Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0C07370g3.161ON39139120150.0
KLTH0F06490g3.161ON39139119350.0
KLLA0C03850g3.161ON39139119240.0
Kpol_479.253.161ON39139119190.0
TDEL0D046103.161ON39139119120.0
Suva_4.2203.161ON39139119100.0
Skud_4.2223.161ON39139119100.0
YDL029W (ARP2)3.161ON39139119030.0
Smik_4.2063.161ON39139119030.0
CAGL0K01595g3.161ON39139118960.0
NCAS0C035503.161ON39239118900.0
NDAI0G029003.161ON39139118880.0
Ecym_52373.161ON39139118750.0
ADR316W3.161ON39139118720.0
TPHA0A009203.161ON39139118620.0
ZYRO0B04928g3.161ON39139118600.0
KNAG0K01130na 1ON39339318550.0
TBLA0F008703.161ON39139118550.0
Kwal_33.141773.161ON33733716600.0
KAFR0C01040na 1ON33733716060.0
NDAI0G030408.23ON3753778541e-112
NCAS0C037008.23ON3753778531e-111
Ecym_15208.23ON3763778521e-111
KNAG0L002508.23ON3753778511e-111
KAFR0D009408.23ON3753778511e-111
TDEL0C004708.23ON3753778511e-111
CAGL0K12694g8.23ON3753778511e-111
Suva_6.188.23ON3753778511e-111
Smik_6.398.23ON3753778511e-111
YFL039C (ACT1)8.23ON3753778511e-111
TPHA0D002508.23ON3753778511e-111
TBLA0C004408.23ON3753778501e-111
ZYRO0F02772g8.23ON3753778491e-111
ABR222W8.23ON3763778481e-111
Kpol_1058.158.23ON3753778471e-110
KLTH0G18832g8.23ON3753778451e-110
KLLA0D05357g8.23ON3753778451e-110
SAKL0B00968g8.23ON3753778441e-110
Skud_6.318.23ON3603698241e-107
Kwal_14.11098.23ON3603698171e-106
SAKL0E11814g2.117ON3793867158e-91
AFR051W2.117ON4053866933e-87
Ecym_63852.117ON3773896852e-86
Kpol_1023.188.23ON3192906768e-86
KLTH0B05940g2.117ON3833886766e-85
KLLA0E22925g2.117ON3803906671e-83
Kwal_33.146422.117ON3833886436e-80
ZYRO0G05676g2.117ON3813976427e-80
NCAS0B071302.117ON3813816374e-79
KAFR0F005902.117ON3863866229e-77
TBLA0B010702.117ON3833796202e-76
YHR129C (ARP1)2.117ON3843785957e-73
Suva_15.3262.117ON3843785941e-72
Smik_8.2102.117ON3843785862e-71
TPHA0I013002.117ON3793855843e-71
Skud_8.1902.117ON3843785826e-71
TDEL0B048102.117ON3733795764e-70
NDAI0B044602.117ON3813845671e-68
KNAG0H036502.117ON3873955332e-63
CAGL0H09042g2.117ON3873804678e-54
KNAG0B001701.514ON4534464491e-50
KLTH0C02508g1.514ON4514444491e-50
TPHA0O010401.514ON4584514483e-50
YJR065C (ARP3)1.514ON4494424463e-50
SAKL0D12804g1.514ON4564494474e-50
Kwal_27.99581.514ON4454384446e-50
Smik_10.3551.514ON4494424446e-50
Skud_10.2891.514ON4494414412e-49
Suva_12.1541.514ON4494424412e-49
KLLA0B13904g1.514ON4564494404e-49
KAFR0D037001.514ON4494424342e-48
TBLA0D036801.514ON4584594352e-48
NCAS0A122701.514ON4544474333e-48
CAGL0F00517g1.514ON4544474333e-48
TDEL0F004701.514ON4614544324e-48
Ecym_31531.514ON4584504291e-47
Kpol_1056.161.514ON4603574291e-47
NDAI0A039701.514ON4624574264e-47
AFR419C1.514ON4553574194e-46
ZYRO0G01936g1.514ON4613564133e-45
NDAI0G055801.287ON5152992146e-18
NCAS0B060601.287ON4972932139e-18
Suva_6.1541.287ON4893032075e-17
Skud_10.1321.287ON4882902066e-17
Smik_10.1611.287ON4892982031e-16
YJL081C (ARP4)1.287ON4893052032e-16
SAKL0H17138g8.258ON4193712012e-16
AFR105C1.287ON4792951971e-15
KLTH0G13772g8.258ON4203821932e-15
TDEL0F038508.258ON4193661914e-15
KLLA0F19063g8.258ON4153841915e-15
Kwal_56.238328.258ON4193821852e-14
KAFR0B027008.258ON4203721852e-14
ZYRO0C01738g8.258ON4143621843e-14
Kpol_543.368.258ON4273741826e-14
Suva_14.2812.248ON7552341829e-14
KNAG0B019201.287ON5052061801e-13
Kpol_282.41.287ON5013021792e-13
KAFR0A015601.287ON4853061782e-13
KLTH0H09702g1.287ON4811981764e-13
Skud_14.2722.248ON7552341774e-13
TDEL0D015501.287ON4801891754e-13
CAGL0M03201g1.287ON4932031755e-13
TPHA0A018308.258ON4213671738e-13
Ecym_43128.258ON4113691729e-13
AGR091W8.258ON4103341702e-12
CAGL0L12166g8.258ON4213901693e-12
KLLA0D02288g1.287ON5201891694e-12
ZYRO0G21428g1.287ON4831981675e-12
TPHA0I010301.287ON5032131666e-12
KLTH0G09482g2.248ON7452291677e-12
Smik_12.1448.258ON4383901658e-12
Smik_14.2672.248ON7552321651e-11
NDAI0B019608.258ON4392461641e-11
TBLA0D053601.287ON5962361641e-11
Ecym_63301.287ON4801841613e-11
NCAS0B049908.258ON4203711613e-11
KNAG0G020108.258ON4243841594e-11
Kwal_14.23771.287ON4811851604e-11
SAKL0D05874g1.287ON4972821551e-10
KAFR0J011602.248ON7512331552e-10
Skud_12.1538.258ON4381801532e-10
YNL059C (ARP5)2.248ON7552321552e-10
YLR085C (ARP6)8.258ON4381801523e-10
Kwal_23.48482.248ON7452831491e-09
Suva_10.1698.258ON4381801471e-09
NCAS0G030502.248ON7432331481e-09
KLLA0F03421g2.248ON7472021482e-09
NDAI0D010602.248ON7532341454e-09
TBLA0E038602.248ON7592381428e-09
ZYRO0A01584g2.248ON7481391411e-08
TBLA0H014608.258ON4421881382e-08
SAKL0E08602g2.248ON7472311364e-08
TDEL0C041402.248ON7492321356e-08
TPHA0C031602.248ON7552301241e-06
CAGL0J10054g2.248ON7542311241e-06
KNAG0I018602.248ON7532271204e-06
Kpol_1003.162.248ON7492271161e-05
ADL253C2.248ON7512321106e-05
Ecym_32852.248ON7461341044e-04
SAKL0H17358g8.251ON311250930.005
AFR135W5.477ON791150860.051
Kpol_520.117.448ON488281840.076
Kpol_543.105.477ON876141840.092
KLLA0F11913g8.251ON25398800.18
NCAS0A147207.448ON485197800.21
SAKL0F13772g7.448ON422163790.28
KAFR0K021507.448ON490115790.29
Skud_15.3045.477ON883139790.34
NDAI0A013007.448ON565196770.60
TBLA0H028002.593ON484302760.78
Smik_15.3205.477ON873128760.93
KLTH0B07502g2.54ON999162731.8
Suva_13.2022.593ON467237722.0
Ecym_35058.251ON305217712.3
YOR141C (ARP8)5.477ON88187722.3
Ecym_23115.477ON775103722.6
CAGL0F05907g2.593ON462297685.9
KNAG0B021107.448ON48587686.6
Skud_16.3217.448ON479191687.3
KAFR0E025305.477ON842123678.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0C07370g
         (391 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...   780   0.0  
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...   749   0.0  
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...   745   0.0  
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...   743   0.0  
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...   741   0.0  
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...   740   0.0  
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...   740   0.0  
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...   737   0.0  
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...   737   0.0  
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...   734   0.0  
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...   732   0.0  
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...   731   0.0  
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...   726   0.0  
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...   725   0.0  
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...   721   0.0  
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...   721   0.0  
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...   719   0.0  
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...   719   0.0  
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...   644   0.0  
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...   623   0.0  
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...   333   e-112
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...   333   e-111
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...   332   e-111
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...   332   e-111
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...   332   e-111
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...   332   e-111
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...   332   e-111
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...   332   e-111
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...   332   e-111
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...   332   e-111
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...   332   e-111
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...   332   e-111
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...   331   e-111
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...   331   e-111
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...   330   e-110
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...   330   e-110
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...   330   e-110
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...   329   e-110
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...   322   e-107
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...   319   e-106
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...   280   8e-91
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...   271   3e-87
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...   268   2e-86
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...   265   8e-86
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...   265   6e-85
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...   261   1e-83
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...   252   6e-80
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...   251   7e-80
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...   249   4e-79
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...   244   9e-77
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...   243   2e-76
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...   233   7e-73
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...   233   1e-72
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...   230   2e-71
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...   229   3e-71
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...   228   6e-71
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...   226   4e-70
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...   223   1e-68
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...   209   2e-63
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...   184   8e-54
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...   177   1e-50
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...   177   1e-50
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....   177   3e-50
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...   176   3e-50
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...   176   4e-50
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...   175   6e-50
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...   175   6e-50
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...   174   2e-49
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...   174   2e-49
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...   174   4e-49
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...   171   2e-48
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...   172   2e-48
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...   171   3e-48
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...   171   3e-48
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...   171   4e-48
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...   169   1e-47
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....   169   1e-47
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514    168   4e-47
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...   166   4e-46
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...   163   3e-45
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    87   6e-18
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    87   9e-18
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    84   5e-17
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    84   6e-17
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    83   1e-16
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    83   2e-16
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...    82   2e-16
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    80   1e-15
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...    79   2e-15
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...    78   4e-15
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...    78   5e-15
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...    76   2e-14
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...    76   2e-14
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...    75   3e-14
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...    75   6e-14
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    75   9e-14
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    74   1e-13
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    74   2e-13
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    73   2e-13
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    72   4e-13
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    73   4e-13
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    72   4e-13
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    72   5e-13
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...    71   8e-13
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...    71   9e-13
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...    70   2e-12
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...    70   3e-12
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    70   4e-12
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    69   5e-12
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    69   6e-12
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    69   7e-12
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...    68   8e-12
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    68   1e-11
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...    68   1e-11
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    68   1e-11
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    67   3e-11
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...    67   3e-11
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...    66   4e-11
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    66   4e-11
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    64   1e-10
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    64   2e-10
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...    64   2e-10
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    64   2e-10
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...    63   3e-10
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    62   1e-09
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...    61   1e-09
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    62   1e-09
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    62   2e-09
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    60   4e-09
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    59   8e-09
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    59   1e-08
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...    58   2e-08
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    57   4e-08
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    57   6e-08
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    52   1e-06
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    52   1e-06
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    51   4e-06
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    49   1e-05
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    47   6e-05
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    45   4e-04
SAKL0H17358g Chr8 complement(1535040..1535975) [936 bp, 311 aa] ...    40   0.005
AFR135W Chr6 (680340..682715) [2376 bp, 791 aa] {ON} Syntenic ho...    38   0.051
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    37   0.076
Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}...    37   0.092
KLLA0F11913g Chr6 complement(1094612..1095373) [762 bp, 253 aa] ...    35   0.18 
NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON} Anc_7...    35   0.21 
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    35   0.28 
KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7....    35   0.29 
Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {...    35   0.34 
NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {O...    34   0.60 
TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.5...    34   0.78 
Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {...    34   0.93 
KLTH0B07502g Chr2 (604448..604460,604791..607777) [3000 bp, 999 ...    33   1.8  
Suva_13.202 Chr13 (328209..328238,328325..329698) [1404 bp, 467 ...    32   2.0  
Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON} ...    32   2.3  
YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON} ...    32   2.3  
Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar t...    32   2.6  
CAGL0F05907g Chr6 (591411..592799) [1389 bp, 462 aa] {ON} simila...    31   5.9  
KNAG0B02110 Chr2 complement(399743..401200) [1458 bp, 485 aa] {O...    31   6.6  
Skud_16.321 Chr16 (604148..605587) [1440 bp, 479 aa] {ON} YPR034...    31   7.3  
KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.4...    30   8.5  

