Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0C07392g3.164ON36136116880.0
Kwal_33.141793.164ON3743804785e-56
KLTH0F06512g3.164ON3702384664e-54
ZYRO0B04862g3.164ON4082784127e-46
TDEL0D045903.164ON3762753993e-44
NCAS0I020703.164ON4232863383e-35
KAFR0F022103.164ON3572372792e-27
Suva_4.2223.164ON4162962752e-26
Skud_4.2243.164ON4082962743e-26
YDL027C3.164ON4202422569e-24
Smik_4.2083.164ON4172562392e-21
Kpol_1045.433.164ON3822522329e-21
TPHA0P006703.164ON3802401541e-10
KLLA0C03872g3.164ON3762411301e-07
KNAG0K017303.164ON3292291141e-05
CAGL0K01639g3.164ON403248940.004
Smik_14.651.81ON79071713.2
KNAG0J001508.863ON61677703.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0C07392g
         (361 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0C07392g Chr3 complement(682073..683158) [1086 bp, 361 aa] {...   654   0.0  
Kwal_33.14179 s33 complement(559209..560333) [1125 bp, 374 aa] {...   188   5e-56
KLTH0F06512g Chr6 complement(563724..564836) [1113 bp, 370 aa] {...   184   4e-54
ZYRO0B04862g Chr2 (391162..392388) [1227 bp, 408 aa] {ON} weakly...   163   7e-46
TDEL0D04590 Chr4 (841954..843084) [1131 bp, 376 aa] {ON} Anc_3.1...   158   3e-44
NCAS0I02070 Chr9 (388867..390138) [1272 bp, 423 aa] {ON} Anc_3.1...   134   3e-35
KAFR0F02210 Chr6 (431088..432161) [1074 bp, 357 aa] {ON} Anc_3.1...   112   2e-27
Suva_4.222 Chr4 complement(394220..395470) [1251 bp, 416 aa] {ON...   110   2e-26
Skud_4.224 Chr4 complement(398578..399804) [1227 bp, 408 aa] {ON...   110   3e-26
YDL027C Chr4 complement(403695..404957) [1263 bp, 420 aa] {ON} P...   103   9e-24
Smik_4.208 Chr4 complement(383879..385132) [1254 bp, 417 aa] {ON...    97   2e-21
Kpol_1045.43 s1045 complement(101542..102690) [1149 bp, 382 aa] ...    94   9e-21
TPHA0P00670 Chr16 (137985..139127) [1143 bp, 380 aa] {ON} Anc_3....    64   1e-10
KLLA0C03872g Chr3 complement(353385..354515) [1131 bp, 376 aa] {...    55   1e-07
KNAG0K01730 Chr11 (362599..363588) [990 bp, 329 aa] {ON} Anc_3.1...    49   1e-05
CAGL0K01639g Chr11 complement(146143..147354) [1212 bp, 403 aa] ...    41   0.004
Smik_14.65 Chr14 complement(105762..108134) [2373 bp, 790 aa] {O...    32   3.2  
KNAG0J00150 Chr10 complement(11793..13643) [1851 bp, 616 aa] {ON...    32   3.7  

>SAKL0C07392g Chr3 complement(682073..683158) [1086 bp, 361 aa] {ON}
           some similarities with uniprot|Q7LHC7 Saccharomyces
           cerevisiae YDL027C Hypothetical ORF
          Length = 361

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/361 (91%), Positives = 331/361 (91%)

Query: 1   MLLPRLGLNVFKSSLTPRPAAPLSRTLVSPLVAIGRRLQMVPQTAGAGVIRYHDPRAPIR 60
           MLLPRLGLNVFKSSLTPRPAAPLSRTLVSPLVAIGRRLQMVPQTAGAGVIRYHDPRAPIR
Sbjct: 1   MLLPRLGLNVFKSSLTPRPAAPLSRTLVSPLVAIGRRLQMVPQTAGAGVIRYHDPRAPIR 60

Query: 61  NLNMLLSRNLHTHXXXXXXXXXXXXXTIAPFRTSPWVMFFAGVGLLSAXXXXXXXXXXXX 120
           NLNMLLSRNLHTH             TIAPFRTSPWVMFFAGVGLLSA            
Sbjct: 61  NLNMLLSRNLHTHPPRRTPFRPGPRPTIAPFRTSPWVMFFAGVGLLSALFVVLPLVFTLF 120

Query: 121 XXXXXAGVIAYQFKRWRSAKLYDALYRSLQTTKLDVRYRSIRGLYSTTLASILERDRAGA 180
                AGVIAYQFKRWRSAKLYDALYRSLQTTKLDVRYRSIRGLYSTTLASILERDRAGA
Sbjct: 121 FPLVVAGVIAYQFKRWRSAKLYDALYRSLQTTKLDVRYRSIRGLYSTTLASILERDRAGA 180

Query: 181 ELFDTVVNGRKMRDMWGDENDRLRSRQLLAFLESRVLESIRNNEDGVREFFLGTDVDSWI 240
           ELFDTVVNGRKMRDMWGDENDRLRSRQLLAFLESRVLESIRNNEDGVREFFLGTDVDSWI
Sbjct: 181 ELFDTVVNGRKMRDMWGDENDRLRSRQLLAFLESRVLESIRNNEDGVREFFLGTDVDSWI 240

