +P       ++  +  P    P+ + F+I  F+ SG+ VR+ K++E    Y +  WV+
Sbjct: 381 LGLP-------SVSDFEEPVMKRPVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVR 433

Query: 471 YISRSG-AYEVR 481
           YI++SG  Y +R
Sbjct: 434 YITQSGDDYTIR 445

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  211 bits (537), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 149/485 (30%), Positives = 254/485 (52%), Gaps = 67/485 (13%)

Query: 11  KGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHH------IRSSSNLW 64
           KG+ ++S+  +D + +S  E F+  ++     R    ++    FHH          ++++
Sbjct: 11  KGKPLLSRRYQDDVSQSAVESFQHLLLE----REQESSVMPPCFHHNGIHYMYVQYNDVY 66

Query: 65  IVAVTRS-NADSAAIWEFLYKFNALLEAYGLN-SEESLKEEFMTCYELLDVVLENGVPVD 122
           ++A+TRS + ++  ++ F+YK   ++E Y     EES+++ ++  YELLD +++ GVP  
Sbjct: 67  VLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELLDEMMDKGVPQV 126

Query: 123 TELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXXXXXXXPAN 182
           TE   +   ++++          + +L  SA    ++  R P  L               
Sbjct: 127 TETKMLKQYITQK----------SFKLTRSAKKQKNVA-RPPTELTNSVS---------- 165

Query: 183 GDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDLTTHLSGT 242
                      WR  GIKYKKNE FLDV E IN+L+++ G +L+S + G+V + + LSG 
Sbjct: 166 -----------WRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILGTVKVRSRLSGM 214

Query: 243 PLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRF 302
           P  + GLND     G   + D +   E  V +KK        +++LED KFHQCV+L++F
Sbjct: 215 PDLKLGLNDK----GIFTTNDQEDSPEPVVSSKK-----KNSNIELEDLKFHQCVRLSKF 265

Query: 303 NTDRIIRFVPPDGSFELMRYHVRDNLNLPFK--ITPIFSVRSNNGA-VEYRVALKSLFPS 359
             ++II F+PPDG F+LM Y     L+ P K  I     V+ ++G+ +E     K+    
Sbjct: 266 ENEKIITFIPPDGEFDLMTYR----LSTPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKK 321

Query: 360 KLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSA-LTVP 418
           K  A +V + IP+P          S G  ++VPE+NA+LWKF+ +QG  E +++A L +P
Sbjct: 322 KSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLP 381

Query: 419 -MDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYISRSG- 476
            + +     L++    P+ + F+I  F+ SG+ VR+ K+ E    Y++  WV+YI++SG 
Sbjct: 382 SVSDAEPPKLKR----PVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGD 437

Query: 477 AYEVR 481
            Y +R
Sbjct: 438 DYTIR 442

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  207 bits (526), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 144/487 (29%), Positives = 243/487 (49%), Gaps = 54/487 (11%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFR---IQVINNLDVRSPVLTLGSTTFHHI 57
           M + ++     G++++S+  RD +  S  E F    ++      V  P LT     +  I
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60

Query: 58  RSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLDVVL 115
           + + +++++ ++RS + + A ++ FLYK   +L  Y     EES+++ F+  YELLD +L
Sbjct: 61  QHN-DIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEML 119

Query: 116 ENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXXX 175
           + G+P  TE   +   ++++          + +L+ S   + ++  R P  L K      
Sbjct: 120 DYGIPQITETKMLKQYITQK----------SYKLIKSVKKSKNV-VRPPAQLTKSVS--- 165

Query: 176 XXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDL 235
                             WR  GI YKKNE FLDV E IN+L++  G +L+S + G V +
Sbjct: 166 ------------------WRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVKV 207

Query: 236 TTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQ 295
            + LSG P  + GLND      G       F SE E  N          +++LED +FHQ
Sbjct: 208 RSRLSGMPDLKLGLNDK-----GI------FTSE-EGGNNAEGGSGKKSNIELEDLQFHQ 255

Query: 296 CVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVALKS 355
           CV+L++F  ++II F+PPDG F+LM Y +   +           V S +  +E     K+
Sbjct: 256 CVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCDAKIQVHSQS-RIEIHCRAKA 314

Query: 356 LFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSAL 415
               K TA +V + IPVP      K   S+G  ++VPE++A+LW+   + G  E + +A 
Sbjct: 315 QIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAA- 373

Query: 416 TVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYISRS 475
            + + + + + + +  R P+ + F+I  F+ SG+ VR+ KV E    Y +  WV+YI++S
Sbjct: 374 QLGLPSMTDVEVPKAKR-PIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQS 432

Query: 476 G-AYEVR 481
           G  Y +R
Sbjct: 433 GDDYTIR 439

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  208 bits (529), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 151/498 (30%), Positives = 253/498 (50%), Gaps = 67/498 (13%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRS----PVLTLGSTTFHH 56
           M +A++    KG  ++++  RD I  S  E F   ++++L+  +    P L+     +  
Sbjct: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPT-LLSDLEEETNLVPPCLSYNGMQYLF 90

Query: 57  IRSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLDVV 114
           I+ + ++++VA+  S +A++A I+ FLYK   +L  Y     EES+++ F+  YELLD  
Sbjct: 91  IQHN-DVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDET 149

Query: 115 LENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXX 174
           ++ G+P  TE   +   ++++              L+ AA       R P+ L       
Sbjct: 150 MDYGIPQITETKMLKQYITQKSFK-----------LVKAAKKKRNAARPPEALTNSVS-- 196

Query: 175 XXXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVD 234
                              WRS+ IKYKKNE FLD+ E IN+L+++ G IL+S + G V 
Sbjct: 197 -------------------WRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVK 237

Query: 235 LTTHLSGTPLCQFGLND----SLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLED 290
           + + LSG P  + G+ND    S  +D  +L+ +   ++      KK        +++LED
Sbjct: 238 VKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKK-------NNIELED 290

Query: 291 CKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSN-----NG 345
            KFHQCV+L++F T++II F+PPDG FELM Y       L   I P+     N       
Sbjct: 291 LKFHQCVRLSKFETEKIITFIPPDGDFELMNYR------LSTSIKPLIWCDMNIQVHSQS 344

Query: 346 AVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQ 405
            +E     K+    K TA +V + IPVP      +   S+G  ++VPE+N ++WK   + 
Sbjct: 345 RIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFP 404

Query: 406 GLTENTLSALTVPMDNQSSLNLQQW-SRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYH 464
           G  E ++SA    M   S  N+++  ++ P+ + F+I  F+ SG+ V++ K++E    Y 
Sbjct: 405 GGKEYSMSA---QMQLPSIGNIEEHKAKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYK 461

Query: 465 TVKWVKYISRSG-AYEVR 481
           +  WV+YI++SG  Y +R
Sbjct: 462 SYPWVRYITQSGDDYTIR 479

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  206 bits (525), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 149/517 (28%), Positives = 253/517 (48%), Gaps = 77/517 (14%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRS----PVLTLGSTTFHH 56
           M +A++     G+ ++S+  RD I  S  + F   ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IRSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLDVV 114
           I+ + +L++VA+  S +A++AAI+ FL+K   +L  Y     EES+++ F+  YELLD V
Sbjct: 60  IQHN-DLYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118

Query: 115 LENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXX 174
           ++ G+P  TE   +   ++++              L+ +A       R P  L       
Sbjct: 119 MDYGIPQITETKMLKQYITQKSFK-----------LVKSAKKKRNATRPPVALTNSVS-- 165

Query: 175 XXXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVD 234
                              WR  GI +KKNE FLD+ E IN+L+++ G +L+S + G V 
Sbjct: 166 -------------------WRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVK 206

Query: 235 LTTHLSGTPLCQFGLN----------DSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAG 284
           + + LSG P  + G+N          DS +L     +   D  ++ +   K +I  ++  
Sbjct: 207 VNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTA 266

Query: 285 S-----VQLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFS 339
           S     ++LED KFHQCV+L++F  ++II F+PPDG F+LM Y +   +  P     +  
Sbjct: 267 SKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNV 325

Query: 340 VRSNNGAVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLW 399
              +N  +E     K+    K TA +V + IPVP          S+G  ++VPE++A+LW
Sbjct: 326 QVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILW 385

Query: 400 KFAKYQGLTENTLSA--------------LTVPMDNQSSLNLQQWSRPPMSLTFEILMFS 445
           K   + G  E ++SA               T+P +N   L      + P+ + F+I  F+
Sbjct: 386 KLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKNNAEIL------KGPVQIKFQIPYFT 439

Query: 446 NSGLVVRFFKVSERDHSYHTVKWVKYISRSG-AYEVR 481
            SG+ VR+ K++E    Y +  WV+YI++SG  Y +R
Sbjct: 440 TSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 476

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  206 bits (524), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 152/519 (29%), Positives = 253/519 (48%), Gaps = 84/519 (16%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRS----PVLTLGSTTFHH 56
           M +A++     G+ ++S+  RD I  S  + F I ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IRSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLDVV 114
           I+ + +L++VA+  S +A++AAI+ FL+K   +L  Y     EES+++ F+  YELLD V
Sbjct: 60  IQHN-DLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118

Query: 115 LENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXX 174
           ++ G+P  TE   +   ++++              L+ +A       R P  L       
Sbjct: 119 MDYGIPQITETKMLKQYITQKSFK-----------LVKSAKKKRNATRPPVALTNSVS-- 165

Query: 175 XXXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVD 234
                              WR  GI +KKNE FLD+ E IN+L+++ G +L+S + G V 
Sbjct: 166 -------------------WRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVK 206

Query: 235 LTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEY------------EVKNKKAIPKAA 282
           + + LSG P  + G+ND      G  S+ LD  +              E   K +I  ++
Sbjct: 207 VNSKLSGMPDLKLGINDK-----GIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSS 261

Query: 283 AG-----SVQLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPI 337
           A      +++LED KFHQCV+L++F  ++II F+PPDG F+LM Y +   +  P     +
Sbjct: 262 ATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDV 320

Query: 338 FSVRSNNGAVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAV 397
                +N  +E     K+    K TA +V + IPVP          S+G  ++VPE++A+
Sbjct: 321 NVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAI 380

Query: 398 LWKFAKYQGLTENTLSA--------------LTVPMDNQSSLNLQQWSRPPMSLTFEILM 443
           LWK   + G  E ++SA               T+P  N   L      + P+ + F+I  
Sbjct: 381 LWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAEIL------KGPVQIKFQIPY 434

Query: 444 FSNSGLVVRFFKVSERDHSYHTVKWVKYISRSG-AYEVR 481
           F+ SG+ VR+ K++E    Y +  WV+YI++SG  Y +R
Sbjct: 435 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 473

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  204 bits (520), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 148/497 (29%), Positives = 252/497 (50%), Gaps = 71/497 (14%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFR---IQVINNLDVRSPVLTLGSTTFHHI 57
           M + ++    KG+L++S+  +D I  +  E F    I+      V  P  +     +  I
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 58  RSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLDVVL 115
           + + +L+++ +T+S + + A ++ +L+K   +LE Y  +  EES+K+ F+  YELLD ++
Sbjct: 61  QHN-DLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMM 119

Query: 116 ENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXXX 175
           ++G+P  T+     +KM R+ +        + +L+ SA    ++  R P  L        
Sbjct: 120 DHGIPQITD-----TKMLRQYITQK-----SFKLIRSAKKKKNV-VRPPATLTNSVS--- 165

Query: 176 XXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDL 235
                             WR  GI YKKNE FLDV E IN+L+++ G +L+S + G V +
Sbjct: 166 ------------------WRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKV 207

Query: 236 TTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGS-----VQLED 290
            + LSG P  + GLND      G  +         +  +      A+ G+     ++LED
Sbjct: 208 KSRLSGMPDLKLGLNDK-----GIFA---------QGDDDDDEEGASGGTKKKSNIELED 253

Query: 291 CKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVR---SNNGAV 347
            KFHQCV+L +F  ++II F+PPDG FELM Y     L+ P K      V+    +   +
Sbjct: 254 LKFHQCVRLTKFENEKIITFIPPDGDFELMSYR----LSTPIKPLIWCDVKLQVHSRSRI 309

Query: 348 EYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGL 407
           E     K+    K TA +V + IPVP      K   S+G  ++VP +NA+LWK   + G 
Sbjct: 310 EIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGG 369

Query: 408 TENTLSA-LTVP-MDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHT 465
            + +++A + +P + + S   L++    P+ + F+I  F+ SG+ VR+ K++E    Y++
Sbjct: 370 KDYSMAAEMGLPSVSDNSDHKLKR----PVQIKFQIPYFTTSGIQVRYLKINEPKMQYNS 425

Query: 466 VKWVKYISRSG-AYEVR 481
             WV+YI++SG  Y +R
Sbjct: 426 YPWVRYITQSGDDYTIR 442

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  202 bits (515), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 154/509 (30%), Positives = 259/509 (50%), Gaps = 71/509 (13%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFR---IQVINNLDVRSPVLTLGSTTFHHI 57
           M++++     KG+ ++S+  RD I  +  + F    +++     V  P LT     +  I
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60

Query: 58  RSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAYGLN-SEESLKEEFMTCYELLDVVL 115
           + + +L+IVA+T S + +++ ++ FL+K   ++  Y  +  EES+++ F+  YELLD ++
Sbjct: 61  QHN-DLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMM 119

Query: 116 ENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXXX 175
           + G+P  TE   +   ++++              L+ AA       R P+ L        
Sbjct: 120 DYGIPQITETKMLKQYITQKSFK-----------LVKAAKKKRNAARPPQALTNSVS--- 165