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/391 (96%), Positives = 379/391 (96%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60
           MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA
Sbjct: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120
           SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKR 180
           QMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVLSHLTKR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTKR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300
           ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV
Sbjct: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391
           ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR
Sbjct: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/391 (91%), Positives = 374/391 (95%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60
           MD  TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA++ TPLKDIMIGDEA
Sbjct: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120
           S VRSYLQISYPMENG+IKNW+DMELLWDYAFY+QMKLPSTSGGKV+LTEPPMNPLRNRE
Sbjct: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKR 180
           QMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLT+R
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL YVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300
           ENYELPDGRVIKVGSERFEAPECLFQP+LVDVEQPGVGEMLFNT+QAADVDVR+ALYRA+
Sbjct: 241 ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRL+KFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391
           ANIMADKDHMWL+KQEWQEMGP+AMSKFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/391 (90%), Positives = 373/391 (95%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60
           MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER   +TPLKDIMIGDEA
Sbjct: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120
           S+VRSYLQISYPMENGII+NWADMELLWDYAF+EQMKLP+TSGGKVLLTEPPMNP++NRE
Sbjct: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKR 180
           QMCEVMFEKYDFGG YVAIQAVLALYAQGL            THIVPVYESVVL+HLT+R
Sbjct: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300
           E+YELPDGRVIKVG ERFEAPECLFQPSLVDVEQPGVGE+LFNT+QAADVD+RT+LY+A+
Sbjct: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391
           ANIMADKDHMWL+KQEW E+GPAAMSKFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/391 (90%), Positives = 371/391 (94%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASI+TPLKDIMIGDEA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASISTPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120
           S+VRSYLQISYPMENGIIKNW DMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPL+NRE
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKR 180
           QMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLT+R
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKLCYVSYDLDLDT+LARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTRLARETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300
           E YELPDGR+IKVG ERFEAPECLFQP+LVDVE  GVGE+LFNT+Q+ADVDVR++LY+A+
Sbjct: 241 EKYELPDGRIIKVGQERFEAPECLFQPNLVDVESAGVGELLFNTIQSADVDVRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVL  DPSRLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLNKDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391
           ANIMADKDHMWL+KQEWQE GPAAMSKFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWQESGPAAMSKFGPR 391

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score =  741 bits (1912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/391 (89%), Positives = 370/391 (94%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60
           MDPH PIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEERA+++TPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERANVSTPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120
           SDVRSYLQISYPMENGIIKNW DMELLWDYAF++QMKLP+TS GK+LLTEPPMNP++NRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFDQMKLPTTSNGKILLTEPPMNPVKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKR 180
           QMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLT+R
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEK+CYVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKVCYVSYDLDLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300
           ENYELPDGRVIKVG ERFEAPECLFQPSLVDVEQ GVGE+LFNT+Q ADVD+R+ALYRA+
Sbjct: 241 ENYELPDGRVIKVGQERFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSALYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVL ND SRLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDASRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391
           ANIMADKDHMWL+KQEWQE GPAAM+KFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWQESGPAAMAKFGPR 391

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/391 (89%), Positives = 370/391 (94%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60
           MDPH PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERAS+TTPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120
           SDVRSYLQISYPMENGIIKNW DMELLWDYAF+EQMKL STS GK+LLTEPPMNPL+NRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLQSTSNGKILLTEPPMNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLT+R
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300
           E+YELPDGR IKVG ERFEAPECLFQP LVDVEQPGVGE+LFNTVQ+ADVD+R++LY+A+
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF+RVL NDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391
           A+IMADKDHMWL+KQEWQE GPAAMSKFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWQESGPAAMSKFGPR 391

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/391 (89%), Positives = 368/391 (94%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60
           MDPH PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERAS+ TPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120
           SDVRSYLQISYPMENGIIKNW DMELLWDYAF+EQMKLPSTS GK+LLTEPPMNPL+NRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVLSHLT+R
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKLCYVSYDLDLDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTVLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300
           E+YELPDGR IKVG ERFEAPECLFQP LVDVEQPGVGE+LFNTVQ+ADVD+R++LYRA+
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF RVL NDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFNRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391
           A+IMADKDHMWL+KQEWQE GPAAM+KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWQESGPAAMTKFGPR 391

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/391 (89%), Positives = 369/391 (94%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60
           MDPH PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERAS+ TPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120
           S+VRSYLQISYPMENGIIKNW DMELLWDYAF+EQMKLPSTS GK+LLTEPPMNPL+NRE
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVLSHLT+R
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKLCYVSYDLDLDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300
           E+YELPDGR IKVG ERFEAPECLFQP LVDVEQPGVGE+LFNTVQ+ADVD+R++LY+A+
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF+RVL NDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391
           A+IMADKDHMWL+KQEWQE GP+AM+KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWQESGPSAMTKFGPR 391

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/391 (89%), Positives = 369/391 (94%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60
           MDPH PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERAS+TTPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120
           SDVRSYLQISYPMENGIIKNW DMELLWDYAF+EQMKLPSTS GK+LLTEPPMNPL+NRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVLSHLT+R
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKLCYVSYDLDLDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300
           E+YELPDGR IKVG ERFEAPECLFQP LVDVEQPGVGE+LFNTVQ+ADVD+R++LY+A+
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF+RVL NDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391
           A+IMADKDHMWL+KQEW E GPA+M+KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWLESGPASMAKFGPR 391

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/391 (88%), Positives = 369/391 (94%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60
           MDPH PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA+I  PLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERATINKPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120
           SDVRSYLQISYPMENGIIKNW DMELLWDYAF+ QM+LP+TSGGK+LLTEPPMNP++NRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMQLPTTSGGKILLTEPPMNPVKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKR 180
           QMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLT+R
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300
           ENYELPDGR+IKVG ERFEAPECLFQP+LVDVEQ G+GE+LFNT+Q+ADVDVR++LY+A+
Sbjct: 241 ENYELPDGRIIKVGQERFEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVL NDP+RLDKFKVRIEDPPRR+HMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLNNDPTRLDKFKVRIEDPPRRRHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391
           A+IMADKDHMWLTKQEW+E G AAMSKFGPR
Sbjct: 361 ASIMADKDHMWLTKQEWRESGAAAMSKFGPR 391

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/391 (88%), Positives = 369/391 (94%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA+ITTPLKDIMIGDEA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120
           S+VRSYLQISYPMENGIIKNW DMELLWDYAF+EQMKLP+TS GK+LLTEPPMNP +NRE
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL HLT+R
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLGHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300
           E+YELPDGR IKVG ERFEAPECLFQP LVDVEQPG+GE+LF+TVQ+ADVDVR+ALY+A+
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391
           A+IMADKDHMWL+KQEWQE G A+M KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWQESGAASMVKFGPR 391

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/391 (88%), Positives = 369/391 (94%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA+ITTPL+DIMIGDEA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLRDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120
           SDVRSYLQISYPMENGIIKNW DMELLWDYAF+ QMKL +TSGGK+LLTEPPMNPL+NRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMKLNNTSGGKILLTEPPMNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLT+R
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300
           E+YELPDGR IKVG ERFEAPECLFQP LVDVEQPGVGE+LFNT+Q+ADVDVR+ALY+A+
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTIQSADVDVRSALYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLW+TRVL NDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWYTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391
           A+IMADKDHMWL+KQEW E G AAM+KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWYEGGAAAMAKFGPR 391

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/391 (88%), Positives = 370/391 (94%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60
           MDP+ PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRA ER++I+TPLKDIMIGDEA
Sbjct: 1   MDPYVPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120
           S+VRSYLQISYPMENGIIKNWADME LWDYAFY+QMK+PST+G KVLLTEPPMNPL+NRE
Sbjct: 61  SNVRSYLQISYPMENGIIKNWADMEQLWDYAFYDQMKIPSTAGHKVLLTEPPMNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKR 180
           QMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLT+R
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTR+LIDLLSRRGYAFN++ADFETVRQIKEKLCYVSYDLDLDTKLA ETTTLV
Sbjct: 181 LDVAGRDVTRYLIDLLSRRGYAFNKTADFETVRQIKEKLCYVSYDLDLDTKLAHETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300
           E YELPDGRVIKVGSERFEAPECLFQPSLVDVEQ G+GEMLF+T+Q+ADVD+ +ALYRA+
Sbjct: 241 ETYELPDGRVIKVGSERFEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDIISALYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVL+NDP+RLDKFKVRIEDPPRRKHMVF GGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPARLDKFKVRIEDPPRRKHMVFTGGAVL 360

Query: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391
           ANIMADKDHMWLTK+EW+EMGPAAMSKFGPR
Sbjct: 361 ANIMADKDHMWLTKKEWEEMGPAAMSKFGPR 391

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/391 (87%), Positives = 370/391 (94%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60
           MDP  PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRA+ERA+++TPLKDIMIGDEA
Sbjct: 1   MDPQKPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120
           S VRSYLQISYPMENGII++WADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE
Sbjct: 61  SQVRSYLQISYPMENGIIRDWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKR 180
           QMCEVMFEKYDFGGVYV IQAVLALYAQGL            THIVPVYESVVL+HLT+R
Sbjct: 121 QMCEVMFEKYDFGGVYVGIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRD+TR+LIDLLSRRGYAFN++ADFETVRQIKEKLCYVSYDLDLDT+LA+ETTTLV
Sbjct: 181 LDVAGRDMTRYLIDLLSRRGYAFNKTADFETVRQIKEKLCYVSYDLDLDTRLAQETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300
           E YELPDGRVIKVGSERFEAPECLFQPSLVDVEQPG+GEMLFNT+Q+ADVD+ + LY+A+
Sbjct: 241 EQYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVL+NDP+RL+KFKVRIEDPPRRKHMVF GGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPTRLEKFKVRIEDPPRRKHMVFTGGAVL 360

Query: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391
           A+IMADK+HMWLTKQEW+E GPA+MSKFGPR
Sbjct: 361 ASIMADKEHMWLTKQEWEESGPASMSKFGPR 391

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/391 (86%), Positives = 367/391 (93%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEER ++  PLKD+MIG+EA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120
           S VRSYLQISYPMENGIIKNW DMELLWDYAFYEQMKLPSTSGGKVLLTEPP+NPL+NRE
Sbjct: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLT+R
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKLCYVSYDL+LDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300
           ENYELPDGRVIKVG ERFEA ECLFQP+LVDVE  GVGE+LFNT+Q+AD+DVR++LY+A+
Sbjct: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSR+EKELKQLW+TRVL NDP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391
           A+IMADKDHMWL+KQEW E GPAAM+KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  721 bits (1860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/391 (86%), Positives = 365/391 (93%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER SI+TPLKDIMIG+EA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGSISTPLKDIMIGEEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120
           SDVRSYLQISYPMENGII+NW DME LWDYAFY QMK PSTSGGK+LLTEPPMNPL+NRE
Sbjct: 61  SDVRSYLQISYPMENGIIRNWQDMEHLWDYAFYNQMKFPSTSGGKILLTEPPMNPLKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKR 180
            MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLT+R
Sbjct: 121 LMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL YVSYDL+LDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLNLDTKLARETTVLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300
           ENYELPDGRVIKVG ERFEAPECLFQP LVDVEQPG+GE+LFNT+Q+ADVD+R++LYRA+
Sbjct: 241 ENYELPDGRVIKVGQERFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVDIRSSLYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLW+TR+LR D +RLDKFKV+IEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWYTRILRGDAARLDKFKVKIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391
           A+IMA+KDHMWLTK+EW E GPAAM+KFGPR
Sbjct: 361 ASIMAEKDHMWLTKEEWHESGPAAMAKFGPR 391