Query: 241 RDGYDLQLDTRICGTTGRSIGGKLAMSVTYPLYLVSSTNRRKLADVSIVFLDERLAAGSG 300
           RDGYDLQLDTRICGTTGRSIGGKLAMSVTYPLYLVSSTNRRKLADVSIVFLDERLAAGSG
Sbjct: 241 RDGYDLQLDTRICGTTGRSIGGKLAMSVTYPLYLVSSTNRRKLADVSIVFLDERLAAGSG 300

Query: 301 FYPPGDLAGQDERCPMVISIVPVRTLVPRQFIISTPGASGNNASRLTQRTTRDGHREYTY 360
           FYPPGDLAGQDERCPMVISIVPVRTLVPRQFIISTPGASGNNASRLTQRTTRDGHREYTY
Sbjct: 301 FYPPGDLAGQDERCPMVISIVPVRTLVPRQFIISTPGASGNNASRLTQRTTRDGHREYTY 360

Query: 361 D 361
           D
Sbjct: 361 D 361

>Kwal_33.14179 s33 complement(559209..560333) [1125 bp, 374 aa] {ON}
           YDL027C - Hypothetical ORF [contig 105] FULL
          Length = 374

 Score =  188 bits (478), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 128/380 (33%), Positives = 193/380 (50%), Gaps = 39/380 (10%)

Query: 1   MLLPRLGLNVFKSSLTPRPAAPLSRT------LVSPLVAIGRRLQMVPQTAGAGVIRY-- 52
           M+L R+G+    SSL PR    L+R         S L+++ R     P      +I +  
Sbjct: 12  MMLHRVGIRTIYSSLHPRVPLTLTRYSRPEFRAFSSLISVSRP-PTCPSLTSPRLITHSN 70

Query: 53  --HDP-----RAPIRNLNMLLSRNLHTHXXXXXXXXXXXXXTIAPFRT---SPWVMFFAG 102
             HD      + P+  +N    R+LH+                 PF+T   SP     A 
Sbjct: 71  YKHDGVLKILKTPVPRINY---RSLHSGP--------------PPFKTVRISPIFGILAF 113

Query: 103 VGLLSAXXXXXXXXXXXXXXXXXAGVIAYQFKRWRSAKLYDALYRSLQTTKLDVRYRSIR 162
           +G +S                  AGV  +QFK+W+SA L   L+R L T+K+ +   +I 
Sbjct: 114 LGSISLVFIVVPFVFTFFFPLIIAGVAVFQFKKWKSATLMQQLHRRLLTSKMRIDRHTIL 173

Query: 163 GLYSTTLASILERDRAGAELFDTVVNGRKMRDMWGDENDRLRSRQLLAFLESRVLESIRN 222
           GL +    S+L  +R  A  F   ++    R M  D + +  +  +++FL+SR+LE+ ++
Sbjct: 174 GLQARMFESLLGSERNSAIFFRRAMDDMSARQM-DDTSFKSGADDMISFLDSRILEAFKS 232

Query: 223 NEDGVREFFLGTDVDSWIRDGYDLQLDTRICGTTGRSIGGKLAMSVTYPLYLVSSTNRRK 282
           NE G+R++FLG DV +W+ +GY+L LD+    T G+SI G   M++TYPLYL+SS  R+K
Sbjct: 233 NEQGIRDYFLGADVKTWVENGYELSLDSDSPRTIGKSIEGTFVMTITYPLYLLSSNQRKK 292

Query: 283 -LADVSIVFL-DERLAAGSGFYPPGDLAGQDERCPMVISIVPVRTLVPRQFIISTPGASG 340
            LADV++  L D      S F+   +    ++ CPMVISI P R L   QFI+     +G
Sbjct: 293 LLADVTVAVLGDSTPGKPSPFFLMQENFADNKDCPMVISIKPARALNTNQFILDETDDNG 352

Query: 341 NNASRLTQRTTRDGHREYTY 360
           N+ SR T +TT DGHRE+ Y
Sbjct: 353 NHPSRYTVKTTSDGHREFRY 372

>KLTH0F06512g Chr6 complement(563724..564836) [1113 bp, 370 aa] {ON}
           weakly similar to uniprot|Q7LHC7 Saccharomyces
           cerevisiae YDL027C Hypothetical ORF
          Length = 370

 Score =  184 bits (466), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 147/238 (61%), Gaps = 4/238 (1%)

Query: 126 AGVIAYQFKRWRSAKLYDALYRSLQTTKLDVRYRSIRGLYSTTLASILERDRAGAELFDT 185
           AG+  +QFKRW++  L   L+R L  TK+ + Y+++ GL +    S+L  D   A  F  
Sbjct: 127 AGIAVFQFKRWQNTTLLGQLHRCLLATKMSINYKTVWGLQTQMFESLLGSDGFAAGSFRG 186