Query: 176 XXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDL 235
                             WR  GIKYKKNE FLD+ E IN+L+++ G +L+S + G V +
Sbjct: 166 ------------------WRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEVKV 207

Query: 236 TTHLSGTPLCQFGLND----SLSLDGGTLSRDLDFISEYEV-KNKKAIPKAAAG------ 284
            + LSG P  + G+ND    S  L+  + + + +  +  EV  +K + P+ + G      
Sbjct: 208 RSRLSGMPDLKLGINDKGIFSKYLESTSSNSNSNDDNSNEVNSSKSSTPQPSTGQDEGSS 267

Query: 285 ----SVQLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSV 340
               +V+LED KFHQCV+L++F  ++II F+PPDG+FELM Y     L  P K  P+   
Sbjct: 268 RKTSNVELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYR----LTTPIK--PLIWC 321

Query: 341 RSN-----NGAVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEEN 395
             N        VE     K+    K  A +V + IPVP          S+G  ++VPE+N
Sbjct: 322 DVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWVPEKN 381

Query: 396 AVLWKFAKYQGLTENTLSA-LTVP-MDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRF 453
           A+LWK   + G  E +++A L +P +D+     L++    P+ + F+I  F+ SG+ VR+
Sbjct: 382 AILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKR----PVQIKFQIPYFTTSGIQVRY 437

Query: 454 FKVSERDHSYHTVKWVKYISRSG-AYEVR 481
            KV+E    Y +  WV+YI++SG  Y +R
Sbjct: 438 LKVNEPKLQYKSYPWVRYITQSGDDYTIR 466

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  202 bits (515), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 147/527 (27%), Positives = 243/527 (46%), Gaps = 99/527 (18%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRS----PVLTLGSTTFHH 56
           M +A++     G+ ++S+  RD +  S  + F   ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFST-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IRSSSNLWIVAVTRSNADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLDVVL 115
           I+ +    +  VT   A++AAI+ FL+K   +L  Y     EES+++ F+  YELLD V+
Sbjct: 60  IQHNDLYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119

Query: 116 ENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXXX 175
           + G+P  TE   +   ++++                         F++ K   K      
Sbjct: 120 DYGIPQITETKMLKQYITQK------------------------SFKLVKSAKKKRNATR 155

Query: 176 XXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDL 235
                 N        +  WR  GI +KKNE FLD+ E IN+L+++ G +L+S + G V +
Sbjct: 156 PPVALTN--------SVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKV 207

Query: 236 TTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGS---------- 285
            + LSG P  + G+ND      G  S+ LD        N   IP A + +          
Sbjct: 208 NSKLSGMPDLKLGINDK-----GIFSKYLD--------NDSNIPSAVSAATSDNNTDTDK 254

Query: 286 ----------------VQLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLN 329
                           ++LED KFHQCV+L++F  ++II F+PPDG F+LM Y +   + 
Sbjct: 255 KPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK 314

Query: 330 LPFKITPIFSVRSNNGAVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCR 389
            P     +     +N  +E     K+    K TA +V + IPVP          S+G  +
Sbjct: 315 -PLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLK 373

Query: 390 FVPEENAVLWKFAKYQGLTENTLSA--------------LTVPMDNQSSLNLQQWSRPPM 435
           +VPE++A+LWK   + G  E ++SA               T+P  N   L      + P+
Sbjct: 374 YVPEKSAILWKLRSFPGGKEYSMSAELGLPSISTSKDGSRTIPKSNAKLL------KGPV 427

Query: 436 SLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYISRSG-AYEVR 481
            + F+I  F+ SG+ VR+ K++E    Y +  WV+YI++SG  Y +R
Sbjct: 428 QIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  202 bits (514), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 147/504 (29%), Positives = 258/504 (51%), Gaps = 63/504 (12%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRS----PVLTLGSTTFHH 56
           M +A++    KG+ ++S+  RD I  S  + F   ++++ +  S    P ++     +  
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKFS-SLLSDKEEESNLLPPCISHNGIQYMF 59

Query: 57  IRSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLDVV 114
           I+ + +L++ A+  S  A+ + I+ FL+K   +L+ Y     EES+++ F+  YELLD +
Sbjct: 60  IQHN-DLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLDEM 118

Query: 115 LENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXX 174
           ++ G+P  TE     +KM ++ + +                     F++ K   K     
Sbjct: 119 MDYGLPQITE-----TKMLKKYITTK-------------------SFKLEKAHKKKRNAA 154

Query: 175 XXXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVD 234
                  N        +  WR  GIKYKKNE FLD+ E IN+L+++ G +L+S + G+V 
Sbjct: 155 RPPTELTN--------SVSWRPEGIKYKKNEAFLDIIESINMLITQKGQVLRSEIVGNVR 206

Query: 235 LTTHLSGTPLCQFGLND----SLSLDGGT--LSRDLDFISEYEVKNKKAIPKAAAG---- 284
           + + LSG P  + G+ND    +  L+G    ++++ D     +  N+ +I    +     
Sbjct: 207 VKSRLSGMPDLKLGINDRGIFTKYLEGNNIGIAKNGDDEDADDTNNESSIVSEGSNKRKT 266

Query: 285 SVQLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIF--SVRS 342
           +++LED KFHQCV+L++F  ++II F+PPDG F+LM Y       L   I P+    V  
Sbjct: 267 NIELEDLKFHQCVRLSKFENEKIISFIPPDGEFDLMNYR------LSTSIKPLIWCDVSI 320

Query: 343 NNGAVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFA 402
               +E     K+    K  A +V + IPVP          S+G+ +++PE+N +LWK +
Sbjct: 321 QTYRIEIHCKAKAQIKKKSIATNVEILIPVPEDADSPIFKYSHGKIKYLPEKNLLLWKIS 380

Query: 403 KYQGLTENTLSA-LTVP-MDNQSSLN--LQQWSRPPMSLTFEILMFSNSGLVVRFFKVSE 458
            + G  E +++A + +P +  +  LN  +   S+ P+ + F+I  F+ SG+ VR+ KV+E
Sbjct: 381 SFPGGKEYSMAAQMGLPSISGEDDLNTRVSNQSKKPVQVKFKIPYFTTSGIQVRYLKVNE 440

Query: 459 RDHSYHTVKWVKYISRSG-AYEVR 481
               Y T  WV+YI++SG  Y +R
Sbjct: 441 PKLQYKTYPWVRYITQSGDDYTIR 464

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  201 bits (511), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 143/488 (29%), Positives = 248/488 (50%), Gaps = 62/488 (12%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFR---IQVINNLDVRSPVLTLGSTTFHHI 57
           M++A++    KG  ++S+  RD I  S  + F    +Q+     V  P L+     +  I
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 58  RSSSNLWIVAVTRSNADSAA-IWEFLYKFNALLEAYGLNS--EESLKEEFMTCYELLDVV 114
           + + +L++VA+  S A + A ++ FL+K   +LE Y L S  EES+++ F+  YELLD +
Sbjct: 61  QHN-DLYVVALATSLATNVAQVFAFLHKLMEVLEEY-LKSVEEESVRDNFIIIYELLDEM 118

Query: 115 LENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXX 174
           ++ G+P  TE   +   ++++                         F++ K + K     
Sbjct: 119 MDYGIPQITETKMLKQYITQK------------------------SFKLMKAVKKSKAAP 154

Query: 175 XXXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVD 234
                  N        +  WR+  I +KKNE FLD+ E IN+L+++ G +L+S + G + 
Sbjct: 155 RPPTEVTN--------SVSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIGQIK 206

Query: 235 LTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFH 294
           + + LSG P  + G+ND   +    +  D D ++    + KK        +++LED KFH
Sbjct: 207 VKSKLSGMPDLKLGINDK-GIFSKYVEGDSDPVTTAVTEGKKKT------NIELEDLKFH 259

Query: 295 QCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSN-----NGAVEY 349
           QCV+L++F  ++II F+PPDG+FELM Y     L++P K  P+     N        +E 
Sbjct: 260 QCVRLSKFENEKIITFIPPDGAFELMNYR----LSMPVK--PLIWCDVNVQVHSQSRIEI 313

Query: 350 RVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTE 409
               ++    +  A  V + IPVP          ++G  ++VP++NA+LWK   + G  E
Sbjct: 314 HCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKE 373

Query: 410 NTLSA-LTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKW 468
            ++SA + +P  N  +L+  +  R P+ + F+I  F+ SG+ VR+ K++E    Y +  W
Sbjct: 374 YSMSAQMGLPSIN--ALDKPKVKR-PVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPW 430

Query: 469 VKYISRSG 476
           V+YI++SG
Sbjct: 431 VRYITQSG 438

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  201 bits (512), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 142/500 (28%), Positives = 248/500 (49%), Gaps = 60/500 (12%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLD---VRSPVLTLGSTTFHHI 57
           M +A++    KG+ ++S+  +D +  S  + F   + +  D   V  P +      +  I
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60

Query: 58  RSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLDVVL 115
           + + +L++VA+  S   + A ++ FL+K   +L  Y     EES+++ F+  YEL+D ++
Sbjct: 61  QHN-DLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMM 119

Query: 116 ENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXXX 175
           + G+P  TE   +   ++++              L  A        R P  LN       
Sbjct: 120 DYGIPQITEPRMLKKYITQKSFK-----------LEKAHKKKRNAARPPSELNNSVS--- 165

Query: 176 XXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDL 235
                             WR+ GIKYKKNE FLD+ E IN+L+++ G +L+S + G+V +
Sbjct: 166 ------------------WRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIGAVKI 207

Query: 236 TTHLSGTPLCQFGLND----SLSLDGGTLSRDL-------DFISEYEVKNKKAIPKAAAG 284
            + LSG P  + G+ND    +  L+G  +  ++         ++E  + N     K    
Sbjct: 208 KSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDG---KKRKT 264

Query: 285 SVQLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNN 344
           +++LED KFHQCV+L++F  ++II F+PPDG F+LM Y +  ++  P     +     + 
Sbjct: 265 NIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIK-PLIWCDVSIQVHSK 323

Query: 345 GAVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKY 404
             +E R   K+    K  A +V + IPVP          S+G  ++VPE++A+LWK   +
Sbjct: 324 SRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILWKIKSF 383

Query: 405 QGLTENTLSA-LTVP-MDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHS 462
            G  E  + A + +P MD+     +++    P+ + FEI  F+ SG+ VR+ K++E    
Sbjct: 384 PGGKEYAMFAEMGLPSMDSYEEPKVKR----PVQVKFEIPYFTTSGIQVRYLKINEPKLQ 439

Query: 463 YHTVKWVKYISRSG-AYEVR 481
           Y +  WV+YI++SG  Y +R
Sbjct: 440 YKSYPWVRYITQSGDDYTIR 459

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  201 bits (511), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 139/490 (28%), Positives = 244/490 (49%), Gaps = 49/490 (10%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLD---VRSPVLTLGSTTFHHI 57
           M++ ++     G+ ++S+  RD I  S  + F   ++ + +   V  P L      +  I
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60

Query: 58  RSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAYGLNS--EESLKEEFMTCYELLDVV 114
           + S ++++VA+T S   + A I+ FL++  ++L  Y L S  EES+++ F+  YELLD +
Sbjct: 61  QHS-DIYVVALTTSYQTNIAQIFMFLHQLVSVLGDY-LKSVEEESIRDNFVIIYELLDEM 118

Query: 115 LENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXX 174
           ++ G+P  TE   +   ++++    ++             A  +                
Sbjct: 119 MDYGIPQITETKMLKQYITQKSFKLIKAAKKKRNAARPPVALTN---------------- 162

Query: 175 XXXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVD 234
                           +  WR  GIKYKKNE +LD+ E IN+L+++ G +L+S + G V 
Sbjct: 163 ----------------SVSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEVK 206

Query: 235 LTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFH 294
           + + LSG P  + G+ND   +    L  + DF    ++ N  +       +++LED KFH
Sbjct: 207 VKSRLSGMPDLKLGINDK-GIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFH 265

Query: 295 QCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVALK 354
           QCV+L++F  ++II F+PPDG FELM Y +   +  P     I     +   +E     K
Sbjct: 266 QCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK-PLIWCDINIQVHSKSRIEIHCRAK 324

Query: 355 SLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSA 414
           +    K  A +V + IPVP          S+G  +++PE+NA+LWK   + G  E +++A
Sbjct: 325 AQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTA 384

Query: 415 -LTVP-MDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYI 472
            L +P +D      +++    P+ + F+I  F+ SG+ VR+ K++E    Y +  WV+YI
Sbjct: 385 QLGLPSVDGIEPPKVKR----PVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYI 440

Query: 473 SRSG-AYEVR 481
           ++SG  Y +R
Sbjct: 441 TQSGDDYTIR 450

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  201 bits (510), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 151/498 (30%), Positives = 250/498 (50%), Gaps = 61/498 (12%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVIN---NLDVRSPVLTLGSTTFHHI 57
           M +A++    KG  ++S+  RD I  S  + F I + N     ++  P +      F  I
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 58  RSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLDVVL 115
           + + +L++VA+  S + ++A I+ FL+K   +L  Y     EES+++ F+  YELLD ++
Sbjct: 61  QHN-DLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMM 119

Query: 116 ENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXXX 175
           + G+P  TE      KM ++ +            L  AA       R P  L        
Sbjct: 120 DYGIPQITE-----PKMLKQYITQ------KSFKLKKAAKKKRNAARPPTSLTNSVS--- 165

Query: 176 XXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDL 235
                             WR  GIK+KKNE FLD+ E IN+L+++ G +L+S + G V +
Sbjct: 166 ------------------WRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKV 207