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/393 (86%), Positives = 369/393 (93%), Gaps = 2/393 (0%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASI--TTPLKDIMIGD 58
           MDPH+PIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEER+ +   TP+KDIM+G+
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDFTFPSIVGRPILRAEERSFMDSKTPIKDIMVGE 60

Query: 59  EASDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRN 118
           EASDVRSYLQISYPMENGIIK+W DMELLWD+AF+E+MKLPSTSGGK+LLTEPPMNPL+N
Sbjct: 61  EASDVRSYLQISYPMENGIIKHWTDMELLWDHAFFEKMKLPSTSGGKILLTEPPMNPLKN 120

Query: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLT 178
           RE MC+VMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLT
Sbjct: 121 REMMCQVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLT 180

Query: 179 KRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTT 238
           +RLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL YVSYDLD DTKLARETTT
Sbjct: 181 RRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDFDTKLARETTT 240

Query: 239 LVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYR 298
           LVENYELPDGR+IKVG ERFEAPECLFQP+LVDVEQPGVGE+LFNT+Q+ADVD+R++LY+
Sbjct: 241 LVENYELPDGRIIKVGQERFEAPECLFQPNLVDVEQPGVGELLFNTIQSADVDIRSSLYK 300

Query: 299 AVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGA 358
           A+VLSGGSSMYPGLPSRLEKELKQLWFTRVL+NDPSRLDKFKVRIEDPPRRKHMVFIGGA
Sbjct: 301 AIVLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPSRLDKFKVRIEDPPRRKHMVFIGGA 360

Query: 359 VLANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391
           VLANIMADKDHMWL+KQEW+E G  AM+KFGPR
Sbjct: 361 VLANIMADKDHMWLSKQEWEESGAQAMAKFGPR 393

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/391 (85%), Positives = 367/391 (93%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER +I+TPLKDIMIGDEA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGTISTPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120
           S+VRSYLQISYPMENGIIKNW DMELLWDYAF+ QMKLP+TSGGKVLLTEPPMNP++NRE
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMKLPTTSGGKVLLTEPPMNPVKNRE 120

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKR 180
           +MCEVMFE+YDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLT+R
Sbjct: 121 RMCEVMFERYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGY+FNR+ADFETVRQIKEK+CYVSYDL+LDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYSFNRTADFETVRQIKEKVCYVSYDLNLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300
           + YELPDGR+IKVG ERFEAPECLFQP LVDVE PGVGE+LFNT+Q+AD+DVR++LY+A+
Sbjct: 241 QEYELPDGRIIKVGQERFEAPECLFQPDLVDVESPGVGELLFNTIQSADIDVRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLE+ELKQLWFTR+L+ D  RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLERELKQLWFTRILKGDAERLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391
           ANIMADKDHMWL+KQEWQE G AA++KFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWQENGAAALAKFGPR 391

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/337 (91%), Positives = 321/337 (95%)

Query: 55  MIGDEASDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMN 114
           MIGDEAS VRSYLQISYPMENG+IKNW+DMELLWDYAFY+QM+LPSTSGGKV+LTEPPMN
Sbjct: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60

Query: 115 PLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 174
           P++NREQMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 120

Query: 175 SHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLAR 234
           +HLT+RLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL YVSYDLDLDTKLAR
Sbjct: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180

Query: 235 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRT 294
           ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNT+Q+ADVDVR+
Sbjct: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240

Query: 295 ALYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVF 354
           ALYRA+VLSGGSSMYPGLPSRLEKELKQLWFTRVL NDPSRLDKFKVRIEDPPRRKHMVF
Sbjct: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300

Query: 355 IGGAVLANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391
           IGGAVLANIMADKDHMWL+KQEWQEMG AAMSKFGPR
Sbjct: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/337 (86%), Positives = 317/337 (94%)

Query: 55  MIGDEASDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMN 114
           MIG EAS+VRSYLQISYPMENGIIKNW DMELLWDYAFYEQMKLP TS GK+LLTEPPMN
Sbjct: 1   MIGGEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPDTSNGKILLTEPPMN 60

Query: 115 PLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 174
           P++NRE+MCEVMFEKY+FGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 61  PIKNREKMCEVMFEKYNFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 120

Query: 175 SHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLAR 234
           +HLT+RLDVAGRDVTR+LIDLLSRRGYAFNR+ADFETVRQIKEKLCYVSYDLDLDTKLAR
Sbjct: 121 NHLTRRLDVAGRDVTRNLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR 180

Query: 235 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRT 294
           ETTTLVE+YELPDGRVIKVGSERFEAPECLFQP+LVDVEQ GVGE+LFNT+Q+ADVD+R+
Sbjct: 181 ETTTLVESYELPDGRVIKVGSERFEAPECLFQPNLVDVEQAGVGELLFNTIQSADVDIRS 240

Query: 295 ALYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVF 354
            L++A+VLSGGSSMYPGLPSRLEKELKQLWFTRVL NDP+RLDKFKVRIEDPPRRKHMVF
Sbjct: 241 TLFKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPTRLDKFKVRIEDPPRRKHMVF 300

Query: 355 IGGAVLANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391
           IGGAVLANIMADKDHMWL+KQEW+E GPAAM+KFGPR
Sbjct: 301 IGGAVLANIMADKDHMWLSKQEWEESGPAAMAKFGPR 337

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  333 bits (854), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 245/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKLCYV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTASQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGS 306
           DG+VI +G+ERF APE LF PS++ +E  G+ +  +N++   DVDVR  LY  +V+SGGS
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGS 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLTKQEWQEMGPA 383
           +  MW++KQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  333 bits (853), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 245/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKLCYV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGS 306
           DG+VI +G+ERF APE LF PS++ +E  G+ +  +N++   DVDVR  LY  +V+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSILSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLTKQEWQEMGPA 383
           +  MW++KQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score =  332 bits (852), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 244/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R  
Sbjct: 9   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDCYVGDEAQSKRGI 65

Query: 67  LQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE PMNP  NRE+M ++M
Sbjct: 66  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 124

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 125 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 184

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKLCYV+ D D + + A +++ + ++YELP
Sbjct: 185 DMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDYDQEMQTAAQSSAIEKSYELP 244

Query: 247 DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGS 306
           DG+VI +G+ERF APE LF PS++ +E  G+ +  +N++   DVDVR  LY  +V+SGG+
Sbjct: 245 DGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 304

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 305 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 353