Query: 186 VVNGRKMRDMWGDENDRLRSRQLLAFLESRVLESIRNNEDGVREFFLGTDVDSWIRDGYD 245
           V++  + + +    N + R+ + LAFL+ RVLE+ +NNE G+R+FFLG+D  +W++ GYD
Sbjct: 187 VMDEIRSQKI-DAANSKRRADEALAFLDRRVLEAFKNNELGLRDFFLGSDASTWVKKGYD 245

Query: 246 LQLDTRICGTTGRSIGGKLAMSVTYPLYLVSSTNRRKL-ADVSIVFLDERLAAGSG-FYP 303
           L L T      G+SI   L M+++YPLYL+SS+  RKL A V+I  LD+ +A  +G F  
Sbjct: 246 LSLATDTPRIRGQSINNSLVMTISYPLYLLSSSQERKLIAYVAIGVLDDSMAGQTGSFKF 305

Query: 304 PGDLAGQDERCPMVISIVPVRTLVPRQFIISTPG-ASGNNASRLTQRTTRDGHREYTY 360
             +LA Q++ CPMVISI P R+L  +QF++   G A G   S    RT  DGHRE+TY
Sbjct: 306 VEELASQNKECPMVISIRPARSLYAKQFVLKDYGEARGKPTSAYYVRTADDGHREFTY 363

>ZYRO0B04862g Chr2 (391162..392388) [1227 bp, 408 aa] {ON} weakly
           similar to uniprot|Q7LHC7 Saccharomyces cerevisiae
           YDL027C Hypothetical ORF
          Length = 408

 Score =  163 bits (412), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 84/278 (30%), Positives = 153/278 (55%), Gaps = 9/278 (3%)

Query: 91  FRTSPWVMFFAGVGLLSAXXXXXXXXXXXXXXXXXAGVIAYQFKRWRSAKLYDALYRSLQ 150
           F+ SP V+F A +G L+                   G+  YQF++W++  L+D L   L+
Sbjct: 126 FKISPLVIFLASIGALTVFFLILPFMLTFFLPLFVVGISVYQFRKWKNNTLFDQLLNGLK 185

Query: 151 TTKLDVRYRSIRGLYSTTLASILER-DRAGAELFDTV---VNGRKMRD-MWGDENDRLRS 205
            +++ +  +++  +Y  +++   +      A +F+ +   V+ +  RD +W + N+   +
Sbjct: 186 KSEMRLNSQTLNAMYVKSISKFFDAAQNPNAGVFEEIFKGVDAKMKRDGIWPNANNVSEA 245

Query: 206 RQLLAFLESRVLESIRNNEDGVREFFLGTDVDSWIRDGYDLQLDTRICGTTGRSIGGKLA 265
            +LL+F++SRV+E+I+++E G+R +FLG DV +WI++GYD +L +  C +  R    ++ 
Sbjct: 246 DRLLSFVQSRVMEAIKSDEQGIRTYFLGDDVSNWIKEGYDFELGSSDCRSFVRGFKNEII 305

Query: 266 MSVTYPLYLVSSTN-RRKLADVSIVFLDERLAAGSG---FYPPGDLAGQDERCPMVISIV 321
             + YP+YL SST+ +R LADVS+  L    A  +    F    +L  Q+ +C M IS+ 
Sbjct: 306 FWIVYPIYLKSSTHPKRHLADVSVAVLQGHHAERNNYDFFLVQTNLIRQNAKCNMAISVK 365

Query: 322 PVRTLVPRQFIISTPGASGNNASRLTQRTTRDGHREYT 359
              +++P+QF+I   G SG+  ++       DGH EYT
Sbjct: 366 STSSILPKQFVIIDGGESGDFWTKYDVHENSDGHTEYT 403

>TDEL0D04590 Chr4 (841954..843084) [1131 bp, 376 aa] {ON} Anc_3.164
           YDL027C
          Length = 376

 Score =  158 bits (399), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 89/275 (32%), Positives = 143/275 (52%), Gaps = 7/275 (2%)

Query: 91  FRTSPWVMFFAGVGLLSAXXXXXXXXXXXXXXXXXAGVIAYQFKRWRSAKLYDALYRSLQ 150
           +R SP V    G+G L                   AG+ AYQF +W+   L+  + R L+
Sbjct: 98  YRISPIVAVLTGIGFLMLLFAVLPFIFTFFFPLIIAGICAYQFSKWKRKVLFQDILRHLK 157

Query: 151 TTKLDVRYRSIRGLYSTTLASILERDRAGAELFDTVVNGRKMRDMWG--DENDRLRSRQL 208
           T+ + V Y +++ L+  +L  I+  ++  A++F+ ++      D+    D+    ++ +L
Sbjct: 158 TSTMKVNYNTVKALHVKSLDKIVRLEQQNAKVFEDLLKSFDA-DLRARLDKFSSAKADKL 216

Query: 209 LAFLESRVLESIRNNEDGVREFFLGTDVDSWIRDGYDLQLDTRICGTTGRSIGGKLAMSV 268
           L F++ R+LE+I  NE G+R +FLG DV  W+ D Y L+LDT    T  +   G+L M +
Sbjct: 217 LRFIDDRLLEAIETNEQGIRNYFLGDDVGRWVEDNYQLELDTTQYKTNAQVGDGELIMLL 276