Query: 236 TTHLSGTPLCQFGLND----SLSLDGGT----LSRDLDFISEYEVKNKKAIPKAAAGSVQ 287
            + LSG P  + G+ND    S  L+G      ++ D   + E + K K+      + +++
Sbjct: 208 KSKLSGMPDLKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKR------SNNME 261

Query: 288 LEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAV 347
           LED KFHQCV+L++F  ++ I F+PPDG FELM Y +   +  P     +     +   +
Sbjct: 262 LEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLSTAIK-PLIWCDVNIKTHSKSRI 320

Query: 348 EYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGL 407
           E     K+    K TA +V + IPVP          S+G  ++VPE+NA+LWK   + G 
Sbjct: 321 EIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGD 380

Query: 408 TENTLSA-LTVPMDN--QSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYH 464
            E +++A + +P  N  + S  L++    P+ + F+I  F+ SG+ VR+ K+ E++  Y 
Sbjct: 381 KEYSMAAEMGLPSTNAGEESEKLKR----PVQVKFQIPYFTTSGIQVRYLKIEEKNLQYK 436

Query: 465 TVKWVKYISRSG-AYEVR 481
           +  WV+YI++SG  Y +R
Sbjct: 437 SYPWVRYITKSGDDYTIR 454

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  200 bits (508), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 150/497 (30%), Positives = 243/497 (48%), Gaps = 73/497 (14%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRS----PVLTLGSTTFHH 56
           M++ ++    KG  ++S+  RD I  S  + F   ++ +L+  S    P L      +  
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRF-APLLADLEEESSVIPPCLNHRGIQYLF 59

Query: 57  IRSSSNLWIVAVTRSNADSAA-IWEFLYKFNALLEAYG----LNSEESLKEEFMTCYELL 111
           I    +L++VA++ S A +AA ++ FL+K   L+EA G       EES+++ F+  YELL
Sbjct: 60  I-EHEDLYVVALSTSLATNAAQVFTFLHK---LVEALGDYLKTVEEESVRDNFVIIYELL 115

Query: 112 DVVLENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGX 171
           D +++ G+P  TE   +   ++++              L+ A   V    R P  L    
Sbjct: 116 DEMMDYGIPQITETKMLKQYITQKSFK-----------LIKAVKKVKATARPPTGLTNSV 164

Query: 172 XXXXXXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDG 231
                                 WR+ GI YKKNE FLD+ E IN+++++ G +L+S + G
Sbjct: 165 S---------------------WRADGITYKKNEAFLDIVESINMVMNQQGQVLRSEIIG 203

Query: 232 SVDLTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDC 291
            V + + LSG P  + G+ND      G  +RD       E    +        S +LED 
Sbjct: 204 QVIVRSRLSGMPDLKLGINDK-----GIFTRDP------ETGESQVTAGKKKSSAELEDL 252

Query: 292 KFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSN-----NGA 346
           KFHQCV+L++F  ++II F+PPDG FELM Y     L  P K  P+     N        
Sbjct: 253 KFHQCVRLSKFENEKIITFIPPDGEFELMSYR----LTTPVK--PLIWCDVNVQVHSKSR 306

Query: 347 VEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQG 406
           +E     K+    K  A +V + IPVP          S+G  ++VPE+NA+LWK   + G
Sbjct: 307 IEIHCRAKAQIKKKSVANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKIRSFYG 366

Query: 407 LTENTLSA-LTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHT 465
             E +++A + +P  N   +   ++ R P+ + F+I  F+ SG+ VR+ K++E    Y +
Sbjct: 367 GKEYSMAAQMGLPSIN--GVEKPKFKR-PVQVKFQIPYFTTSGIQVRYLKINEPKLQYKS 423

Query: 466 VKWVKYISRSG-AYEVR 481
             WV+YI+++G  Y +R
Sbjct: 424 YPWVRYITQNGDDYTIR 440

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  197 bits (502), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 150/500 (30%), Positives = 248/500 (49%), Gaps = 68/500 (13%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFR---IQVINNLDVRSPVLTLGSTTFHHI 57
           M++ ++     G+ ++++  RD I  +  + F    +Q+     V  P +      +  I
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60

Query: 58  RSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLDVVL 115
           + S ++++VA+T S   + A I+ FL++   +LE Y  +  EES+++ F+  YELLD ++
Sbjct: 61  KHS-DIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMM 119

Query: 116 ENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXXX 175
           + G+P  TE     +KM ++  ++ ++  L          N     R P  L        
Sbjct: 120 DFGIPQITE-----TKMLKK-YITQKSFKLIKTSTSKKKKN---AARPPAELTNSVS--- 167

Query: 176 XXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDL 235
                             WR  GI YKKNE FLD+ E IN+LV++ G +L+S + G+V +
Sbjct: 168 ------------------WRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRV 209

Query: 236 TTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKA---IPKAAAG---SVQLE 289
            + LSG P  + G+ND      G  S   +++ E  V    +   IP+        ++LE
Sbjct: 210 RSRLSGMPDLKLGINDR-----GIFS---NYLEENNVDGSSSSTPIPEGVEDKKPQIELE 261

Query: 290 DCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSN-----N 344
           D KFHQCV+L++F  ++II F+PPDG F+LM Y     L  P K  P+     N      
Sbjct: 262 DLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYR----LTTPIK--PLIWCDVNIQVHSK 315

Query: 345 GAVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKY 404
             +E     K+    K  A +V + IPVP      +   S+G  +++PE+NA+LWK   +
Sbjct: 316 SRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSF 375

Query: 405 QGLTENTLSA-LTVP-MDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHS 462
            G  E ++SA L +P +D      +    R P+ + F+I  F+ SG+ VR+ KV+E    
Sbjct: 376 AGGKEYSMSAQLHLPSVDGVEPPKV----RRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQ 431

Query: 463 YHTVKWVKYISRSGA-YEVR 481
           Y +  WV+YI++SG  Y +R
Sbjct: 432 YKSYPWVRYITQSGEDYTIR 451

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  196 bits (497), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 148/525 (28%), Positives = 241/525 (45%), Gaps = 95/525 (18%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRS----PVLTLGSTTFHH 56
           M +A++     G+ ++S+  RD I  S  + F   ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFP-TLLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IRSSSNLWIVAVTRSNADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLDVVL 115
           I+ +    +  VT   A++AAI+ FL+K   +L  Y     EES+++ F+  YELLD V+
Sbjct: 60  IQHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119

Query: 116 ENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXXX 175
           + G+P   E   +   ++++              L+ +A       R P  L        
Sbjct: 120 DYGIPQICETKMLKQYITQKSFK-----------LVKSAKKKRNATRPPVALTNSVS--- 165

Query: 176 XXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDL 235
                             WR  GI +KKNE FLD+ E IN+L+++ G +L+S + G V +
Sbjct: 166 ------------------WRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKV 207

Query: 236 TTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGS---------- 285
            + LSG P  + G+ND      G  S+ LD  S          P +AA S          
Sbjct: 208 NSKLSGMPDLKLGINDK-----GIFSKYLDDDSN------TPPPTSAATSDNITDTDKKP 256

Query: 286 --------------VQLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLP 331
                         ++LED KFHQCV+L++F  ++II F+PPDG F+LM Y +   +  P
Sbjct: 257 SITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-P 315

Query: 332 FKITPIFSVRSNNGAVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFV 391
                +     +N  +E     K+    K TA +V + IPVP          S+G  ++V
Sbjct: 316 LIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYV 375

Query: 392 PEENAVLWKFAKYQGLTENTLSA--------------LTVPMDNQSSLNLQQWSRPPMSL 437
           PE++A+LWK   + G  E ++SA                +P  N   L      + P+ +
Sbjct: 376 PEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNAEIL------KGPVQI 429

Query: 438 TFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYISRSG-AYEVR 481
            F+I  F+ SG+ VR+ K++E    Y +  WV+YI++SG  Y +R
Sbjct: 430 KFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score = 98.6 bits (244), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 122/505 (24%), Positives = 193/505 (38%), Gaps = 139/505 (27%)

Query: 45  PVLTLGSTTFHHIRSSSNLWIVAV--------TRSNADSAAIWEFLYKFNALLEAYGLNS 96
           PV       F +IR     +I AV         +S+ +  AI  +L  F  LL+ Y  NS
Sbjct: 44  PVFHYKGIHFVYIRRDGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRY-FNS 102

Query: 97  EES----LKEEFMTCYELLDVVLENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMS 152
           ++     + + F   YELLD  L+ GVP  T+ + +         + ++ N L DEL  S
Sbjct: 103 QKLNRWLIVDNFHLIYELLDESLDFGVPQLTDYNIIQD------YIKVQVN-LHDELADS 155

Query: 153 A---AANVDL-GFR-----MPKFLNKGXXXXXXXXXPANGDEHGDPCAYPWRSSGIKYKK 203
           +   +   DL GF      M  F+ +                     A  WR  GI Y K
Sbjct: 156 SKKISKKEDLHGFEDDESYMNSFIARTTT-----------------SAISWRPKGIHYTK 198

Query: 204 NEIFLDVNERINILVSKDGS-ILKSYVDGSVDLTTHLSGTPLCQFGLNDSLSLDGGTLSR 262
           NE FLDV E I   +  + S I K++V G +   ++LSG P  + GL+   S        
Sbjct: 199 NEFFLDVIEEIEYCMDFNKSKIRKNFVHGRIRCRSYLSGMPKLKIGLSKITS-------- 250

Query: 263 DLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRY 322
                         ++PK       + + KFHQCV L     + I+ F+PPDG F+L  Y
Sbjct: 251 --------------SLPKEREQF--MNNAKFHQCVSLEDLQKN-IVSFIPPDGEFQLCEY 293

Query: 323 ----HVRD-------------------NLNLPFKITPIFSVRSNNGAVEYRVALKSLFPS 359
               HVRD                    + +   IT  F  +++   +  R+ L  +F  
Sbjct: 294 KLKRHVRDPPVIKLVKFDVKKEEKKRPKILISLTITTDFKSQNSTSVLNIRIPLTKIF-- 351

Query: 360 KLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSALTVPM 419
                +  + +  PP     +     G   F   ++ +LW+    +G    T  ++    
Sbjct: 352 ----SEYQIDLAKPP-----RFKCDQGNVLFNLTDDLLLWEVGSIKGGHAQTEHSMYCEF 402

Query: 420 ----DNQSSLNLQQWSR----PPM-------------------------SLTFEILMFSN 446
               + +    L++       PP+                         S+ FEI  ++ 
Sbjct: 403 RLYDEEEYKKQLEELKNSMDPPPLRQGPKLEELYKQVHENENTNRSRLVSMEFEIPYYTC 462

Query: 447 SGLVVRFFKVSERDHSYHTVKWVKY 471
           SGL V++ K+ E    YH+  WV+Y
Sbjct: 463 SGLKVQYLKIEEDQLQYHSFPWVRY 487

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score = 95.1 bits (235), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 110/494 (22%), Positives = 195/494 (39%), Gaps = 107/494 (21%)

Query: 43  RSPVLTLGSTTFHHIRSSSNLWIVAVTRSNA--DSAAIWEFLYKFNALLEAY-GLNSEE- 98
           R PV+      + +I     L+ V+V+      +   I  +L  F+ALL  Y  +N  + 
Sbjct: 41  RGPVIYSKGIIYIYILRDG-LYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDR 99

Query: 99  -SLKEEFMTCYELLDVVLENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANV 157
             + + F   YEL D  L+ G+P  T+ + +      R  + +E N         A ++ 
Sbjct: 100 TGIIDNFNLIYELFDESLDYGIPQLTDYNII------RDSIKIEANVPKVPSNSQADSDE 153

Query: 158 DLGFRMPKFLNKGXXXXXXXXXPANGDEH--------GDPCAYPWRSSGIKYKKNEIFLD 209
           + G   P+ L                DE             A  WR  GI Y KNE+F+D
Sbjct: 154 ESG---PEILQSKENKDKADIHGFRDDEQYINSFVLRTTTQAISWRPKGIYYTKNELFVD 210

Query: 210 VNERINILVS-KDGSILKSYVDGSVDLTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFIS 268
           + ER + L+  K+  + +++V G ++  ++LSG P+ +  +N  L        +D D   
Sbjct: 211 IIERQSYLMDFKNSQVRQTFVYGKINCRSYLSGMPIVRVCINKML--------KDKDLF- 261

Query: 269 EYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNL 328
                              L   KFHQCV L   ++   I F+PPDG F+L  Y ++ ++
Sbjct: 262 -------------------LGSSKFHQCVSLESLSSQDYIEFIPPDGDFQLCEYKLKRHI 302

Query: 329 N-------LPFKITPIFSVRSNNGAVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKI 381
           N       + +KI      R     +   V ++  F ++ +A  + + IP      + KI
Sbjct: 303 NDSPIIKLIDYKINE----RQKKHRLHLSVTIQPHFKAQNSATALKIHIPTRDLFQNYKI 358

Query: 382 NTS--------NGRCRFVPEENAVLWKFAKYQGLTENTLSALTVPM----DNQSSLNLQQ 429
           + +        +G   F   +  +LW     +G    T  ++ V      + + +  L+Q
Sbjct: 359 DLTKAPRFKCDHGSVFFNLSDELLLWDAQGIKGGHGETSYSMHVEFALFDEEEHARKLEQ 418

Query: 430 WSR----PPM----------------------------SLTFEILMFSNSGLVVRFFKVS 457
             +    PP+                            +  FE+  +++SGL V + K+S
Sbjct: 419 IKKSMDPPPLREGAHLEELYAQVKSNKEGKGQFQSNAITAEFEVPYYTSSGLRVEYLKIS 478