Query: 367 KDHMWLTKQEWQEMGPA 383
           +  MW++KQE+ E GP+
Sbjct: 354 Q-QMWISKQEYDESGPS 369

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  332 bits (851), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 245/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKLCYV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGS 306
           DG+VI +G+ERF APE LF PS++ +E  G+ +  +N++   DVDVR  LY  +V+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLTKQEWQEMGPA 383
           +  MW++KQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  332 bits (851), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 245/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKLCYV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGS 306
           DG+VI +G+ERF APE LF PS++ +E  G+ +  +N++   DVDVR  LY  +V+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLTKQEWQEMGPA 383
           +  MW++KQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score =  332 bits (851), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 245/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKLCYV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGS 306
           DG+VI +G+ERF APE LF PS++ +E  G+ +  +N++   DVDVR  LY  +V+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLTKQEWQEMGPA 383
           +  MW++KQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score =  332 bits (851), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 245/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKLCYV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGS 306
           DG+VI +G+ERF APE LF PS++ +E  G+ +  +N++   DVDVR  LY  +V+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLTKQEWQEMGPA 383
           +  MW++KQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  332 bits (851), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 245/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKLCYV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGS 306
           DG+VI +G+ERF APE LF PS++ +E  G+ +  +N++   DVDVR  LY  +V+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLTKQEWQEMGPA 383
           +  MW++KQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  332 bits (851), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 245/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKLCYV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGS 306
           DG+VI +G+ERF APE LF PS++ +E  G+ +  +N++   DVDVR  LY  +V+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLTKQEWQEMGPA 383
           +  MW++KQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score =  332 bits (851), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 245/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKLCYV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGS 306
           DG+VI +G+ERF APE LF PS++ +E  G+ +  +N++   DVDVR  LY  +V+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLTKQEWQEMGPA 383
           +  MW++KQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  332 bits (851), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 161/377 (42%), Positives = 245/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKLCYV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGS 306
           DG+VI +G+ERF APE LF PS++ +E  G+ +  +N++   D+DVR  LY  +V+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDIDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLTKQEWQEMGPA 383
           +  MW++KQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  332 bits (850), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 161/377 (42%), Positives = 245/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAIMRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKLCYV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGS 306
           DG+VI +G+ERF APE LF PS++ +E  G+ +  +N++   DVDVR  LY  +V+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS ++   V+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSME---VKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLTKQEWQEMGPA 383
           +  MW++KQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score =  331 bits (849), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 245/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    + H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSMPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKLCYV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSVEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGS 306
           DG+VI +G+ERF APE LF PS++ +E  GV +  +N++   DVDVR  LY  +V+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLSLESSGVDQTTYNSIMKCDVDVRKDLYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLTKQEWQEMGPA 383
           +  MW++KQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score =  331 bits (848), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 244/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R  
Sbjct: 9   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 65

Query: 67  LQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE PMNP  NRE+M ++M
Sbjct: 66  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 124

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 125 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 184

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKLCYV+ D + + + A +++ + ++YELP
Sbjct: 185 DMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELP 244

Query: 247 DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGS 306
           DG+VI +G+ERF APE LF PS++ +E  G+ +  +N++   DVDVR  LY  +V+SGG+
Sbjct: 245 DGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 304

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 305 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 353

Query: 367 KDHMWLTKQEWQEMGPA 383
           +  MW++KQE+ E GP+
Sbjct: 354 Q-QMWISKQEYDESGPS 369

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score =  330 bits (847), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 161/377 (42%), Positives = 245/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    + H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKLCYV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGS 306
           DG+VI +G+ERF APE LF PS++ +E  G+ +  +N++   DVDVR  LY  +V+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLTKQEWQEMGPA 383
           +  MW++KQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  330 bits (845), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 244/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE PMNP  NRE+M +++
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIL 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKLCYV+ D + + + A +++ + ++YELP
Sbjct: 184 DMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGS 306
           DG+VI +G+ERF APE LF PSL+ +E  G+ +  +N++   DVDVR  LY  +V+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLTKQEWQEMGPA 383
           +  MW++KQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  330 bits (845), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 160/377 (42%), Positives = 244/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE PMNP  NRE+M +++
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKNNREKMTQIL 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +L+ RGY+F+ +A+ E VR IKEKLCYV+ D + + + A +++ + ++YELP
Sbjct: 184 DITDYLMKILAERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTASQSSAVEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGS 306
           DG+VI +G+ERF APE LF PS++ +E  G+ +  +N++   DVDVR  LY  +V+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLSLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLTKQEWQEMGPA 383
           +  MW++KQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score =  329 bits (844), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 161/377 (42%), Positives = 244/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE PMNP  NRE+M +++
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIL 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKLCYV+ D + + + A +++ + ++YELP
Sbjct: 184 DMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGS 306
           DG+VI +G+ERF APE LF PS++ +E  G+ +  +N++   DVDVR  LY  +V+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLTKQEWQEMGPA 383
           +  MW++KQE+ E GP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score =  322 bits (824), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 158/369 (42%), Positives = 238/369 (64%), Gaps = 16/369 (4%)

Query: 15  FVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSYLQISYPME 74
             K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R  L + YP+E
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIE 57

Query: 75  NGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVMFEKYDFGG 134
           +GI+ NW DME +W + FY ++++ +     VLLTE PMNP  NRE+M ++MFE ++   
Sbjct: 58  HGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPA 116

Query: 135 VYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAGRDVTRHLID 194
            YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGRD+T +L+ 
Sbjct: 117 FYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMK 176

Query: 195 LLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELPDGRVIKVG 254
           +LS RGY+F+ +A+ E VR IKEKLCYV+ D + + + A +++++ ++YELPDG+VI +G
Sbjct: 177 ILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIG 236

Query: 255 SERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPS 314
           +ERF APE LF PS++ +E  G+ +  +N++   DVDVR  LY  +V+SGG++M+PG+  
Sbjct: 237 NERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 296

Query: 315 RLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLTK 374
           R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   +  MW++K
Sbjct: 297 RMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTFQ-QMWISK 344

Query: 375 QEWQEMGPA 383
           QE+ E GP+
Sbjct: 345 QEYDESGPS 353

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score =  319 bits (817), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 158/369 (42%), Positives = 237/369 (64%), Gaps = 16/369 (4%)

Query: 15  FVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSYLQISYPME 74
             K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R  L + YP+E
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIE 57

Query: 75  NGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVMFEKYDFGG 134
           +GI+ NW DME +W + FY ++++ +     VLLTE PMNP  NRE+M +++FE ++   
Sbjct: 58  HGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQILFETFNVPA 116

Query: 135 VYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAGRDVTRHLID 194
            YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGRD+T +L+ 
Sbjct: 117 FYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMK 176

Query: 195 LLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELPDGRVIKVG 254
           +LS RGY+F+ +A+ E VR IKEKLCYV+ D + + + A +++ + ++YELPDG+VI +G
Sbjct: 177 ILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELPDGQVITIG 236

Query: 255 SERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPS 314
           +ERF APE LF PSL+ +E  G+ +  +N++   DVDVR  LY  +V+SGG++M+PG+  
Sbjct: 237 NERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 296

Query: 315 RLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLTK 374
           R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LA++   +  MW++K
Sbjct: 297 RMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTFQ-QMWISK 344

Query: 375 QEWQEMGPA 383
           QE+ E GP+
Sbjct: 345 QEYDESGPS 353

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score =  280 bits (715), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 152/386 (39%), Positives = 228/386 (59%), Gaps = 17/386 (4%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDV 63
           + PIVLD G+G +K G +GE  P     S++G P         +     +  IG++A ++
Sbjct: 9   NQPIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLE---GEQFIGNQAQEL 65

Query: 64  RSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMC 123
           R  L++ YP+E+GI+KNW+DMEL+W++ F++ ++L +     VL TE P+NPL+NRE MC
Sbjct: 66  RGLLKLRYPLEHGIVKNWSDMELIWNHVFHKSLQLNNIEEHPVLATEAPLNPLKNREAMC 125

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDV 183
           E++FE ++   VYV+IQAVL+LYA G              H VPV++   L    +R+DV
Sbjct: 126 EMLFETFNVPAVYVSIQAVLSLYASGRTTGCVLDCGDGCCHSVPVFDGFSLPSSIRRIDV 185

Query: 184 AGRDVTRHLIDLLSR-RGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVEN 242
           AGRDVT  L  LL +  G +   S++ E VR IKEK CYV+ D  L  +     T     
Sbjct: 186 AGRDVTEFLQLLLRKTTGVSLLSSSEREIVRIIKEKACYVARD-PLTEEQTYHLTPTSTI 244