Query: 269 TYPLYLVSSTNRRK-LADVSIVFLDERLAAGSG---FYPPGDLAGQDERCPMVISIVPVR 324
            +PLYL S++N RK LA+VS+  L       +G         ++  D  C MVI++ PV 
Sbjct: 277 VFPLYLKSNSNPRKHLANVSLALLQGLFEGTNGANYLEFLSSISETDAECQMVIAVQPVT 336

Query: 325 TLVPRQFIISTPGASGNNASRLTQRTTRDGHREYT 359
               + F+IST G SG+  S+   +   DGH EYT
Sbjct: 337 NFSTKLFVISTDGRSGDWYSKYDSKEDSDGHTEYT 371

>NCAS0I02070 Chr9 (388867..390138) [1272 bp, 423 aa] {ON} Anc_3.164
           YDL027C
          Length = 423

 Score =  134 bits (338), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 88/286 (30%), Positives = 142/286 (49%), Gaps = 23/286 (8%)

Query: 88  IAPFRTSPWVMFFAGVGLLSAXXXXXXXXXXXXXXXXXAGVIAYQFKRWRSAKLYDALYR 147
           I   R    ++ F+ +G+L                    G+  +QF++W+   LY  L  
Sbjct: 142 IKIIRIPSILLIFSSLGILIITLMILPLLISAFFPFLILGIALFQFRKWKQNTLYKQLLA 201

Query: 148 SLQTT---KLDVRYRSIRGLYSTTLASI-LERDRAGAELFDTVVNGRKMRDMWGDENDRL 203
            L+      + ++Y ++  L    L  I   ++  G   F   +   KM D + + N R 
Sbjct: 202 HLKNKSKGHMSIKYSTLNSLQYKILNDISFMKNSQG---FKPDILNMKMND-FINSNAR- 256

Query: 204 RSRQLLAFLESRVLESIRNNEDGVREFFLG-----TDVDSWIRDGYDLQLDTRICGTTGR 258
            S  LL  L+SR++E+I  +E G+R +FLG      +V  W+ +G D +LDT+   + G+
Sbjct: 257 DSEALLNLLQSRIMEAIETDELGIRTYFLGAADNINNVTHWVNEGLDFELDTKNSISKGK 316

Query: 259 SIGGKLAMSVTYPLYLVS-STNRRKLADVSIVFLDERLAAGSGFYPPGDLAGQDERCPMV 317
            + G++ +SVTY LYL S  + +R++A+VSIV LDE +     F    DLA  ++ CPMV
Sbjct: 317 LVNGEMILSVTYALYLKSLKSPKRRIAEVSIVVLDESVEKNHVFISINDLAKTNKSCPMV 376

Query: 318 ISIVPVRT-----LVPRQFIISTPGASGNNASRLTQRTTRDGHREY 358
            +I PV+      L P QFI+   G SG+N        T+ G+RE+
Sbjct: 377 FAIKPVKIDLSLLLQPFQFILDDYGRSGSNYD---VYNTKSGNREF 419

>KAFR0F02210 Chr6 (431088..432161) [1074 bp, 357 aa] {ON} Anc_3.164
           YDL027C
          Length = 357

 Score =  112 bits (279), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 68/237 (28%), Positives = 115/237 (48%), Gaps = 23/237 (9%)

Query: 127 GVIAYQFKRWRSAKLYDALYRSLQTTKLDVRYRSIRGLYSTTLASILERDRAGAELFDTV 186
           G+  YQ++ W+  KL+D ++R L  T L ++Y+++  L    +  IL++    +      
Sbjct: 140 GIFIYQYRIWKRTKLFDQIFRGLGRTNLSIKYKTLNSLQYNYVPKILKKSVPKS------ 193

Query: 187 VNGRKMRDMWGDENDRLRSRQLLAFLESRVLESIRNNEDGVREFFL--GTDVDSWIRDGY 244
                    W    D   +  LL+F++ RV+E+ + NE G+ ++FL  G + D       
Sbjct: 194 ---------WYTNEDISDAEILLSFIKLRVIEAFKKNEMGISDYFLRRGQNFDDL----- 239

Query: 245 DLQLDTRICGTTGRSIGGKLAMSVTYPLYLVSSTNRRKLADVSIVFLDERLAAGSGFYPP 304
            L +D        R + G   +++ + L L +      LADV I  LD+    G  F P 
Sbjct: 240 SLLIDKENSQFLIRRLAGNFIVTMRHQLLLKNENVDIYLADVMISVLDDSSQTGI-FMPL 298

Query: 305 GDLAGQDERCPMVISIVPVRTLVPRQFIISTPGASGNNASRLTQRTTRDGHREYTYD 361
            +LA  ++ C MVIS+V    ++PRQF+I+  G +G    + T    +DGHRE+  D
Sbjct: 299 KELAKSNKSCKMVISVVSNSDILPRQFVITDEGETGKFYGKFTVSHGKDGHREFRID 355