Query: 458 ERDHSYHTVKWVKY 471
           E +  Y +  WV+Y
Sbjct: 479 EENLKYQSFSWVRY 492

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score = 91.7 bits (226), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 92/358 (25%), Positives = 137/358 (38%), Gaps = 98/358 (27%)

Query: 180 PANGDEH--------GDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILK-SYVD 230
           P   DEH            A  WR  GI Y KNE FLDV E +  L+  + + ++ + V 
Sbjct: 165 PGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEYLMDFERAQVRLNQVH 224

Query: 231 GSVDLTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLED 290
           G+++  ++LSG P    GLN         +++D DF S+                     
Sbjct: 225 GAINCRSYLSGMPQLTVGLNK-------MVAQDRDFTSQ--------------------- 256

Query: 291 CKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYR 350
             FHQCV L R  TDR I FVPPDG F+L  Y +    N      P+  +     AV+ R
Sbjct: 257 VHFHQCVDLERLATDRHITFVPPDGEFQLCHYKLARGANE----QPLIKLEECRAAVKPR 312

Query: 351 ------------VALKSLFPSKLTAKDVVLRIPVPPGTV--DCKINTS--------NGRC 388
                       V++ + F  KL     VL++ VP   V    K++ S         G  
Sbjct: 313 RRPADADRLVLTVSISTNF--KLQDATSVLKVRVPLARVFEQWKVDLSFPPRFKCDAGCV 370

Query: 389 RFVPEENAVLWKFAKYQG-------------------LTENTLSALTVPMD--------- 420
            F   ++ +LW   K +G                         + L+  MD         
Sbjct: 371 MFNITDDYLLWDIGKAKGSHGDRRFTMQSQFHLYDEAYYSRRRAQLSTSMDPLPAHPGQQ 430

Query: 421 -----NQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYIS 473
                NQ+  +    +   + + FE+   + SGL V F K+ E    Y +  W++Y S
Sbjct: 431 LEALYNQTHASAPTHASALLRVDFEVPYHTISGLKVEFLKILEPQLQYQSFPWIRYKS 488

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score = 87.8 bits (216), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 117/507 (23%), Positives = 196/507 (38%), Gaps = 116/507 (22%)

Query: 45  PVLTLGSTTFHHIRSSSNLWI--VAVTRSNADSAAIWEFLYKFNALLEAY----GLNSEE 98
           PV++  S  F HI+ SS L++  +    ++A+   I  FL +F++LL+ Y     L+   
Sbjct: 43  PVISASSFHFVHIKRSSLLYVSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSALDKNM 102

Query: 99  SLKEEFMTCYELLDVVLENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVD 158
            L +  +   EL+D  ++ GV   T+ S +   +  R  V++  N   D+L +  +   +
Sbjct: 103 VL-DNVLLIMELIDESIDFGVIQITDASIMRDYI--RVKVNMPENKTIDDLSLGDSDTDE 159

Query: 159 LGFRMPKFLNKGXXXXXXXXXPANGD---EHGDPCA--------------------YPWR 195
              +  K  +             +G    EH D  A                      WR
Sbjct: 160 EDNKKTKRRSGKPNLYKFLRGAKDGTHKAEHTDTAAKEDDVEDSYNSYIAKATIMPVSWR 219

Query: 196 SSGIKYKKNEIFLDVNERINILVS-KDGSILKSYVDGSVDLTTHLSGTPLCQFGLNDSLS 254
           + GI Y +NE FLDV E++  L+    G I K+ + G +   ++LSG P  +   N  LS
Sbjct: 220 AKGIHYARNEFFLDVVEQVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIAFN-KLS 278

Query: 255 LDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFNTDRIIRFVPPD 314
                  +D  FIS                       KFHQCV     N ++ I F+PPD
Sbjct: 279 ------QKDEQFISH---------------------SKFHQCVTWPSSN-EKEIEFIPPD 310

Query: 315 GSFELMRY----HVRDNLNLP---FKITPIFSVRSNNGAVEYRVALKSLFPSKLTAKDVV 367
           G F L +Y    HV+D   L    F + P    +     ++    +++ F ++ +   + 
Sbjct: 311 GDFVLCQYELKRHVKDQPMLKLVSFGVKP----KLKKYKIQMSCTIETHFKARNSTSTLN 366

Query: 368 LRIPVP----PGTVDCK----INTSNGRCRFVPEENAVLWKFAKYQGLTENT-------L 412
           L+IP+        +D K      + +G+  F   ++ +LW     +G   +T        
Sbjct: 367 LKIPLARLFQEYQIDLKKPARFKSDSGKVLFNISDDFLLWDIEVMKGGHGDTQLSMAAEF 426

Query: 413 SALTVPMDNQSSLNLQQWSRPP----------------------------MSLTFEILMF 444
           S        +    L+    PP                            +S+ FEI   
Sbjct: 427 SLFNKKEFEEEQEELKNSMNPPPLRDGPKLEELYDQVHNEKGPSKMASRLLSMKFEIPYS 486

Query: 445 SNSGLVVRFFKVSERDHSYHTVKWVKY 471
           + SGL V + K+ E    Y +  WV+Y
Sbjct: 487 TCSGLQVEYLKIDEEQLQYQSFPWVRY 513

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 81/348 (23%), Positives = 138/348 (39%), Gaps = 99/348 (28%)

Query: 191 AYPWRSSGIKYKKNEIFLDVNERINILVS-KDGSILKSYVDGSVDLTTHLSGTPLCQFGL 249
           A  WR  GI Y KNE FLDV E++  ++  ++G +  + ++G++   ++LSG P    GL
Sbjct: 178 AVSWRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVINGTIICRSYLSGMPQLSIGL 237

Query: 250 NDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFNTDR--I 307
           N  +  +   + R                             KFH+CV L+    +   +
Sbjct: 238 NKLMQKNVHFMKR----------------------------LKFHECVDLHTLIKEESPV 269

Query: 308 IRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRS--------NNGAVEYRVALKSL--- 356
           I+F+PPDG FEL  Y     LN P    P+  ++S         N   + ++ LK+    
Sbjct: 270 IKFIPPDGEFELCNY----KLNRPLLDEPVIKLQSFGLSQKPRKNQETQDKLLLKAAITT 325

Query: 357 -FPSKLTAKDVVLRIPVPPGTVDCKINTSN--------GRCRFVPEENAVLWKFAKYQGL 407
            F ++ +AK+++++IP+        I+           G   F     +++WK    +G 
Sbjct: 326 HFKAQDSAKELLIKIPIKSVIRKWNIDLEKPPLFKSDIGDVVFDITAGSIIWKINNLKGG 385

Query: 408 TENT---LSALTVPMDNQSSLNLQQWSR-----PPM------------------------ 435
             N    L  +    D Q    L+   R     PP+                        
Sbjct: 386 HGNKNYGLKCMFEIWDRQIHEALEVQLRNSMDPPPLRTGPKLERIWDQYHGKTTEYDGNE 445

Query: 436 ------------SLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKY 471
                       +++FEI  ++ SGL V +FK+ E   +Y +  WV+Y
Sbjct: 446 NQKEDVDKFALIAMSFEIPYYAVSGLKVEYFKIEEPQLNYQSFPWVRY 493

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 84/335 (25%), Positives = 132/335 (39%), Gaps = 85/335 (25%)

Query: 191 AYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKS-YVDGSVDLTTHLSGTPLCQFGL 249
           A  WR  GI Y KNE +LDV E +  LV      +KS  V G +   ++LSG P+   GL
Sbjct: 186 AISWRPKGIHYNKNEFYLDVIEHLEYLVDFQCMNIKSNTVYGYIQCRSYLSGMPMLTIGL 245

Query: 250 NDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFNTDRIIR 309
           N             L+  +EY ++                   FHQCV L++  TD++I 
Sbjct: 246 NK------------LNSENEYFMRR----------------ANFHQCVNLDQLTTDKLIS 277

Query: 310 FVPPDGSFELMRYHVRDNLNLP---------FKITPIFSVRSNNGAVEYRVALKSLFPSK 360
           F PPDG F+L  Y +  N++ P          K+ P    ++ +G     +A+      K
Sbjct: 278 FTPPDGEFQLCNYKLTRNMSDPPMIKLEDCKVKLKP---RKTKDGLDRLILAVTISTYFK 334

Query: 361 LTAKDVVLRIPVPPGTV--DCKINTS--------NGRCRFVPEENAVLWKFAKYQG---- 406
           L     +L I VP   V  D  ++ S         G+  F   ++ +LW+  K +G    
Sbjct: 335 LQDSTSLLNIKVPLSKVFRDWDVDLSYQPRFKCEQGKVMFNITDDYLLWEVGKVKGGHGD 394

Query: 407 ---------LTENTLSALTVPMDNQSSLNLQQWSRPP---------------------MS 436
                       N      +     +S++ +   R P                     + 
Sbjct: 395 KTLKMQSEFHLHNREHEARIKQQLSNSMDPKPIRRGPHLEKLYQQTHELNSPTSEAALLK 454

Query: 437 LTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKY 471
           + FEI  ++ SGL V F K+ E+   + +  WV+Y
Sbjct: 455 VEFEIPYYTISGLKVEFLKIEEKQLQFQSFPWVRY 489

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score = 86.3 bits (212), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 91/364 (25%), Positives = 139/364 (38%), Gaps = 120/364 (32%)

Query: 194 WRSSGIKYKKNEIFLDVNERINILVS-KDGSILKSYVDGSVDLTTHLSGTPLCQFGLNDS 252
           WR+ GI Y KNE FLDV ER+  L+  + G I K+ + G +   ++LSG P  +  +N  
Sbjct: 255 WRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKLKISIN-- 312

Query: 253 LSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFNT-------- 304
                  L+RD  F+S                     +  FHQCV L+  NT        
Sbjct: 313 -----KILNRDPQFMS---------------------NSNFHQCVSLDSINTIEKGQEKE 346

Query: 305 -----------DRIIRFVPPDGSFELMRY----HVRDNLNLP---FKITPIFSVRSNNGA 346
                       R I FVPPDG F L +Y    HV+D   +    F+I P    +     
Sbjct: 347 QNTGDSQAAADAREIEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFEIKP----KLKKSK 402

Query: 347 VEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTS--------NGRCRFVPEENAVL 398
           ++    +++ F    +   + ++IP+     D KI+ S        NG+  F   ++ +L
Sbjct: 403 IQILTKIQTNFKPTNSTSKLNVKIPLTRVFQDYKIDLSKQIRFKANNGKVVFNLSDDFLL 462

Query: 399 WKFAKYQGLTENTLSALTVPMDNQ------------SSLNLQQWSR-----------PPM 435
           W+    +G  E   +A   P D+             S  N +++ R           PP+
Sbjct: 463 WEIQTMKGHRER--NASNAPQDDGDPSTCASMVAEFSLFNQEEYDRLQEEMKTSMNPPPL 520

Query: 436 ----------------------------SLTFEILMFSNSGLVVRFFKVSERDHSYHTVK 467
                                       S+ FEI   + SGL V + KV E    Y +  
Sbjct: 521 RTGPKLEELYNQVHDKHTPHVTPRDRLVSIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFP 580

Query: 468 WVKY 471
           WV+Y
Sbjct: 581 WVRY 584

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score = 86.3 bits (212), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 77/329 (23%), Positives = 129/329 (39%), Gaps = 80/329 (24%)

Query: 194 WRSSGIKYKKNEIFLDVNERINILVS-KDGSILKSYVDGSVDLTTHLSGTPLCQFGLNDS 252
           WR+ GI Y KNE FLDV E++  L   K+  + K+ + G +   ++LSG P  +  LN  
Sbjct: 238 WRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKLKIALNK- 296

Query: 253 LSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFNTDRIIRFVP 312
                  L RD  F+S                       KFHQCV L   N ++ + F+P
Sbjct: 297 ------LLQRDAQFMSH---------------------SKFHQCVALETLN-EKELEFIP 328

Query: 313 PDGSFELMRYHVRDNLN-LPFKITPIFSVRSNNGAVEYRVAL--KSLFPSKLTAKDVVLR 369
           PDG F L  Y ++ ++N  P      F ++      + R+ L  ++ F ++ +   + ++
Sbjct: 329 PDGEFILCEYELKRHVNDTPILKITSFEIKPQLKKFKLRILLTIETHFKTRNSTSILNVK 388

Query: 370 IPVPPGTVDCKINTSN--------GRCRFVPEENAVLWKFAKYQGLTENTLSALTVPMD- 420
           IP+     D  I+ S         G+  F   ++ +LW+  + +G    T  ++      
Sbjct: 389 IPLAKLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGETQFSMVAEFSL 448

Query: 421 ------------NQSSLNLQQWSRPP--------------------------MSLTFEIL 442
                        + S+N       P                          + + FEI 
Sbjct: 449 FNKEEFEREQEERKHSMNPPPLREGPKLEELYAQTHSQKDPEVLVKSIQSQLVGMDFEIP 508

Query: 443 MFSNSGLVVRFFKVSERDHSYHTVKWVKY 471
             + SGL V + K+ E    Y +  WV+Y
Sbjct: 509 YTTCSGLKVEYLKIEEEQLQYQSFPWVRY 537

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score = 85.1 bits (209), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 106/481 (22%), Positives = 183/481 (38%), Gaps = 119/481 (24%)

Query: 63  LWIVAVTRSNADSAAIWEFLY--KFNALLEAY-GLNSEESLK--EEFMTCYELLDVVLEN 117
           L+ V+++  +  S+ +   +Y   F+ LL+ Y  +N+ +  +  + F   YELLD  L+ 
Sbjct: 60  LYFVSMSVGSLRSSIMSTLVYLNDFHMLLKKYLRVNALDRTRIVDNFNLIYELLDESLDF 119