Query: 243 YELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVL 302
           ++LPDG+V+ + +E+F APE LFQP L+  E   + EM   ++   D+D+R AL   +VL
Sbjct: 245 FKLPDGKVLDLKNEKFRAPEVLFQPQLIGSEFESIPEMCHQSISKVDLDLRPALLSNIVL 304

Query: 303 SGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLAN 362
           SGG++M+PG   RL  EL+ L       ++P    + K++I  PP RK+  +IGG++L+ 
Sbjct: 305 SGGTTMFPGFGDRLLTELRNL-------SEP----QTKIKIFAPPERKYSTWIGGSILSG 353

Query: 363 IMADKDHMWLTKQEWQEMGPAAMSKF 388
           +   K  +W+TK EWQE      S+F
Sbjct: 354 LSTFKK-IWVTKSEWQENPDCVHSRF 378

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score =  271 bits (693), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 142/386 (36%), Positives = 224/386 (58%), Gaps = 17/386 (4%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDV 63
           + P+VLD G+G +K G +GE  P     S++G           +     D  IG++A ++
Sbjct: 35  NQPVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEG---DTFIGNQAQEL 91

Query: 64  RSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMC 123
           R  L++ YP+++GI+ NWADME +W Y F + ++L +      L+TE P+NP +NRE+MC
Sbjct: 92  RGLLKLRYPLQHGIVTNWADMEQVWGYVFNKSLQLQNVEDHPNLVTEAPLNPHKNREKMC 151

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDV 183
           E++FE ++   +YV++QAVL+LYA G              H VPV++   +    +R+D+
Sbjct: 152 ELLFESFNVPALYVSVQAVLSLYASGRTTGCVVDCGDGCCHAVPVFDGFSVPSSIRRIDI 211

Query: 184 AGRDVTRHLIDLLSR-RGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVEN 242
           AGRD+T  L  LL +  G +   S++ E VR IKEK C+V+ D  L+ +      +    
Sbjct: 212 AGRDITEFLQLLLRKTTGVSLLSSSEREIVRTIKEKACFVTKDPKLEEQNFPMNPSF-SK 270

Query: 243 YELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVL 302
           ++LPDG+ I++G ER+ APE LFQP L+  E   + +M + ++   D+D+R+ LY  ++L
Sbjct: 271 FKLPDGKTIELGQERYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLYSNILL 330

Query: 303 SGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLAN 362
           SGG+SM PG   RL KELK L  +R            K++I  PP RK+  +IGG++L+ 
Sbjct: 331 SGGTSMLPGFGDRLLKELKSLSGSRT-----------KIKIFAPPERKYSTWIGGSILSG 379

Query: 363 IMADKDHMWLTKQEWQEMGPAAMSKF 388
           +   K  +W+TK EW+E      S+F
Sbjct: 380 LSTFKK-LWVTKSEWEEFPDCIHSRF 404

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score =  268 bits (685), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 142/389 (36%), Positives = 226/389 (58%), Gaps = 23/389 (5%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDV 63
           + PIVLD G+G +K G +GE  P     S++G           +     D  IG++A ++
Sbjct: 7   NQPIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEG---DTFIGNQAQEL 63

Query: 64  RSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMC 123
           R  L++ +P+E+GI+KNW+DME +W Y F + ++L +     +L+TE P+NP  NRE+MC
Sbjct: 64  RGLLKLRHPVEHGIVKNWSDMEHIWSYVFNKSLQLQNVEDHPILITEAPLNPRNNRERMC 123

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDV 183
           E++FE ++   +YV+IQAVL+LYA G              H VPV++   +    +R+D+
Sbjct: 124 ELLFESFNVPALYVSIQAVLSLYASGRTTGCVVDCGDGCCHAVPVFDGFSIPSSIRRIDI 183

Query: 184 AGRDVTRHLIDLLSR-RGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVEN 242
           AGRD+T  L  LL +  G +   S++ E VR IKEK CYV+ D  ++     +  ++  N
Sbjct: 184 AGRDITEFLQLLLRKTTGVSLLSSSEREVVRIIKEKACYVAKDPHIE----EQNFSINPN 239

Query: 243 Y---ELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRA 299
           Y   +LPDG+ I +G E+F APE LFQP L+  E   + +M + +++  D+D+R+ L+  
Sbjct: 240 YTKFKLPDGKTIDLGQEKFRAPEILFQPELIGSEFESLPDMCYQSIEKVDLDLRSLLFSN 299

Query: 300 VVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAV 359
           V+LSGG+S+ PG   RL  ELK L  ++            K++I  PP RK+  +IGG++
Sbjct: 300 VLLSGGTSILPGFGDRLLSELKSLSDSQT-----------KIKIFAPPERKYSTWIGGSI 348

Query: 360 LANIMADKDHMWLTKQEWQEMGPAAMSKF 388
           L+ +   K  +W+T+ EW+E      S+F
Sbjct: 349 LSGLSTFK-KLWVTRAEWEEAADCIHSRF 376

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score =  265 bits (676), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 126/290 (43%), Positives = 188/290 (64%), Gaps = 4/290 (1%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVM 126
           L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE PMNP  NRE+M ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    + H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELP 246
           D+T +L+ +LS RGY+F+ +A+ E VR IKEKLCYV+ D + + + A +++++ ++YELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTAL 296
           DG+VI +G+ERF APE LF PS++ +E  G+ +  +N++   DVDVR  L
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKEL 293

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score =  265 bits (676), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 141/388 (36%), Positives = 229/388 (59%), Gaps = 17/388 (4%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDV 63
           + P+VLD G+G +K G +GE  P     S++G P         + +  +  +IG+EA  +
Sbjct: 9   NQPVVLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKYNKVMAGGLASDSQ--LIGNEAQKM 66

Query: 64  RSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMC 123
           R  L++ YP+E+G++++W  +E LW + FY  +KL +     +L+TE P+NP++NR +MC
Sbjct: 67  RGLLKLHYPLEHGVVQDWPGLEQLWTHVFYNSLKLANIEEHPMLITEAPLNPMKNRNKMC 126

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDV 183
           E++FE +    VYV+IQAVLALYA G                VPVY+   L    +R+DV
Sbjct: 127 EMLFETFGSPAVYVSIQAVLALYAGGRTTGCVIDCGDGCCQSVPVYDGFTLPSAIQRIDV 186

Query: 184 AGRDVTRHLIDLLSR-RGYAFNRSADFETVRQIKEKLCYVSYDLDLDTK--LARETTTLV 240
           AGRD+T  L  LL +  G   + S++ E VR IKEK C+V+ D+  + +      +  L 
Sbjct: 187 AGRDITEFLQLLLRKSSGVTLSSSSEREIVRMIKEKACFVATDVGNEEQNYEGANSAELE 246

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300
             ++LPDG+++ +G+E+F APE LFQP L+  E   + EM   ++   D+D+R++LY ++
Sbjct: 247 TRFKLPDGKILTLGAEKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLDLRSSLYSSI 306

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGS+M+ G   RL  E+++        ++P+     K++I  PP RK+  +IGG++L
Sbjct: 307 VLSGGSTMFSGFGDRLLSEIRK-------TSEPNT----KIKIFAPPERKYSTWIGGSIL 355

Query: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKF 388
           A  ++  + +W+T+ EWQE      S+F
Sbjct: 356 AG-LSTFEKLWVTRAEWQENPQCIHSRF 382

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score =  261 bits (667), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 143/390 (36%), Positives = 228/390 (58%), Gaps = 25/390 (6%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDV 63
           + PIVLD G+G +K G  GE+ P     S+VG P               +  +G++A ++
Sbjct: 10  NQPIVLDNGSGLIKAGFGGEDKPKCYEHSLVGIPKYSKVMAGRFDG---NTFVGNQAQEI 66