>Suva_4.222 Chr4 complement(394220..395470) [1251 bp, 416 aa] {ON}
           YDL027C (REAL)
          Length = 416

 Score =  110 bits (275), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/296 (26%), Positives = 126/296 (42%), Gaps = 31/296 (10%)

Query: 91  FRTSPWVMFFAGVGLLSAXXXXXXXXXXXXXXXXXAGVIAY----QFKRWRSAKLYDALY 146
           ++ SP ++ F  V L +                    +I +    QFKRW+    Y  + 
Sbjct: 122 YKVSPLLILFTTVSLFTFILTSTMIVIPFIFHFFFPFLIMFIFFKQFKRWQKNVFYKDIL 181

Query: 147 RSLQTTKLDVRYRSIRGLYSTTLASILERDRAGAELFDTVVNGRKMRDMWGDENDRLRSR 206
            SL  T+L +   ++R L    +    +   +   + +    G  +  +  DE      +
Sbjct: 182 NSLPRTELKITVPTMRSLQMQPMIQSWKDISSRMGIPNEFAKGLNVDLVKQDET----RK 237

Query: 207 QLLAFLESRVLESIRNNEDGVREFFLGTDVDSWIRDGYDLQLDTRICGTTGRSIGGKLAM 266
           Q L+FLE RVLES   NE G+R +FLG +V+ WI++ YDL+LD   C +  R     +  
Sbjct: 238 QFLSFLEKRVLESFTKNEMGIRSYFLGDNVEKWIKESYDLELDIENCRSELRKFQDSIFA 297

Query: 267 SVTYPLYLVSSTN-----------RRKLADVSIVFLDE---RLAAGSGFYPPGDL----- 307
           SV Y LYL S  +           ++ LADV ++ LD+    +    G Y   D      
Sbjct: 298 SVQYKLYLDSMKDLPLNPSKKFEGKKHLADVYVIILDKSFPEIMFNGGGYSKADFFKILQ 357

Query: 308 ----AGQDERCPMVISIVPVRTLVPRQFIISTPGASGNNASRLTQRTTRDGHREYT 359
               A  ++    +I++  V T +   FII+  G SG+  S+         H EYT
Sbjct: 358 ESETANSNKMHNTIIAVKSVNTPLSHHFIITAKGDSGDFFSKYHVSKVDGKHTEYT 413

>Skud_4.224 Chr4 complement(398578..399804) [1227 bp, 408 aa] {ON}
           YDL027C (REAL)
          Length = 408

 Score =  110 bits (274), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 81/296 (27%), Positives = 126/296 (42%), Gaps = 31/296 (10%)

Query: 91  FRTSPWVMFFAGVGLLSAXXXXXXXXXXXXXXXXXAGVIAY----QFKRWRSAKLYDALY 146
           ++ SP+ + FA   L +                    +I +    QFK+W+    Y  + 
Sbjct: 114 YKVSPFFIIFATASLFTFILTSTIIVIPFVLHFFFPLLIIFIFFKQFKKWQKNIFYKDIL 173

Query: 147 RSLQTTKLDVRYRSIRGLYSTTLASILERDRAGAELFDTVVNGRKMRDMWGDENDRLRSR 206
            SL  T+L +   ++R L    +    +   +   + +    G  + D+      R   +
Sbjct: 174 SSLPRTELKIAVPTMRSLQLQPMVQSWKDISSRMGIPNEFAKGLNV-DLVKQNETR---K 229

Query: 207 QLLAFLESRVLESIRNNEDGVREFFLGTDVDSWIRDGYDLQLDTRICGTTGRSIGGKLAM 266
           Q L+FL+ RVLES   NE GVR +FLG +V+ WI + YDL+LD   C +  R     +  
Sbjct: 230 QFLSFLQKRVLESFTKNEMGVRSYFLGDNVEKWIENSYDLELDIDSCRSELRKFQESIFS 289

Query: 267 SVTYPLYLVSSTN-----------RRKLADVSIVFLDE---RLAAGSGFYPPGDL----- 307
           SV Y LYL S  N           +R +ADV ++ LDE    +    G Y   D      
Sbjct: 290 SVRYKLYLDSMKNSPLSPSKNLEGKRHIADVYVIILDESFPEIMFNGGGYSKADFFKILQ 349

Query: 308 ----AGQDERCPMVISIVPVRTLVPRQFIISTPGASGNNASRLTQRTTRDGHREYT 359
               A   +   M+I+I  V T + + F+I+  G SG+  S+         H EYT
Sbjct: 350 ESETANSSKTHNMIIAIKSVNTPLSKHFVITAKGDSGDFFSKYQISNVDGSHTEYT 405

>YDL027C Chr4 complement(403695..404957) [1263 bp, 420 aa] {ON}
           Putative protein of unknown function; the authentic,
           non-tagged protein is detected in highly purified
           mitochondria in high-throughput studies; YDL027C is not
           an essential gene
          Length = 420

 Score =  103 bits (256), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 72/242 (29%), Positives = 109/242 (45%), Gaps = 27/242 (11%)