Query: 118 GVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGXXXXXXX 177
           G+P  T+ + +   +  +P     N P   ++   A +N D      +  N         
Sbjct: 120 GIPQLTDFNIIRDSIKIQP-----NIPPDPKI---ARSNSDDDESEQEESNVAETQEKSN 171

Query: 178 XXPANGDEH--------GDPCAYPWRSSGIKYKKNEIFLDVNE-RINILVSKDGSILKSY 228
                 DE             A  WR  GI Y KNE+F+DV E +  ++  K   + K++
Sbjct: 172 KHGFQDDEEYINSFVLRTTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHHQVRKNF 231

Query: 229 VDGSVDLTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQL 288
           + G +   ++LSG P+ +  +N  L        +D D                      L
Sbjct: 232 IFGRIICRSYLSGMPVVKICINKML--------KDRDQF--------------------L 263

Query: 289 EDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRY----HVRDN----------------- 327
              KFHQCV L   ++   I F+PPDG F+L  Y    H+ D+                 
Sbjct: 264 SSAKFHQCVSLESLSSQDFIEFIPPDGDFQLCEYKIKRHISDSPVIKLIEYKVVEKPKKH 323

Query: 328 -LNLPFKITPIFSVRSNNGAVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNG 386
            L +  KI P F  +++   ++ RV ++ +F    T K  + + P        +     G
Sbjct: 324 KLQISMKIQPHFKAQNSATFLDIRVPIQDIFE---TYKIDLTKQP--------RFKCDFG 372

Query: 387 RCRFVPEENAVLWKFAKYQGLTENTLSALTVPM-------DNQSSLNLQQWSRPP----- 434
              F   +  +LWK    +G    T  ++ V           + +  L+    PP     
Sbjct: 373 SILFNLSDGYLLWKANGMKGGHGETYHSMQVEFFLFDAEAHRKEAEELKNSMDPPPLREG 432

Query: 435 ------------------------MSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVK 470
                                   ++  FE+  F++SGL V + K+ E    Y +  WV+
Sbjct: 433 VRMEELYALAHEEKGQINNPVRNMITAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFPWVR 492

Query: 471 Y 471
           Y
Sbjct: 493 Y 493

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score = 85.1 bits (209), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 81/344 (23%), Positives = 133/344 (38%), Gaps = 85/344 (24%)

Query: 194 WRSSGIKYKKNEIFLDVNERINILVSKDGSIL-KSYVDGSVDLTTHLSGTPLCQFGLNDS 252
           WR+ GI+Y KNE FLDV E++   +    +I+ K+ + G +   + LSG P  +  LN  
Sbjct: 225 WRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTLKVSLNKI 284

Query: 253 LSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFNTDRIIRFVP 312
           +  D   LS                             CKFHQCV  +  +  +++ FVP
Sbjct: 285 IYQDKQFLSS----------------------------CKFHQCVMPDSVDEGKVLEFVP 316

Query: 313 PDGSFELMRYHVRDNLN-LPFKITPIFSVRSNNGAVEYR--VALKSLFPSKLTAKDVVLR 369
           PDG F L +Y ++ ++N LP      + V+      + +  V ++S F    +   + ++
Sbjct: 317 PDGDFVLCKYELKRHVNDLPLLKLISYEVKPKLDKYKLKLFVTIESTFKKTNSTTKLNIK 376

Query: 370 IPVPPGTVDCKINTSN--------GRCRFVPEENAVLWKFAKYQGLTENTLSALTVPMDN 421
           IP+        I+ S         G+  F   ++ +LW+    +G            + N
Sbjct: 377 IPLKVLLEKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGAMKGGNSQLKMGADFALFN 436

Query: 422 QSSLNLQQ------WSRPPM------------------------------------SLTF 439
           +     QQ       + PP+                                     + F
Sbjct: 437 EEEYLRQQEELKTSMNPPPLRTGPKLEELYKQIHEEKCNNFTRKGESSDETKGNLIKMDF 496

Query: 440 EILMFSNSGLVVRFFKVSERDHSYHTVKWVKY--ISRSG-AYEV 480
           EI   ++SGL V + K+ E +  Y    WV+Y  IS  G AY V
Sbjct: 497 EIPYNTSSGLKVEYLKIEEPNLQYQAFPWVRYKTISDDGYAYAV 540

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 84/352 (23%), Positives = 133/352 (37%), Gaps = 99/352 (28%)

Query: 191 AYPWRSSGIKYKKNEIFLDVNERINILVS-KDGSILKSYVDGSVDLTTHLSGTPLCQFGL 249
           A  WR+ GI Y KNE FLDV E +  L++ KD  I ++ + G +   ++LSG P  +  L
Sbjct: 224 AVSWRTKGIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTLRIAL 283

Query: 250 NDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFNTDRI-- 307
           N  L  D   L                               KFHQCV LN  N   +  
Sbjct: 284 NKILQDDKQFLGH----------------------------AKFHQCVSLNSINIKDLEK 315

Query: 308 ------------------IRFVPPDGSFELMRYHVRDNLNLPFKITPI-FSVRSNNGAVE 348
                             I F+PPDG F L +Y +R ++  P  I    F ++ N     
Sbjct: 316 DLEGPNDISNKNFVNKKEIEFIPPDGEFVLCQYELRRHVKDPPVINMTSFDIKPNFKKFR 375

Query: 349 YRVALK--SLFPSKLTAKDVVLRIPVPPGTVDCKINTSN--------GRCRFVPEENAVL 398
            +++LK  + F  + +   + ++IP+     D KI+ S         G+  F   E+ ++
Sbjct: 376 VQISLKIETHFKRQNSTSLMTIKIPLLQLFNDYKIDLSKQPRFKSDVGKVLFNISEDFLI 435

Query: 399 WKFAKYQ---GLTENTLSALTVPMDNQSSLNLQQWSR-----PPMS-------------- 436
           W+    +   G  E  + A     + +    LQ+ ++     PP+               
Sbjct: 436 WEIDALKGGHGENEKGMVAEFFLFNQEEYDRLQEEAKISMNPPPLRNGPKLEELYEEMHE 495

Query: 437 -----------------LTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKY 471
                            + FEI   + SGL V + K+ E    Y +  WV+Y
Sbjct: 496 NEDAEDTALKMKTQYVFMQFEIPYSTCSGLKVEYLKIEEDLLKYQSFPWVRY 547

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score = 83.2 bits (204), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 90/365 (24%), Positives = 140/365 (38%), Gaps = 121/365 (33%)

Query: 194 WRSSGIKYKKNEIFLDVNERINILVS-KDGSILKSYVDGSVDLTTHLSGTPLCQFGLNDS 252
           WR+ GI Y KNE FLDV ER+  L+  + G I K+ + G +    +LSG P  +  +N  
Sbjct: 254 WRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN-- 311

Query: 253 LSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFN--------T 304
                  L+RD  F+S                     + KFHQCV L+  N        T
Sbjct: 312 -----KLLNRDPQFMS---------------------NSKFHQCVSLDSINIIEEEGRDT 345

Query: 305 D----------RIIRFVPPDGSFELMRY----HVRDNLNLP---FKITPIFSVRSNNGAV 347
           D          + I F+PPDG F L +Y    HV+D   +    F+I P    +     +
Sbjct: 346 DDAGSQTATDTKEIEFIPPDGEFVLCQYELKRHVKDAPMIKLQGFEIKP----KLKKFKI 401

Query: 348 EYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSN--------GRCRFVPEENAVLW 399
           +    +++ F    +   + ++IP+     D KI+ S         G+  F   ++ +LW
Sbjct: 402 QIITKIQTNFKPTNSTSKLNVKIPLTKVFQDYKIDLSKQIRFKANLGKVVFNLSDDFLLW 461

Query: 400 KFAKYQGLTENTLSALTVPMDNQSS-----------LNLQQWSR-----------PPM-- 435
           +    +G  E      TVP ++ +S            N +++ R           PP+  
Sbjct: 462 EIGTMKGHRERNTG--TVPQEDDASTLASMVAEFPLFNQEEYDRLQEELKTSMNPPPLRT 519

Query: 436 -----------------------------SLTFEILMFSNSGLVVRFFKVSERDHSYHTV 466
                                        S+ FEI   + SGL V + KV E    Y + 
Sbjct: 520 GPKLEELYKQVHEERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVEYLKVEEPQLQYQSF 579

Query: 467 KWVKY 471
            WV+Y
Sbjct: 580 PWVRY 584

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 79/343 (23%), Positives = 133/343 (38%), Gaps = 96/343 (27%)

Query: 194 WRSSGIKYKKNEIFLDVNERINILVS-KDGSILKSYVDGSVDLTTHLSGTPLCQFGLNDS 252
           WR+ GI Y KNE FLDV E++  L+    G I K+ + G +    +LSG P  +  LN  
Sbjct: 218 WRTKGIYYAKNEFFLDVIEKVQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALN-- 275

Query: 253 LSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFNT-------- 304
                  +  D  FIS                     + KFHQCV +N            
Sbjct: 276 -----KLIKNDEQFIS---------------------NSKFHQCVSINSLKREINNEEEE 309

Query: 305 ----DRIIRFVPPDGSFELMRY----HVRDNLNLP-FKITPI-FSVRSNNGAVEYRVALK 354
                + I F+PPDG F L +Y    HVRD   +P  K++ I    +     ++  V ++
Sbjct: 310 NTYHGKEIEFIPPDGEFVLCKYELKRHVRD---VPVIKLSNIEIKPKLKKYKIQIHVTIE 366

Query: 355 SLFPSKLTAKDVVLRIPVPPGTVDCKINTSN--------GRCRFVPEENAVLWKFAKYQG 406
           + F  + +   + ++IP+       KI+ +         G   F   ++ ++W+    +G
Sbjct: 367 THFKKQNSTSVLTIKIPLRMVFSQYKIDLTKQPRFKSDFGEVLFNISDDFLIWEVGSMKG 426

Query: 407 -----------------------LTENTLSALTVP---------------MDNQSSLNLQ 428
                                  L E   +++  P                DN+   +  
Sbjct: 427 GNGESKNNMVAEFFIFNQEEYDRLQEEMKTSMNPPPLREGPKLEEIYEQTHDNRDEHDKN 486

Query: 429 QWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKY 471
             S+  +++ FE+   + SGL V + K+ E   +Y +  WV+Y
Sbjct: 487 GISQQLLTMKFEVPYSTCSGLKVEYLKIEENQVNYQSFPWVRY 529

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 91/366 (24%), Positives = 141/366 (38%), Gaps = 120/366 (32%)

Query: 194 WRSSGIKYKKNEIFLDVNERINILVS-KDGSILKSYVDGSVDLTTHLSGTPLCQFGLNDS 252
           WR+ GI Y KNE FLDV ER+  L+  + G I K+ + G +    +LSG P  +  +N  
Sbjct: 260 WRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKLKISIN-- 317

Query: 253 LSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFNT-------- 304
                  L+RD  F+S                     +  FHQCV L+  NT        
Sbjct: 318 -----KILNRDPQFMS---------------------NSSFHQCVSLDSINTIEKDEEKN 351

Query: 305 ------------DRIIRFVPPDGSFELMRY----HVRDNLNLPFKITPIFSVRSNNGAVE 348
                        R I F+PPDG F L +Y    HV+D    P      F ++      +
Sbjct: 352 SDDDAGLQAATDAREIEFIPPDGEFVLCQYELKRHVKD---APMVRLKDFEIKPKLKKFK 408

Query: 349 YRVALK---SLFPSKLTAKDVVLRIPVPPGTVDCKINTSN--------GRCRFVPEENAV 397
            ++  K   +  P+  T+K + +RIP+     + KI+ S         G+  F   ++ +
Sbjct: 409 IQIVTKIQTNFKPTNSTSK-LNVRIPLTKVFQEYKIDLSKQIRFKANIGKVVFNLSDDFL 467

Query: 398 LWKFAKYQGLTE----------------NTLSALTV--PMDNQSSLN-LQQWSR-----P 433
           LW+    +G  E                NT +++    P+ NQ   + LQ+  +     P
Sbjct: 468 LWEIQTMKGHREHSTNKSSQYNSDEDDPNTCASMVAEFPLFNQEEYDRLQEEMKTSMNPP 527

Query: 434 PM----------------------------SLTFEILMFSNSGLVVRFFKVSERDHSYHT 465
           P+                            ++ FEI   + SGL V + KV E    Y +
Sbjct: 528 PLRTGPRLEELYRQVHDQQTSHVTPRDKLVNIDFEIPYCTCSGLKVEYLKVEEPQLQYQS 587

Query: 466 VKWVKY 471
             WV+Y
Sbjct: 588 FPWVRY 593

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score = 80.1 bits (196), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 107/236 (45%), Gaps = 40/236 (16%)

Query: 194 WRSSGIKYKKNEIFLDVNERINILVS-KDGSILKSYVDGSVDLTTHLSGTPLCQFGLNDS 252
           WR+ GI Y KNE FLDV E++  LV  + G + +S + G +   ++LSG P  +  LN  
Sbjct: 251 WRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLN-- 308

Query: 253 LSLDGGTLSRDLDFISEYEVKN-------KKAIPKAAAGSVQLEDCKFHQCVQLNRFNTD 305
                  L  D  FIS+ +          +K I  A   S +L+  K  +       N +
Sbjct: 309 -----KLLQNDKQFISQVQFHQCVSLDSIEKVIKYAEEHSDELKTLKHTE------HNAE 357