Query: 64  RSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMC 123
           R  L++ +P+E+G++ +W  +E LW + F + ++L S     VL+TE P+NP +NREQMC
Sbjct: 67  RGLLKLRHPLEHGVVTDWNALEQLWGHVFEKGLQLSSLQDHPVLVTEAPLNPKKNREQMC 126

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDV 183
           E++FE +    VYV+IQAVL+LYA G             +H VPVY+   L    +R+D+
Sbjct: 127 ELLFETFSVPAVYVSIQAVLSLYASGRTTGCVLDSGDGCSHAVPVYDGYTLPSAIRRIDI 186

Query: 184 AGRDVTRHLIDLLSRR--GYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVE 241
           AGRD++  L+ +L R+  G +   S++ E VR IKEK CY++    LD K   +  T+  
Sbjct: 187 AGRDIS-ELLQVLIRKSTGVSLLSSSEREIVRIIKEKACYIA----LDPKEEEKNYTMHG 241

Query: 242 N---YELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYR 298
               + LPDG+ I++ +E+F APE LF P L+  E   + E+L+ ++Q  D+D+RT+L+ 
Sbjct: 242 KQTMFRLPDGKQIELDNEKFRAPEILFNPQLIGSEFQSLPEILYESIQKVDLDLRTSLFS 301

Query: 299 AVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGA 358
            +V SGG++M PG   R+ KELK       L  +P    + K++I  PP RK+  +IGG+
Sbjct: 302 NIVFSGGTTMIPGFGDRVLKELK-------LSCEP----QTKIKIFAPPERKYSTWIGGS 350

Query: 359 VLANIMADKDHMWLTKQEWQEMGPAAMSKF 388
           +L+ +   K  +W+TK+EW+E      ++F
Sbjct: 351 ILSGLSTFK-KIWVTKKEWEENPRCVHARF 379

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score =  252 bits (643), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 142/388 (36%), Positives = 232/388 (59%), Gaps = 17/388 (4%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDV 63
           + P+VLD G+G +K G +GE  P     S++G P         +++  +  ++G+EA   
Sbjct: 9   NQPVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSS--RGQLVGNEAQKQ 66

Query: 64  RSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMC 123
           R  L++ YP+E+GI+++W+ +E LW + FY  +KL +     +L+TE P+NPL NR++MC
Sbjct: 67  RGLLRLQYPVEHGIVQDWSGLEQLWTHVFYSSLKLNNIGDHPMLVTEAPLNPLENRDKMC 126

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDV 183
           E+++E ++   VYV+IQAVLALYA G                VPVY+   +    +R+DV
Sbjct: 127 EMLYETFNVPAVYVSIQAVLALYAGGRTTGCVIDCGDGCCQSVPVYDGFSIPSAIRRIDV 186

Query: 184 AGRDVTRHLIDLLSRR-GYAFNRSADFETVRQIKEKLCYVSYDLDLDTK--LARETTTLV 240
           AGRDVT  L  LL +  G     S++ E VR IKEK CYV+ ++  + +   +   +  +
Sbjct: 187 AGRDVTEFLQLLLRKSIGVTLLSSSEREIVRMIKEKACYVAPEVAAEEQKYASSRGSEEL 246

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300
             ++LPDG+++ +G+E+F APE LFQP L+  E   + +M F ++   D+D+R++LY ++
Sbjct: 247 TKFKLPDGKILSLGAEKFRAPEILFQPQLIGSEFNSIQDMCFQSISKVDLDLRSSLYSSL 306

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGS+++ G   RL  EL+        R +P+     K++I  PP RK+ V+IGG++L
Sbjct: 307 VLSGGSTLFAGFGDRLLNELRS-------RCEPN----VKIKIFAPPERKYSVWIGGSIL 355

Query: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKF 388
           A  ++  + +W+T+ EWQE      S+F
Sbjct: 356 AG-LSTFEKIWVTRSEWQENPQCVHSRF 382

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score =  251 bits (642), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 143/397 (36%), Positives = 225/397 (56%), Gaps = 25/397 (6%)

Query: 1   MDPHT-----PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKD-I 54
           +DP+      P+VLD G+  +K G +GE+ P +   SIVG P         +    KD  
Sbjct: 2   LDPNAVLYSQPVVLDNGSAILKAGYSGEDRPKFLEHSIVGSP-----RHGYVNDSSKDDT 56

Query: 55  MIGDEASDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMN 114
            +G+ A + RS LQ+ +P+++G++KNW DMEL+WDY F +++KL       VL+TE P+N
Sbjct: 57  FVGNLAQERRSILQLRHPVDHGVVKNWNDMELIWDYMFKDKLKLKDVDEHPVLITEAPLN 116

Query: 115 PLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 174
           P+ NR++MC+++FE +    +YVA  AVL+LYA G             +  VPVY+   L
Sbjct: 117 PVSNRDEMCDLLFESFGVQALYVANPAVLSLYASGKISGCVLDCGDGYSCSVPVYQGYTL 176

Query: 175 SHLTKRLDVAGRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDL-DTKL 232
               KR+D+ GRD+T  L + L    G +   S + E VR IKEK CYV+ DLD+ + K 
Sbjct: 177 KSAIKRIDLGGRDLTEQLQLQLRKSTGLSLTTSGEMELVRMIKEKSCYVAVDLDIEEEKC 236

Query: 233 ARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDV 292
             E   +   ++LPDG+ I +  +RF+ PE LFQPS++  E   + E+++ +V   D D+
Sbjct: 237 NYEGDQVGLKFKLPDGKFITLSKDRFQVPEILFQPSVISSEVSSIPEIIWQSVSKLDTDL 296

Query: 293 RTALYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHM 352
           R  ++  ++LSGG++M  G  +RL +EL +L              + +V+I  PP RK+ 
Sbjct: 297 RPQMWSDILLSGGTTMLKGFGNRLVQELDKL-----------NQAQSRVKIWAPPERKYT 345

Query: 353 VFIGGAVLANIMADKDHMWLTKQEWQEMGPAAMSKFG 389
            +IGG++LA  ++    + +TK +WQE      +K G
Sbjct: 346 SWIGGSILAE-LSTFQKIIVTKSQWQEDPSIIHTKCG 381

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score =  249 bits (637), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 133/381 (34%), Positives = 211/381 (55%), Gaps = 20/381 (5%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKD---IMIGDEA 60
           + P+VLD G+  +K G +G+N P     +++G P     E+  +T  + +     IG+ A
Sbjct: 8   NQPVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTP---KYEKVMLTNAISNNDLTYIGNRA 64

Query: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120
              R  L++ +PM  GI++NW DME LW + F + +K+       +L+TE P+NP +NR+
Sbjct: 65  QKSRGLLRLRHPMNRGIVENWDDMETLWSHTFNDILKINDFDEHPLLITEAPLNPEKNRD 124

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKR 180
           +MCEV FEK+DF  VY+A  + L+LYA G                VP+YE   L    +R
Sbjct: 125 KMCEVFFEKFDFAAVYIANPSTLSLYASGRTTGCVLDCGDGYCSSVPIYEGFALPSSIRR 184

Query: 181 LDVAGRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTL 239
           +DV GRDVT  L   +    G +   S++ E V+ +KEK CYVS D   D  ++      
Sbjct: 185 IDVGGRDVTEQLQFQIRKYTGISLYSSSEHEIVKNVKEKACYVSTDFAHDEDMSNLNPEK 244

Query: 240 VE-NYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYR 298
           +   ++LPDG+ + +   RF APE LF+P ++ +E   V +M F ++   D+++R  L+ 
Sbjct: 245 IRCQFKLPDGKDLILDKARFRAPEILFRPQIMGLEYDSVSDMCFESISKVDLELRPKLFS 304

Query: 299 AVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGA 358
           +++L+GGS+M+ G   RL KEL+       +R     L    ++I  PP RK+  +IGG+
Sbjct: 305 SIILNGGSTMFRGFGDRLLKELQ-------IRTGNKNL----IKIIAPPERKYTSWIGGS 353