Query: 141 LYDALYRSLQTTKLDVRYRSIRGLYSTTLASILERDRAGAELFDTVVNGRKMRDMWGDEN 200
            Y  +  SL  TKL +   ++R L    +    +   +   + +    G  + D+   E 
Sbjct: 180 FYKDVLTSLPKTKLKITLPTMRSLQLQPMVQSWKEISSRMGIPNEFAKGLNV-DLVKQEE 238

Query: 201 DRLRSRQLLAFLESRVLESIRNNEDGVREFFLGTDVDSWIRDGYDLQLDTRICGTTGRSI 260
            R   +Q L+FL+ RVLES   NE G+R +FLG  V+ WI++ YDL+LD   C +  R  
Sbjct: 239 TR---KQFLSFLQKRVLESFTKNELGIRSYFLGDSVEKWIKESYDLELDIDNCRSELRKF 295

Query: 261 GGKLAMSVTYPLYLVSSTN-----------RRKLADVSIVFLDERLAA---GSGFYPPGD 306
              +  SV Y LYL S  N           ++ +ADV ++ LDE   A     G Y   D
Sbjct: 296 QTFIFSSVRYKLYLDSMKNLPLNPSKKLEGKKHIADVYVIILDESFPAIMFNGGAYSKAD 355

Query: 307 L---------AGQDERCPMVISIVPVRTLVPRQFIISTPGASGNNASRLTQRTTRDGHRE 357
                     +   +    +I+I  V TL+ + F+I+T G SG   S+       D + E
Sbjct: 356 FFKILQESETSNSSKTLNTIIAIKSVNTLLSKHFVITTNGDSGEFFSKYNISKINDKNTE 415

Query: 358 YT 359
           YT
Sbjct: 416 YT 417

>Smik_4.208 Chr4 complement(383879..385132) [1254 bp, 417 aa] {ON}
           YDL027C (REAL)
          Length = 417

 Score = 96.7 bits (239), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/256 (29%), Positives = 116/256 (45%), Gaps = 30/256 (11%)

Query: 128 VIAYQFKRWRSAKLYDALYRSLQTTKLDVRYRSIRGLYSTTLASILERDRAGAELFDTVV 187
           V   QFK+W++   Y  +  SL  T+L +   ++R L    L  +++  R  +       
Sbjct: 165 VFFKQFKKWQNNTFYKDILISLPKTELKITVPTMRSL---QLQPMIQSWREISSRMGIPN 221

Query: 188 NGRKMRDMWGDENDRLRSRQLLAFLESRVLESIRNNEDGVREFFLGTDVDSWIRDGYDLQ 247
              K  ++  ++ D  R +Q L+FL+ RVLES   NE G+R +FLG  V+ WI + YDL+
Sbjct: 222 EFAKGLNVDLEKQDETR-KQFLSFLQKRVLESFTKNEMGIRSYFLGDRVEKWIEESYDLE 280

Query: 248 LDTRICGTTGRSIGGKLAMSVTYPLYLVSSTN-----------RRKLADVSIVFLDER-- 294
           LD   C +  R     +  SV Y LYL S              ++ +ADV ++ LDE   
Sbjct: 281 LDIDNCRSELRKFQNFVFSSVRYRLYLDSIKKLPLNPSKKFEGKKHIADVYVIILDESFP 340

Query: 295 --LAAGSGFYPPGDL---------AGQDERCPMVISIVPVRTLVPRQFIISTPGASGNNA 343
             + +G G Y   D          A   +   M+I+I  V  L    F+I+  G SGN  
Sbjct: 341 EIMFSGEG-YSKADFFKILRESETANSSKMLNMIIAIKSVNPL-SSHFVITANGDSGNFF 398

Query: 344 SRLTQRTTRDGHREYT 359
           S+         + EYT
Sbjct: 399 SKYHITKIDGKNTEYT 414

>Kpol_1045.43 s1045 complement(101542..102690) [1149 bp, 382 aa]
           {ON} complement(101544..102692) [1149 nt, 383 aa]
          Length = 382

 Score = 94.0 bits (232), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 77/252 (30%), Positives = 123/252 (48%), Gaps = 34/252 (13%)

Query: 131 YQFKRWRSAKLYDALYRSLQTTKLDVRYRSIRGLYSTTLASIL--ERDRAGAE--LFDTV 186
           +QFKRWR+ ++ +  +  L+ + L  R  ++  +++  L  +L  E  + G+   +F+  
Sbjct: 143 HQFKRWRANRMINKWFDGLKNSHLRTRMSTMYAIHTKNLEEMLHNEAKQFGSYGGIFNET 202

Query: 187 VNGRKMRDMWGDENDRLRS-RQLLAFLESRVLESIRNNEDGVR-------EFFLGTDVDS 238
           +N  KM  M+ +  +   S  +L  F+E RV+E+I  NE+G+R       E  L  ++D 
Sbjct: 203 LNAMKMNPMYKNSIEFNESGEKLRNFIEYRVIEAIYKNEEGIRTTLFHNYEKALDPNIDK 262