Query: 306 RIIRFVPPDGSFELMRYHVRDNLNLP-------FKITPIFSVRSNNGAVEYRVALKSLFP 358
             I F+PPDG F L  Y ++ ++  P       F+ITP    +     ++   A+++ F 
Sbjct: 358 SEIEFIPPDGDFTLCSYELKRHIRDPPMVKLCSFEITP----KWKKYKLKISAAVETHFK 413

Query: 359 SKLTAKDVVLRIPVPPGTVDCKIN--------TSNGRCRFVPEENAVLWKFAKYQG 406
              +   + ++IP+     D +I+        TSNGR  +   ++ +LW+    +G
Sbjct: 414 PTNSTSKLDVKIPISKVFKDYQIDLKKPIKFKTSNGRVVYNISDDFLLWEIGVIKG 469

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 21/37 (56%)

Query: 435 MSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKY 471
           +S+ FEI   + SGL V + K+ E    Y +  WV+Y
Sbjct: 550 LSMDFEIPYCTCSGLKVEYLKIDEDQLQYQSFPWVRY 586

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 104/239 (43%), Gaps = 49/239 (20%)

Query: 194 WRSSGIKYKKNEIFLDVNERINILVS-KDGSILKSYVDGSVDLTTHLSGTPLCQFGLNDS 252
           WR+ GI Y KNE FLDV E+   ++  K+  I K+ + G +     LSG P  +  LN  
Sbjct: 289 WRTKGIYYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALN-- 346

Query: 253 LSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFNTDRIIRFVP 312
                  L +D  F+S+                      +FHQCV L     ++ I F+P
Sbjct: 347 -----KLLQKDQQFLSQ---------------------LRFHQCVSLETIQ-NKEIEFIP 379

Query: 313 PDGSFELMRY----HVRDNLNLP---FKITPIFSVRSNNGAVEYRVALKSLFPSKLTAKD 365
           PDG F L  Y    HV+D  N+    F+I P    +     ++  +++ + F  + +   
Sbjct: 380 PDGEFILCEYELKRHVKDPPNIKLISFEIKP----KLKKFKIQINLSITTFFKVQNSTSI 435

Query: 366 VVLRIPVPPGTVDCKINTSN--------GRCRFVPEENAVLWKFAKYQGLTENTLSALT 416
           + L+IP+     D KI+           G+ +F   ++ +LW+    +G     + A+T
Sbjct: 436 LNLKIPLEKLFNDYKIDLKKSPRFKSNIGQVKFNLSDDFLLWEIGSMKGGHGENIKAMT 494

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 2/43 (4%)

Query: 431 SRPPMSLT--FEILMFSNSGLVVRFFKVSERDHSYHTVKWVKY 471
           S  P  LT  FEI  ++ SGL V + K+ E    Y +  WV+Y
Sbjct: 603 SNKPQYLTVDFEIPYYACSGLKVEYLKIEEEQLLYQSFPWVRY 645

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 85/317 (26%), Positives = 130/317 (41%), Gaps = 75/317 (23%)

Query: 193 PWRSSGIKYKKNEIFLDVNERINILV---SKDGSI--LKSYVDGSVDLTTHLSGTPLCQF 247
           PWR++G+KY  NE+++DV E I++++    K G +  ++  +DG VD  +HL+G P+   
Sbjct: 187 PWRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTGNPVVAL 246

Query: 248 GLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFNTDRI 307
            LN    L G  L                 +P              H C Q     +   
Sbjct: 247 KLN----LHGHDL----------------GVP------------ALHPCCQAQYTGSPEN 274

Query: 308 IRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAV--EYRVALKSL---FPSKLT 362
           ++FVPPDG F LM+Y +  +L      + +F   SN G V  +Y V L  L   F  K+ 
Sbjct: 275 LQFVPPDGKFRLMQYTI--DLEALQTKSKLF---SNMGLVSLDYFVGLGDLRDEFEIKVN 329

Query: 363 AK---------DVVLRIPVPPGTVDCKIN---TSNGRCRFVPEENAVLWKFAKYQGLTEN 410
                      D+V+ I     T DC+I    +++G      E N   W F K       
Sbjct: 330 IAGSQHVKLIDDLVVTIKFGKLTSDCRIKALRSTHGHFENGFENNIGKWSFDK------- 382

Query: 411 TLSALTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERD------HSYH 464
                TVP+      N        +SL    + +SN G +    KV   D       +  
Sbjct: 383 ETPTGTVPVFRGCLENATPEQIKTLSLA---ISYSNKGSLPSGIKVGAVDIISGLPKNTK 439

Query: 465 TVKWVKYISRSGAYEVR 481
             K VKY++R+G + +R
Sbjct: 440 PFKGVKYVARTGQFNLR 456

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score = 76.3 bits (186), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 82/366 (22%), Positives = 137/366 (37%), Gaps = 116/366 (31%)

Query: 194 WRSSGIKYKKNEIFLDVNERINILVS-KDGSILKSYVDGSVDLTTHLSGTPLCQFGLNDS 252
           WR+ GI Y KNE FLDV ER+  L+  + G I K+ + G +    +LSG P  +  +N  
Sbjct: 262 WRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN-- 319

Query: 253 LSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFNT-------- 304
                  L+RD  F+S                     +  FHQCV L+   T        
Sbjct: 320 -----KILNRDAQFLS---------------------NSSFHQCVSLDSIKTIEKREEKE 353

Query: 305 -----------DRIIRFVPPDGSFELMRY----HVRDNLNLP---FKITPIFSVRSNNGA 346
                       + + FVPPDG F L +Y    HV+D   +    F+I P    +     
Sbjct: 354 DDDTGLQAAADAKELEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFQIKP----KLKKFK 409

Query: 347 VEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSN--------GRCRFVPEENAVL 398
           ++    +++ F    +   + ++IP+     + +I+ S         G+  F   ++ +L
Sbjct: 410 IQIETKIQTNFKPTNSTSKLNVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVFNLSDDFLL 469

Query: 399 WKFAKYQGLTENTLSALT---------------VPMDNQSSLNLQQWSR------PPM-- 435
           W+    +G  E+  +  +                P+ NQ   +  Q  +      PP+  
Sbjct: 470 WEIQAMKGHREHNTNKTSQDDNDPDACASMVAEFPLFNQEEYDRLQEEKKTSMNPPPLRT 529

Query: 436 --------------------------SLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWV 469
                                     ++ FEI   + SGL + + KV E    Y +  WV
Sbjct: 530 GPRLEELYRQVHDQQIAHVTPRDKLVAIDFEIPYCTCSGLKIEYLKVEEPQLQYQSFPWV 589

Query: 470 KYISRS 475
           +Y + S
Sbjct: 590 RYKTTS 595

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 58/126 (46%), Gaps = 10/126 (7%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSS 60
           M ++LF+  +  EL+VSK IR     S       Q  +  D   P+L+     F H++  
Sbjct: 1   MSSSLFILDENLELLVSKNIRALPSLSSVLSSFKQCYH--DEAPPILSQNDWFFIHLKRD 58

Query: 61  SNLWIVAVTRS----NADSAAIWEFLYKFNALLEAY---GLNSEESLKEEFMTCYELLDV 113
             L  V+V  +    N D   I  FL +F  LL+ Y    + +++ + +  +   EL+D 
Sbjct: 59  F-LHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQEYFEIKVLTKDVILDNVLLVLELMDE 117

Query: 114 VLENGV 119
            ++ G+
Sbjct: 118 CIDFGI 123

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score = 76.3 bits (186), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 85/358 (23%), Positives = 142/358 (39%), Gaps = 113/358 (31%)

Query: 194 WRSSGIKYKKNEIFLDVNERINILVS-KDGSILKSYVDGSVDLTTHLSGTPLCQFGLNDS 252
           WR+ GI Y KNE FLDV E++   +  K G I K+ + G +   ++LSG P  +  +N  
Sbjct: 252 WRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEIICRSYLSGMPKLKISIN-- 309

Query: 253 LSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLN----RFNTDRI- 307
                  L +D+ F+S                     + KFHQCV L+    R N   + 
Sbjct: 310 -----KILKQDVQFLS---------------------NVKFHQCVSLDSIRARSNPPAVE 343

Query: 308 ------------------IRFVPPDGSFELMRY----HVRDNLNLP---FKITPIFSVRS 342
                             I F+PPDG F L +Y    HV+D   +    F+I P    + 
Sbjct: 344 EDGKKKNEEADTLGNKGEIEFIPPDGEFLLCKYELKRHVKDQPMIKLRNFEIIP----KL 399

Query: 343 NNGAVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLW--- 399
           +   ++  V +++ F +  +   + LRIP+       +I+ S  + +F  E+  VL+   
Sbjct: 400 HKFKIKIHVIIETHFKTTNSTSKLNLRIPITNLFQSYRIDLSK-QPKFKCEQGTVLFNLS 458

Query: 400 -KFAKYQ------GLTENTLSALT------------VPMDNQSSLNLQQWSRPP------ 434
            KF  ++      G  ENTLS +             +  + ++S+N       P      
Sbjct: 459 DKFLLWEVGTMNGGHGENTLSMMAEFALFNEEEYKKMEEERKTSMNPPPLREGPKLEELY 518

Query: 435 ---------------------MSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKY 471
                                +++ FE+   + SGL + + K+ E    Y +  WV+Y
Sbjct: 519 KKIHEEGDSDEVSTRKKNESLLTMDFEVPYCTCSGLKIEYLKIEEDQLQYQSFPWVRY 576

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 76/353 (21%), Positives = 132/353 (37%), Gaps = 101/353 (28%)

Query: 194 WRSSGIKYKKNEIFLDVNERINILVSKDGSIL-KSYVDGSVDLTTHLSGTPLCQFGLNDS 252
           WR+ GI Y KNE FL+V E++   +    +++ K+ + G +     LSG P  +  +N  
Sbjct: 255 WRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSGMPNLKVSINKI 314

Query: 253 LSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFNTD--RIIRF 310
           ++ D   L+                            +CKFHQCV L    +   + + F
Sbjct: 315 VNEDKQFLA----------------------------NCKFHQCVSLASLESSDHKDVEF 346

Query: 311 VPPDGSFELMRY----HVRDNLNLP---FKITPIFSVRSNNGAVEYRVALKSLFPSKLTA 363
           VPPDG F L RY    HVRD   +    F++ P              + +++ F +    
Sbjct: 347 VPPDGEFTLCRYELKRHVRDEPMVKLVNFEVKPKLKKFKLKLL----LTIETHFKTTNAT 402

Query: 364 KDVVLRIPVPPGTVDCKINTSN--------GRCRFVPEENAVLWKFAKYQGLTENTLSAL 415
             + LR+P+     + +++ S         G   F   ++ +LW+     G    T  ++
Sbjct: 403 SKLALRVPIKQLFREYRVDLSKNLKSKCDRGAILFNISDDFLLWEVGSMSGGHGETQLSM 462

Query: 416 TV--PMDNQSSLNLQQ------WSRPP--------------------------------- 434
            V   + NQ   + +Q       + PP                                 
Sbjct: 463 GVEFALFNQEEYDREQEMLKTSMNPPPLREGPKLEELYKQIHEDDDDDDGNTEPVAEHRL 522

Query: 435 ----------MSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYISRSGA 477
                     +++ FE+   ++SGL V + K+ E    Y +  WV+Y + S A
Sbjct: 523 QPRTREIDKLLTMDFEVPYCTSSGLRVEYLKIEEPQLEYQSFPWVRYTTLSDA 575

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 84/328 (25%), Positives = 136/328 (41%), Gaps = 73/328 (22%)

Query: 183 GDEHGDPCA----YPWRSSGIKYKKNEIFLDVNERINILVSKD---GSI--LKSYVDGSV 233
           GD    P A     PWRS+G+KY  NE+++DV E +++++ K+   G +  ++  +DG V
Sbjct: 173 GDPAKGPAAKEKLVPWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVV 232

Query: 234 DLTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKF 293
           D  +HLSG P+       +L L G  L                 +P              
Sbjct: 233 DFRSHLSGNPVIAL----NLRLRGHDL----------------GMP------------AL 260

Query: 294 HQCVQLNRFNTDRIIRFVPPDGSFELMRYHVR-DNLNLPFK-------ITPIFSVRSNNG 345
           HQC   +       +RFVPPDG F+LM Y +  D+L    K       ++P +     + 
Sbjct: 261 HQCCLDSYQGRPDQLRFVPPDGKFQLMHYSIDLDSLQSKSKLFSNIGLVSPDYRTELGDL 320

Query: 346 AVEYRVALKSLFPSKLTAK---DVVLRIPVPPGTVDCKIN---TSNGRCRFVPEENAVLW 399
             E+ V L         AK   D+V+ +   P   +CKI    +++G        N   W
Sbjct: 321 GDEFEVNLN--IAGSQHAKVVDDLVITLSFGPLPSECKIKVLRSTHGHFENCASNNIGKW 378

Query: 400 KFAKYQGLTENTLSALTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSER 459
            F K       TL  L   ++N +    +Q     +S++     ++N G +    KV   
Sbjct: 379 VFDKET--PTGTLPVLRGCLENATR---EQVRALQLSVS-----YTNRGELPSGIKVDSV 428

Query: 460 D------HSYHTVKWVKYISRSGAYEVR 481
           D       +    K VKYI+++G + +R
Sbjct: 429 DILSGLSKNIKPFKGVKYIAKTGDFHLR 456

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 66/147 (44%), Gaps = 39/147 (26%)

Query: 184 DEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDLTTHLSGTP 243
           D   D    PWR SGI Y  NEIF+D++E IN +V K G +L  ++ G +DL  HLSG P
Sbjct: 202 DHSVDESGVPWRMSGINYANNEIFIDMSEEINAIVEK-GKLLTGHIKGCIDLNNHLSGQP 260