Query: 239 WIRDGYDLQLDTRICGTTGR-SIGGKLAMSVTYPLYLVSSTNRRK-----LADVSIVFLD 292
             R      LD     +  R    G L  SVTYPLY    TN +      +  VSIV ++
Sbjct: 263 PFR------LDFNNVNSFQRFEKDGSLISSVTYPLY----TNLKDKPAVVVGYVSIVTMN 312

Query: 293 E---RLAAGSGFYPPGDLAGQDERCPMVISIVPVRTLVPRQFIISTPGASGNNASRLTQR 349
           +   R+  GSG  P  DL+   ++   +ISI     ++P  FII T G +G   S  +  
Sbjct: 313 DHPLRINLGSGDIPKVDLS---KKLKFIISIRSPSEMIPNYFIIDTVGETGKIFSHYSVG 369

Query: 350 TTRDGHREYTYD 361
            T DGH EYT +
Sbjct: 370 KTTDGHNEYTLN 381

>TPHA0P00670 Chr16 (137985..139127) [1143 bp, 380 aa] {ON} Anc_3.164
           YDL027C
          Length = 380

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 105/240 (43%), Gaps = 19/240 (7%)

Query: 127 GVIAYQFKRWRSAKLYDALYRSLQTTKLDVRYRSIRGLYSTTLASILERDRAGAELFDTV 186
           G   +Q+++WR          SL  T++  ++ +  GL  + + S+ +  R+    F   
Sbjct: 150 GYAFFQYRKWRLNCALKLWVNSLMKTQMHTKFSTFNGLRYSIINSVEKDARSQVFGFTNT 209

Query: 187 VNG---RKMRDMWGDENDRLRSRQLLAFLESRVLESIRNNEDGVREFFLGTDVDSW---I 240
            NG   R M DM  D +    S +   F+E+RVLE+  ++EDGVR   L +D  +W   I
Sbjct: 210 PNGPIFRAMNDMTRDLSTE-ASDKFKKFIEARVLEAFVSDEDGVRS-ALASD-HTWKQAI 266

Query: 241 RDGYDLQLDTRICGTTGRSIGGKLAMSVTYPLYLVS-STNRRKLADVSIVFLDERLAAGS 299
           +    L ++             K  M+  +PL + S S ++  L  VSIV         +
Sbjct: 267 KTSRPLGIEFGRMVERSFVARDKKYMTYAFPLSINSPSGSQSHLGRVSIVACH---PLSA 323

Query: 300 GFYPPGDLAGQDERCPMVISIVPVRTLVPRQFIISTPGASGNNASRLTQRTTRDGHREYT 359
           GF PP           +++ I     L P  FII T G +G   S+   +  +D H EYT
Sbjct: 324 GFNPP-----DKTNLKLILCIESNSKLSPDLFIIDTNGMTGEFFSKYDVQKFKD-HTEYT 377

>KLLA0C03872g Chr3 complement(353385..354515) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|Q7LHC7 Saccharomyces
           cerevisiae YDL027C Hypothetical ORF
          Length = 376

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 112/241 (46%), Gaps = 18/241 (7%)

Query: 127 GVIAYQFKRWRSAKLYDALYRSLQTTKLDVRYRSIRGLYSTTLASILERDRAGAELFDTV 186
           G+  YQFK +R+ KL   L  +   TK+ +   + R L    +  ++ + ++  +L D  
Sbjct: 146 GIGWYQFKAFRTRKLMQLLDHAFNQTKMKLSSTTRREL---IMKQMVPKFKSFTQLKDFS 202

Query: 187 VNGRKMRDMWGDE---NDRLRSRQLLAFLESRVLESIRNNEDGVREFFLGTDVDSWIRDG 243
               K+   + D+    +   + + L+F++SR+ ES   NE  ++   LG+D  +++   
Sbjct: 203 GFPFKLSQAFTDKFQSGEFPNADRFLSFVKSRLDESFYKNEHNIKSIVLGSDT-AYVPGH 261

Query: 244 YDLQLDTRICGTTGRSIGGKLAMSVTYPLYLVSSTNRRKLADVSIVFLDERLAAGSGFYP 303
            +L  ++    ++ R+     A S  + L  + S   RK   V++V++  +   G     
Sbjct: 262 MELVTNSYSFVSSVRNNENIQAFS--FMLLNMGSEGVRK--PVALVYIVTKANPGDELLM 317

Query: 304 -PGDLAGQDERCPMVISIVPVRTLVP--RQFIISTPGASGNNASRLTQRTTRDGHREYTY 360
             GD     +  PMVI    VR L P  +   I+  G +G NA    +R  +DG +EYTY
Sbjct: 318 FTGDYIDDSKLSPMVIY---VRALSPFSKCCFITDVGETGANAQYSVKR-KKDGSKEYTY 373

Query: 361 D 361
           +
Sbjct: 374 E 374

>KNAG0K01730 Chr11 (362599..363588) [990 bp, 329 aa] {ON} Anc_3.164
           YDL027C
          Length = 329

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 92/229 (40%), Gaps = 47/229 (20%)

Query: 126 AGVIAYQFKRWRSAKLYDALYRSLQTTKLDVRYRSIRGLYSTTLASILERDRAGAELFDT 185
             +I YQFK+W+  +LY  L + L  + L            TT +  +   R+   L + 
Sbjct: 126 VAIIVYQFKKWQRNQLYSRLMKYLPKSDL-----------YTTKSQFMSLRRSFGLLSNE 174

Query: 186 VVNGRKMRDMWGDENDRLRSRQLLAFLESRVLESIRNNEDGVREFFLGTDVDSWI----- 240
            V G              +S +   F+++R++E++  +   +R   +     SWI     
Sbjct: 175 AVVG--------------KSVEFTNFVKTRIMEALAKDTMKIRSTLIK---PSWIPKNAA 217

Query: 241 RDGYDLQLDTRICGTTGRSIGG--KLAMSVTYPLYLVSSTNRRK-----LADVSIVFLDE 293
            + Y L +         +++ G  K   SV YPL+ V+    R      +  V + FL +
Sbjct: 218 VEEYQLTIGLNRVKMFAKALQGQSKAVFSVEYPLFFVTKLEDRTKQSHLMGKVCLHFLYD 277

Query: 294 R---LAAGSGFYPPGDLAGQ----DERCPMVISIVPVRTLVPRQFIIST 335
               L   +  + P  L  Q    + +   VIS++   TL P+ FI+ T
Sbjct: 278 YSSILKNSAKSFDPETLFKQMNDTESKVQYVISVIQTGTLSPKPFILYT 326

>CAGL0K01639g Chr11 complement(146143..147354) [1212 bp, 403 aa]
           {ON} weakly similar to uniprot|Q07349 Saccharomyces
           cerevisiae YDL027c
          Length = 403

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/248 (20%), Positives = 101/248 (40%), Gaps = 64/248 (25%)

Query: 128 VIAYQFKRWRSAKLYDALYRSLQTTKLDVRYRSIRGLYSTTLASILERDRAGAELFDTVV 187
           ++ +QF+RW++ +LY  +   LQ ++++++   +  L                  +  + 
Sbjct: 165 IVFFQFRRWKTHQLYKKMAEVLQDSQINMKNNQLMSLK-----------------YRLIE 207

Query: 188 NGRKMRDMWGDENDRL---RSRQLLAFLESRVLESIRNNEDGVREFFLGTDVDSWIRDGY 244
            G  M   + ++  +    R   L+  L+ R+ ES  NN++ +   F        +  G+
Sbjct: 208 QGLPMLTNFSNKTTKQLSSRGETLINQLQQRIKESFANNDNNIANVF--------VPQGH 259

Query: 245 DL-QLDTRICGTTGRSIGGKLAMS-----VTYPLYLVSSTNR---------------RKL 283
            L + +  +   T +S   KL        ++  LY+    +R                K+
Sbjct: 260 KLSEYELLLPHHTFKSYTKKLPHDQDIGLLSLSLYMRRRQHRNIKVAMPIPVELNLGNKV 319

Query: 284 ADVSIVF--------LDERL---AAGSGFYPPGDLAGQDERCPMVISIVPVRTLVPRQFI 332
           A+V  V+        L+ ++   AA +G     DL         +ISIVP+ + +P Q+I
Sbjct: 320 ANVYFVYKGDTARGLLNTQILLEAAKAGV----DLQEIKSSTQFLISIVPLDSWLPTQYI 375

Query: 333 ISTPGASG 340
           I+  G+ G
Sbjct: 376 IADAGSLG 383

>Smik_14.65 Chr14 complement(105762..108134) [2373 bp, 790 aa] {ON}
           YNL272C (REAL)
          Length = 790

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 4/71 (5%)

Query: 137 RSAKLYDALYRSLQTTKLD----VRYRSIRGLYSTTLASILERDRAGAELFDTVVNGRKM 192
           + + L + L +SL+T        V Y  ++  Y     ++LE+D    +L + VV   ++
Sbjct: 27  KQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYEALKRTVLEKDDEVNKLREDVVKENEL 86

Query: 193 RDMWGDENDRL 203
           R    DEND+L
Sbjct: 87  RTKAEDENDKL 97

>KNAG0J00150 Chr10 complement(11793..13643) [1851 bp, 616 aa] {ON}
           Anc_8.863 YML088W
          Length = 616

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 6/77 (7%)

Query: 165 YSTTLASILERDRAGAELFDTVV-NGRKMRDMWG---DENDRLRSRQLLAFLESR--VLE 218
           ++ TL S LE      +L +       +++D++G   DEND    +  +A LES+  VLE
Sbjct: 459 WNETLHSELEMFEEHEKLSEQRARENSRLQDLYGGDFDENDEEDIQLKIALLESQQAVLE 518

Query: 219 SIRNNEDGVREFFLGTD 235
           S  NN++G  E  + +D
Sbjct: 519 SRMNNQEGHSETAMNSD 535

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.138    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,998,148
Number of extensions: 1192722
Number of successful extensions: 2534
Number of sequences better than 10.0: 19
Number of HSP's gapped: 2589
Number of HSP's successfully gapped: 19
Length of query: 361
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 250
Effective length of database: 40,753,473
Effective search space: 10188368250
Effective search space used: 10188368250
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 66 (30.0 bits)