Query: 244 LCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFN 303
           L +  L        G L   L  +                      +  FH+C+  ++ N
Sbjct: 261 LVEMKL--------GLLDHKLSHL----------------------NTTFHRCILEDKAN 290

Query: 304 T--DRI------IRFVPPDGSFELMRY 322
           +  D I      + FVPPDG   L +Y
Sbjct: 291 SINDLIAGKFTKLTFVPPDGRTRLCQY 317

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 72.4 bits (176), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 84/319 (26%), Positives = 126/319 (39%), Gaps = 68/319 (21%)

Query: 193 PWRSSGIKYKKNEIFLDVNERINILVSKDG------SILKSYVDGSVDLTTHLSGTPLCQ 246
           PWRS  IK  +NEI++DV E + + + K         +L  Y++GSV + + + G P+ +
Sbjct: 174 PWRSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNGYINGSVSVDSSIGGVPMLE 233

Query: 247 FGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRF--NT 304
                     GG      DF        K  IPK            FH CV++N F  N 
Sbjct: 234 VSF-------GGC-----DF--------KDIIPK------------FHDCVEVNEFLTND 261

Query: 305 DRIIRFVPPDGSFELMRYHV-----RDNLNLPFKITPIFSVRSNNGAVEYRVAL---KSL 356
             II+F+PPDG F+LM Y +      DNL     I+  F+    N   E+ + L   KS 
Sbjct: 262 GNIIKFIPPDGKFQLMEYSMALSSFNDNL-----ISCNFTNGLGNSNDEFEITLNINKSN 316

Query: 357 FPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSALT 416
              K+    V L      G    KI   N   RF   +N  ++      G        + 
Sbjct: 317 KVPKINNLQVCLNFENREGQSKVKI-LRNTHGRFEYGKNTWIFDSELLTGTLPVLRGCVE 375

Query: 417 VPMDNQSSLNLQQWSRPPMS-----LTFEILMFSNSGLV---VRFFKVSERDHS------ 462
               N+    +    R  +S     L   I+ F   G +    R   ++ R+ S      
Sbjct: 376 EETKNEEDGGIDGEGRRILSKLRPELRSVIMSFQYEGQLPSGTRVSSINIRNDSTSNPQR 435

Query: 463 YHTVKWVKYISRSGAYEVR 481
               K VKY++++  YE+R
Sbjct: 436 QQLFKGVKYVTKTSNYEIR 454

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 102/232 (43%), Gaps = 29/232 (12%)

Query: 194 WRSSGIKYKKNEIFLDVNERINILVS-KDGSILKSYVDGSVDLTTHLSGTPLCQFGLNDS 252
           WR+ GI Y KNE FLDV E++   +  + G I K+ + G +    +LSG P  +  +N  
Sbjct: 297 WRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISINK- 355

Query: 253 LSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFNTDRI----I 308
                  L  D  F+S        ++      S + +D   +  V  N  + +R     I
Sbjct: 356 ------ILQNDSQFLSNAHFHQCVSLDSLHLQSAEDDDGDDNANVNENENHDERDRKKEI 409

Query: 309 RFVPPDGSFELMRY----HVRDNLNLPFKITPIFSVRS--NNGAVEYRVALKSLFPSKLT 362
            F+PPDG F L +Y    HV+D   LP     +F ++   +   ++  V +++ F +   
Sbjct: 410 EFIPPDGDFLLCKYELKRHVKD---LPVIKLKLFDIKPKLSKYKLKIHVIIETHFKTTNN 466

Query: 363 AKDVVLRIPVPPGTVDCKINTS--------NGRCRFVPEENAVLWKFAKYQG 406
              + L+IP+     + +I+ S         G+  F   +N ++W+    +G
Sbjct: 467 TSKLNLKIPIERLFQEYRIDLSKQIKFKCDQGKVLFNLSDNFLIWEIGSMKG 518

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 426 NLQQWSRPP--MSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKY 471
           +L++ +R P  + + FEI  ++ SGL + + K+ E    Y +  WV+Y
Sbjct: 613 DLRKRTRSPNLLKIDFEIPYYTCSGLKIEYLKIEEPQLQYQSFPWVRY 660

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 64/138 (46%), Gaps = 38/138 (27%)

Query: 193 PWRSSGIKYKKNEIFLDVNERINILVSKDGSI-----LKSYVDGSVDLTTHLSGTPLCQF 247
           PWRS+G+KY  NE+++D+ E +NI+++K  +      +   +DG V    +LS  PL + 
Sbjct: 205 PWRSAGVKYTNNELYVDMAETVNIILAKTRNSTSLVPISGSIDGEVGFKCYLSENPLVEL 264

Query: 248 GLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFN-TDR 306
            LN        T   DL             IP             FH+CV+    +    
Sbjct: 265 DLN--------TNGHDL------------GIP------------AFHRCVRTEGSDFHPG 292

Query: 307 IIRFVPPDGSFELMRYHV 324
            +RF+PPDG F LM Y++
Sbjct: 293 TLRFIPPDGDFCLMEYNI 310

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 69/153 (45%), Gaps = 50/153 (32%)

Query: 193 PWRSSGIKYKKNEIFLDVNERINILVSKDG----------SILKSYVDGSVDLTTHLSGT 242
           PWR++G+KY  NE+++D+ E I+++  K G           ++   ++G   +  +LSG 
Sbjct: 212 PWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYLSGN 271

Query: 243 PLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQL--- 299
           P               T+   LD        N   +P             FH+CV+L   
Sbjct: 272 P---------------TVDLQLDLAG-----NDLGVP------------AFHECVELDNH 299

Query: 300 -NRFNTDRIIRFVPPDGSFELMRYHVRDNLNLP 331
            N  N D  +RF+PPDG F LM+Y +  +L+ P
Sbjct: 300 QNPSNCD--LRFIPPDGRFNLMQYSI--DLDTP 328

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 72/154 (46%), Gaps = 38/154 (24%)

Query: 193 PWRSSGIKYKKNEIFLDVNERINILVSKDGS------------------ILKSYVDGSVD 234
           PWRS  +KY  NEI++DV E I+++  +  S                  ++++ + G ++
Sbjct: 257 PWRSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYHKINQFNRNDNSPMKLIRADIIGELN 316

Query: 235 LTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFH 294
           + ++LS  P+ +  L D    D  T   + D   +  +     +P             FH
Sbjct: 317 VRSYLSDNPMVEVTLVDRNYSDQKTGWSENDLFKQLNL----GLP------------MFH 360

Query: 295 QCVQLNR---FNTD-RIIRFVPPDGSFELMRYHV 324
            CV+++     N D R I+F+PPDG F LM+Y++
Sbjct: 361 DCVEIDYEKGINQDFRHIKFIPPDGKFSLMKYNI 394

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 56/135 (41%), Gaps = 36/135 (26%)

Query: 193 PWRSSGIKYKKNEIFLDVNERINILVSKDGS---ILKSYVDGSVDLTTHLSGTPLCQFGL 249
           PWR++  +Y  NEI++D+ E +N  + + GS   ++   + G +D+  +LSG P  Q  L
Sbjct: 141 PWRTADCRYVNNEIYVDLVETVNATLRQKGSSLTLINGSLSGKIDVKCYLSGNPTVQLKL 200

Query: 250 NDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFNTDRIIR 309
             S                                   L++   H+CV+L        + 
Sbjct: 201 RTS--------------------------------GHPLDNSALHRCVELGEAGV-ATMN 227

Query: 310 FVPPDGSFELMRYHV 324
           FVPPDG F L  Y +
Sbjct: 228 FVPPDGRFTLAEYAI 242

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 68/170 (40%), Gaps = 60/170 (35%)

Query: 181 ANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSK-------DG--------SIL 225
           A+    G+    PWR +GIK  K E+++D+ E + +   K       DG         ++
Sbjct: 178 ASSSSRGEDMVVPWRRNGIKDAKEELYVDLKEEVYVTYRKSDRHHGRDGIRTSNPSMELV 237

Query: 226 KSYVDGSVDLTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGS 285
             ++ G++D+  +L+G P        ++SL   T+  DL             IP      
Sbjct: 238 SGHIKGTIDVRCYLNGNP--------TVSLMFDTMGNDL------------GIP------ 271

Query: 286 VQLEDCKFHQCVQLNR-------------FNTDRIIRFVPPDGSFELMRY 322
                  FH CV+                F   R++RF+PPDG F L +Y
Sbjct: 272 ------SFHACVEQEDQVQEQKQEQEPESFQGKRLLRFLPPDGKFRLAQY 315

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 72/148 (48%), Gaps = 38/148 (25%)

Query: 193 PWRSSGIKYKKNEIFLDVNERINILVS---KDGSI--LKSYVDGSVDLTTHLSGTPLCQF 247
           PWRS  +KY  +EI++D+ E ++++     ++ S+  +   ++G V++ ++LSG P    
Sbjct: 193 PWRSGHLKYTSDEIYVDIIETVHVIYQTHHRNNSVQMVSGTINGQVNVKSYLSGNP---- 248

Query: 248 GLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFNTDRI 307
                      T+  D+D                 AG+ ++     HQCV++ + +   +
Sbjct: 249 -----------TVEMDMDL----------------AGN-EMYAPSMHQCVEMPQGSPSSL 280

Query: 308 IRFVPPDGSFELMRYHVRDNLNLPFKIT 335
             F+PPDG+  L+ Y +  ++N   K+T
Sbjct: 281 C-FIPPDGNCNLLNYTIDLDMNPKVKVT 307

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 64/138 (46%), Gaps = 38/138 (27%)

Query: 193 PWRSS-GIKYKKNEIFLDVNERINILVSKDGS---ILKSYVDGSVDLTTHLSGTPLCQFG 248
           PWR+S   K++ NE++LD+ E  +++  K  S   ++   + G++D+ ++L+ TPL    
Sbjct: 200 PWRTSRASKHENNELYLDLLETFHVVFEKKKSHIRLVNGNIHGTLDVRSYLNDTPLVLVK 259

Query: 249 LNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFN--TDR 306
           LN        T+  D+             IP              H+CV++N     +  
Sbjct: 260 LN--------TMGNDI------------GIPS------------LHECVEINDGGVFSPS 287

Query: 307 IIRFVPPDGSFELMRYHV 324
            I F+PPDG F L+ Y V
Sbjct: 288 NITFIPPDGKFRLLEYCV 305

>Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]
           {ON} similar to Ashbya gossypii AGL061W
          Length = 517

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 59/292 (20%), Positives = 114/292 (39%), Gaps = 69/292 (23%)

Query: 54  FHHIRSSSNLWIVAVTRSNADSAAIWEFLYKFNALLEAYG----------LNSEESLKEE 103
           + H  S + L+  A+     D      FL +F+ LL  Y           +N+++ L   
Sbjct: 57  YGHFSSVNRLYYWALCEQCDDPLKPLVFLSRFDGLLMEYFDRDVLTATKLMNNQDRLALL 116

Query: 104 FMTCYELLDVVLENG------VPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANV 157
             +  +  ++V+ +       +P+ T+LS+V S  ++    +++N   ++ L  S ++N+
Sbjct: 117 LNSIIDAGEIVMSDTNKLRYLLPLHTDLSTVFSSATKTLTRTIKNRESSNFLGSSNSSNI 176

Query: 158 DLGFRMPKFLNKGXXXXXXXXXPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERI--N 215
           + G  + +                + D   D    PWR   +    NEI++D+ E +  N
Sbjct: 177 NGGPTINR----------------SSDSPLDAQVVPWRIPNLSNVNNEIYVDMVETLTLN 220

Query: 216 ILVSKDGS--ILKSYVDGSVDLTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVK 273
           +  S+  S  +    + G +DL  +L G P  Q  L+                       
Sbjct: 221 LKQSRPNSFHVFHGVISGKIDLKCYLRGNPTMQINLH----------------------- 257

Query: 274 NKKAIPKAAAGSVQLEDCKFHQCVQ-LNRFNTDRIIRFVPPDGSFELMRYHV 324
                   +AG    +    H+C+   +       +RF+PPDG F L+ Y +
Sbjct: 258 --------SAGHA-FKPSALHRCLDPSSSSFDSSSLRFIPPDGKFTLLEYTI 300

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 62/152 (40%), Gaps = 52/152 (34%)

Query: 193 PWRSSGIKYKKNEIFLDVNERINILV------------SKDG--SILKSYVDGSVDLTTH 238
           PWRS  +K+  NEI++D+ E ++++             SK     I+  Y+ G+  + + 
Sbjct: 202 PWRSQNVKHNNNEIYIDLVESVHVVYQTKIRRSNELTRSKQSIKKIVNGYLKGTAYVQSF 261

Query: 239 LSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQ 298
           L+G PL +      L L G  +                                FH+CV 
Sbjct: 262 LNGNPLVEL----QLELSGNDIGH----------------------------PSFHECVD 289

Query: 299 LNRF--NTDR----IIRFVPPDGSFELMRYHV 324
           ++ +  N D      ++F+PPDG F LM Y +
Sbjct: 290 IDEYLKNIDNSSISSLKFIPPDGKFTLMDYTI 321

>Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 69/151 (45%), Gaps = 40/151 (26%)

Query: 193 PWRSSGI-KYKKNEIFLDVNERINILVSKDGSILK---SYVDGSVDLTTHLSGTPLCQFG 248
           PWR+S   K++ NE+++D+ E  ++++ K  + L+     + G+VD+ ++L+  PL    
Sbjct: 200 PWRTSKTSKHENNELYVDLLETFHVVLEKKKTRLRLVNGDICGAVDVRSYLNDNPLVSVK 259

Query: 249 LNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFN--TDR 306
           LN                     + N+  IP              H+CV++N     T  
Sbjct: 260 LN--------------------TMGNEIGIP------------SLHECVEINDDGEFTPS 287

Query: 307 IIRFVPPDGSFELMRYHVRDNLNLPFKITPI 337
            I F+PPDG F L+ Y +  NL+   K + I
Sbjct: 288 NITFIPPDGKFRLLEYSI--NLDSQLKKSGI 316

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 62/138 (44%), Gaps = 39/138 (28%)

Query: 193 PWRSS-GIKYKKNEIFLDVNERINILVSKDGS---ILKSYVDGSVDLTTHLSGTPLCQFG 248
           PWR+S   K++ NE+++D+ E  +++  K  S   +L   + G VD+ ++L+  PL    
Sbjct: 200 PWRTSRASKHENNELYVDLLETFHVVFEKKKSHLRLLTGSIHGIVDVRSYLNDNPLVAVK 259

Query: 249 LNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNR--FNTDR 306
           LN        T+  D+             IP              H CV++N   F+   
Sbjct: 260 LN--------TMGNDI------------GIPS------------LHDCVEINDGVFSPSN 287

Query: 307 IIRFVPPDGSFELMRYHV 324
           I  F+PPDG F L+ Y V
Sbjct: 288 IT-FIPPDGKFRLLEYSV 304

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 70/172 (40%), Gaps = 62/172 (36%)

Query: 188 DPCAYPWRSSGIKYKKNEIFLDVNERINI-----LVSKDG-------------------S 223
           D    PWR+  IK  KNE+++D+ E I++     + ++ G                    
Sbjct: 255 DDMIVPWRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMK 314

Query: 224 ILKSYVDGSVDLTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAA 283
           ++  Y+ G +D+ ++L+G P+ +  LN +   D GT S                      
Sbjct: 315 LMNGYITGVIDVRSYLNGNPIVEMKLN-TCGNDMGTPS---------------------- 351

Query: 284 GSVQLEDCKFHQCVQLN---RFNTDRI---IRFVPPDGSFELMRYHVRDNLN 329
                     H CV+L      + D++   ++F+PPDG F L RY V  N N
Sbjct: 352 ---------LHPCVELEGDMNGDDDKVMDSLKFIPPDGKFCLARYCVDLNKN 394

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 64/161 (39%), Gaps = 55/161 (34%)

Query: 187 GDPCAYPWRSS-GIKYKKNEIFLDVNERINILVSKDGS-------------------ILK 226
           GD    PWR+   I   +NE++ DV E I ++  K  S                    ++
Sbjct: 220 GDDSVAPWRNGKNIHNDRNELYADVREVIQVVYQKKYSSKKNDSRRKIFGRRSGHLEYVR 279

Query: 227 SYVDGSVDLTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSV 286
             + GSVD+   L+G PL +  L       GG     LD            IP       
Sbjct: 280 GNISGSVDMRCFLTGNPLVEIALKQ-----GG-----LDI----------GIPG------ 313

Query: 287 QLEDCKFHQCV-QLNRFNTDRI--IRFVPPDGSFELMRYHV 324
                 FH CV + +    ++I  + F+PPDG F LM+Y++
Sbjct: 314 ------FHDCVDKTSLLKQEKISKLSFIPPDGRFTLMQYNI 348

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 69/146 (47%), Gaps = 32/146 (21%)

Query: 191 AYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDLTT-HLSGTPLCQFGL 249
           A PWR   + +  NE++LD+ E I++++        SY + ++ + T ++ G  L +  L
Sbjct: 201 AVPWRMRNVDHVNNELYLDLVESIHVVLETKKR-KSSYANSTMKIVTGNIIGKALVKSVL 259

Query: 250 NDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQL------NRFN 303
           N +              I E ++          AG+  LE    H+CV+         F 
Sbjct: 260 NGNP-------------IVEMKID--------MAGN-DLESIFLHECVKSKDVDKDQEFE 297

Query: 304 TDRIIRFVPPDGSFELMRYHVRDNLN 329
             ++I+F+PPDGSF+L  Y++  NLN
Sbjct: 298 NTKLIKFLPPDGSFKLFDYNI--NLN 321

>Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 61/139 (43%), Gaps = 40/139 (28%)

Query: 193 PWRSS-GIKYKKNEIFLDVNERINILVSKDGSILK---SYVDGSVDLTTHLSGTPLCQFG 248
           PWR+S   K++ NE+++D+ E  +++     S L+     + G+VD+ ++L+  PL    
Sbjct: 200 PWRTSKASKHENNELYVDLLETFHVVFETKKSRLRLVNGNIHGTVDVRSYLNNNPLVSVK 259

Query: 249 LNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQL---NRFNTD 305
           LN        T+  D+             +P              H+CV++     F   
Sbjct: 260 LN--------TMGNDI------------GVPT------------LHECVEIKDDGEFLPS 287

Query: 306 RIIRFVPPDGSFELMRYHV 324
            I  F+PPDG F L+ Y V
Sbjct: 288 NIT-FIPPDGKFRLLEYSV 305

>Kwal_55.21751 s55 (964248..964487) [240 bp, 79 aa] {OFF} [contig
           126] FULL
          Length = 79

 Score = 34.7 bits (78), Expect = 0.064,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 79  WEFLYKFNALLEAYGLNSEESLKEEFMTCYEL---LDVVLENGVPVDTEL 125
           W F+++++  L++Y      +L  +F+ CY+L   LD+  +NG  + +EL
Sbjct: 29  WAFVHRYHQNLQSYHQMQSSTLLPQFLCCYQLGVALDISAKNGSKLVSEL 78

>Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON}
           YFR051C (REAL)
          Length = 598

 Score = 34.3 bits (77), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 77/192 (40%), Gaps = 31/192 (16%)

Query: 202 KKNEIFLDVNERINILVSKDGSILKSYVDGSVDLTTHLSGTPLCQFGLNDSLSLDGGTLS 261
           + N I + + E IN   S+DG+I  S + G ++L  +          L DS+ +      
Sbjct: 339 ENNGILISIKEVINAEFSRDGTIHSSELKGVLELRINDHDLSHSNLKLADSIDV------ 392

Query: 262 RDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMR 321
           RD  F    + K    I K A  S +L   +            D+   F   D S  ++R
Sbjct: 393 RDKSF----QFKTHPNIDKQAFLSSKLISLR------------DKSKAFPANDQSLGVLR 436

Query: 322 YH----VRDNLNLPFKITPIFSVRSNNGAVEYRVALKSLFPSKLTAKDVVLRIPV-PPGT 376
           +       D+  +P  +T   S   +    +  +  +S+  S+L   DVV  IPV P   
Sbjct: 437 WRKIAPAEDDSLVPLTLTTWVSPSESQQGFDVIIEYESVLESELA--DVVFTIPVFPQEP 494

Query: 377 VDCKINTSNGRC 388
           VD  INT +  C
Sbjct: 495 VD--INTDSSTC 504

>KAFR0B01780 Chr2 (348976..349548) [573 bp, 190 aa] {ON} Anc_8.76
           YPL010W
          Length = 190

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 107 CYELLDVVLENGVPVDTELSSVASKMSRRPVVSLENNPLT-DELLMSA 153
            Y L+D +++NGV ++T+ +S+AS+++++P     N  L  D+ L+ A
Sbjct: 127 VYLLIDEIIDNGVILETDPASIASRVTKQPTSDTLNQTLDLDKGLLGA 174

>YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}
           RET2Delta subunit of the coatomer complex (COPI), which
           coats Golgi-derived transport vesicles; involved in
           retrograde transport between Golgi and ER
          Length = 546

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 76/190 (40%), Gaps = 31/190 (16%)

Query: 204 NEIFLDVNERINILVSKDGSILKSYVDGSVDLTTHLSGTPLCQFGLNDSLSLDGGTLSRD 263
           N I + + E IN   S+DG+I  S + G ++L  +          L DS+ +      RD
Sbjct: 289 NGILISIKEVINAEFSRDGTIHSSELKGVLELRINDHDLSHSNLKLADSIDV------RD 342

Query: 264 LDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYH 323
             F    + K    I K +  S +L   +            D+   F   D S  ++R+ 
Sbjct: 343 KSF----QFKTHPNIDKQSFLSTKLISLR------------DKSKAFPANDQSLGVLRWR 386

Query: 324 ----VRDNLNLPFKITPIFSVRSNNGAVEYRVALKSLFPSKLTAKDVVLRIPV-PPGTVD 378
                 D+  +P  +T   S   +    +  +  +S+  ++L   DV+  IPV P   VD
Sbjct: 387 KVAPAEDDSLIPLTLTTWVSPSESQQGFDVIIEYESVLETELA--DVIFTIPVFPQEPVD 444

Query: 379 CKINTSNGRC 388
             INT +  C
Sbjct: 445 --INTESSTC 452

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 57/148 (38%), Gaps = 48/148 (32%)

Query: 193 PWRSSGIKYKKNEIFLDVNERINILVSKDG------------SILKSYVDGSVDLTTHLS 240
           PWRS+ +  ++NE ++DV E + ++V +               ++   + G VD   +LS
Sbjct: 207 PWRSAKVNSRRNEFYVDVRESVEVVVERAAHRSTSRGTPAPLQLVTGCITGVVDCRCYLS 266

Query: 241 GTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLN 300
             P+ +   N+    D GT +                                H CV+L+
Sbjct: 267 RDPIVEVTFNNH-GCDLGTPA-------------------------------LHDCVELD 294

Query: 301 RF----NTDRIIRFVPPDGSFELMRYHV 324
                      ++F+PPDG F LM Y V
Sbjct: 295 GVPEGPADHTTLKFIPPDGKFRLMEYSV 322

>Ecym_1300 Chr1 (608031..612557) [4527 bp, 1508 aa] {ON} similar to
            Ashbya gossypii AAL016C
          Length = 1508

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 56/135 (41%), Gaps = 9/135 (6%)

Query: 9    SQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSSSNLWI-VA 67
            SQ+ E V S L        + E   +Q  +N   RSP   +  T+   I +S  L+  ++
Sbjct: 1159 SQREEQVSSALRGRATHLQIPESTAVQTKSNKRSRSPGFVVTKTSPTKIWTSEKLYSKIS 1218

Query: 68   VTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLENGVPVDTELSS 127
              ++    A++   L K N  L    +NS E L EE +T           G PV   + S
Sbjct: 1219 DVKNETTDASVVSSLRKPNRRLFELSINSREDLNEEQITS--------NTGQPVKHRVGS 1270

Query: 128  VASKMSRRPVVSLEN 142
              ++ +    ++ EN
Sbjct: 1271 QMNQTNFSEAITTEN 1285

>KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa]
           {ON} Anc_2.44 YNL207W
          Length = 425

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 46/108 (42%), Gaps = 22/108 (20%)

Query: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSS 60
           MLN   V+S  G + V K          ++I+R+   N  +    +  LG T+FH +++ 
Sbjct: 88  MLNRETVYSVGGTIGVGK---------ESDIYRVSDRNGTEKVMKIHRLGRTSFHTVKNK 138

Query: 61  SNLWIVAVTRSNADSAAIWEFL--------YKFNALLEAYGLNSEESL 100
            +       + NA +   W +L        Y+F  LL A G +  E+ 
Sbjct: 139 RDY-----IKKNAKNGVNWMYLSKIAAGKEYQFMTLLFAKGFDVPEAF 181

>NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {ON}
           Anc_3.575 YFR051C
          Length = 547

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 30/52 (57%)

Query: 204 NEIFLDVNERINILVSKDGSILKSYVDGSVDLTTHLSGTPLCQFGLNDSLSL 255
           N I + +NE IN  +++DG+I  S + G ++L  + +     Q  L DS+++
Sbjct: 286 NGILITINETINAEITRDGNISSSELKGVLELRINDASLAHSQLALLDSINV 337

>TDEL0C00160 Chr3 (16995..17840) [846 bp, 281 aa] {ON} 
          Length = 281

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 9/80 (11%)

Query: 354 KSLFPSKLTAKDVVLRIPVPPGTVDCKINTS-NGRCRF-VPEENAVLWKFAKYQGLTENT 411
           KS  PS LT K VVL    P   VDC++    NG C + +P        +  Y+G+ EN 
Sbjct: 90  KSDLPSFLTFKFVVLPAHKPGPNVDCQLEVERNGLCLYRIP-------FYEIYRGIGENY 142

Query: 412 LSALTVPMDNQSSLNLQQWS 431
           + + +   D   +  +   S
Sbjct: 143 IFSFSALRDRSKNFTISHLS 162

>YEL025C Chr5 complement(102581..106147) [3567 bp, 1188 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to both the
           cytoplasm and the nucleus
          Length = 1188

 Score = 30.8 bits (68), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 10/67 (14%)

Query: 187 GDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGS------VDL--TTH 238
           GD  AY   S G+ YK     +D      + VS+ G +LK+ +DGS      VD   + H
Sbjct: 473 GDEFAY--ESGGLIYKNGIFLMDEPYDYGLFVSRTGKVLKAGMDGSTGEFRQVDFLQSNH 530

Query: 239 LSGTPLC 245
            S T  C
Sbjct: 531 NSSTMFC 537

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,134,368
Number of extensions: 2166954
Number of successful extensions: 5912
Number of sequences better than 10.0: 94
Number of HSP's gapped: 5837
Number of HSP's successfully gapped: 140
Length of query: 482
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 369
Effective length of database: 40,524,141
Effective search space: 14953408029
Effective search space used: 14953408029
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)