Query: 359 VLANIMADKDHMWLTKQEWQE 379
           +L  +   K  +W+TK EWQE
Sbjct: 354 ILTGLSTFK-QLWMTKAEWQE 373

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score =  244 bits (622), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 212/386 (54%), Gaps = 16/386 (4%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDV 63
           + PIV+D GT  +K G  GE  P     SIVG P  + ++         D  IG++A   
Sbjct: 12  NQPIVIDNGTNVIKGGFTGETKPRCLEYSIVGTP--KYDKIMQSNGIESDSFIGNKAQKY 69

Query: 64  RSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMC 123
           R  L++ +PM  G+++NW DME +W Y F + + L + +   +L+TEPP+N + NR++MC
Sbjct: 70  RGILKLRHPMLRGVVQNWDDMETIWQYVFDDTLYLENLNEHPILITEPPLNNMANRQKMC 129

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDV 183
           E +FE + F  VY+++  VL+LYA G                +PVY    L+   K++D+
Sbjct: 130 EALFEIFGFPAVYISVSPVLSLYASGQTTGCAVDCGDGYCTSIPVYNGFSLASSVKKIDI 189

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDT-KLARETTTLVE 241
            G D+T  L   +L   G     S++ E VR IKEK+CY++ D +L+T K       +  
Sbjct: 190 GGCDITEQLQFSILKNTGLFMYSSSEREIVRTIKEKVCYIATDYNLETEKYLFNEEKMAS 249

Query: 242 NYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVV 301
            ++LPDG+++ +   ++ + E LF+P L+  E   + E+ + +++  D D+R  LY  +V
Sbjct: 250 QFKLPDGKMLNISQGKYTSTEILFRPELIGSEFDSLPEICYQSIKKVDSDLRLPLYSNIV 309

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++M PG  SRL KEL+ L          +  D  K+RI  PP RK+  +IGG++L+
Sbjct: 310 LSGGTTMCPGFGSRLLKELQTL----------TGYDT-KIRIIAPPERKYTSWIGGSILS 358

Query: 362 NIMADKDHMWLTKQEWQEMGPAAMSK 387
             ++    +W+TK  W+E      SK
Sbjct: 359 G-LSTFSKIWVTKSMWEEDNKIIHSK 383

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score =  243 bits (620), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 133/379 (35%), Positives = 212/379 (55%), Gaps = 21/379 (5%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDV 63
           + PIVLD G+  +K G  G++ P     S++G P     ++  +    K   +G+ A + 
Sbjct: 11  NQPIVLDNGSALLKAGFGGDDKPKCFEYSLIGTP---KYDKVMVGGVEKGKFVGNLAQEY 67

Query: 64  RSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMC 123
           R  L++ YPM++GII+NW  ME +WD+ F + +K+ +     +++TE P+NP  NRE+MC
Sbjct: 68  RGLLKLRYPMDHGIIENWEHMETVWDHIFKDCLKVSNLGEHPLVVTEAPLNPKPNREKMC 127

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDV 183
           E +FE ++   +Y+A  AVL+LYA G                VP+YE   L+   +R+D+
Sbjct: 128 ETLFESFNIPALYIANPAVLSLYASGRTTGCVVEAGDGYCSSVPIYEGFALTPSIRRIDI 187

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTK---LARETTTL 239
            GRD+T+HL + L    G     S++ E VR IKE  CY+  +   + +   L +E  ++
Sbjct: 188 GGRDITKHLQLQLRKSTGMWLYSSSEQEIVRLIKENGCYICSNHKKEEEKFLLDQEKKSI 247

Query: 240 VENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRA 299
             +++LPDG+ + +G  RF APE LF P L+  E   + +M+  ++   D+D+R+ L   
Sbjct: 248 --SFKLPDGKNLVIGPGRFRAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDLRSKLLNN 305

Query: 300 VVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAV 359
           + LSGGS+M+ G   RL  EL           D S     KVRI  PP RK+  FIGG++
Sbjct: 306 ITLSGGSTMFQGFCDRLITEL-----------DFSVDKTTKVRILAPPERKYSAFIGGSI 354

Query: 360 LANIMADKDHMWLTKQEWQ 378
           LAN+   ++ MW+TK +W+
Sbjct: 355 LANLSTFRN-MWVTKDQWE 372

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score =  233 bits (595), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 123/378 (32%), Positives = 205/378 (54%), Gaps = 17/378 (4%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDV 63
           + P+V+D G+G +K G +GE  P      +VG       ++  +     D  IG+ A  +
Sbjct: 12  NQPVVIDNGSGIIKAGFSGEERPKALEYCLVGNT---KYDKVMLEGLQGDTFIGNNAQKL 68

Query: 64  RSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMC 123
           R  L++ YP+++G++++W  MEL+W Y   E ++L +     +L+TE PMNPL+NREQM 
Sbjct: 69  RGLLKLRYPIKHGVVEDWDSMELIWSYVLNEVLQLQNIGEHPLLITEAPMNPLKNREQMA 128

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDV 183
           +V+FE +D   +YV+  AVL+LYA G                VP+Y+   L     R+D+
Sbjct: 129 QVLFETFDVSALYVSNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALPASMMRMDI 188

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDL-DTKLARETTTLVE 241
            G D+T  L   L    G +   S++ E VR +KEK+CY++ ++   + K  + T  L+ 
Sbjct: 189 GGADITEQLQFQLRKSAGVSLFSSSEREIVRTMKEKVCYLAKNIKKEEEKYLQGTQDLIS 248

Query: 242 NYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVV 301
            ++LPDGR I+VG++R+ APE LF P ++ +   G+ +M   ++   D+D+R  L  +++
Sbjct: 249 TFKLPDGRCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSII 308

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++   G   R+      LW    L    S     K++I  P  RK+  +IGG++L 
Sbjct: 309 LSGGTTTLKGFGDRM------LWDLEALTKGTS-----KIKIIAPSERKYTTWIGGSILT 357

Query: 362 NIMADKDHMWLTKQEWQE 379
             ++    +W  K +W E
Sbjct: 358 G-LSTFQRLWTKKSDWLE 374

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score =  233 bits (594), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 122/378 (32%), Positives = 210/378 (55%), Gaps = 17/378 (4%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDV 63
           + PIV+D G+G +K G +GE  P     S+VG       ++  +     D  +G++A  +
Sbjct: 12  NQPIVIDNGSGIIKAGFSGEEKPKSLEYSLVGHA---KYDKVMLEGLQGDTFVGNKAQRL 68

Query: 64  RSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMC 123
           R  L++ YP+E+G++++W  MEL+W +   E ++L +     +L+TE PMNPL+NRE M 
Sbjct: 69  RGLLRLQYPIEHGVVEDWDSMELIWAHILNEVLQLQNIEEHPLLITEAPMNPLKNREVMA 128

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDV 183
           +V+FE ++   +YV+  AVL+LYA G                VP+Y+   L     R+D+
Sbjct: 129 QVLFETFNLPALYVSNPAVLSLYASGRTTGCVIDCGEGYCSTVPIYDGFALPASMMRMDI 188

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDL-DTKLARETTTLVE 241
            GRD+T+ L   L    G +   S++ E VR IKEK+CY++ D+   +    +E+  L  
Sbjct: 189 GGRDITKQLQFQLRKSAGVSLFSSSEREIVRTIKEKVCYLATDIKKEENTYMQESQDLTS 248

Query: 242 NYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVV 301
            ++LPDG+ I++G++R+ APE LF P ++     G+ +M   ++   D+D+RT L  +++
Sbjct: 249 VFKLPDGKCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRTTLLSSII 308

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++   G   R+  +L+   FT+            K++I  PP RK+  ++GG++L 
Sbjct: 309 LSGGTTTLRGFGDRMLHDLEA--FTK---------GTSKIKIIAPPERKYTTWVGGSILT 357

Query: 362 NIMADKDHMWLTKQEWQE 379
             ++    +W  K +W E
Sbjct: 358 G-LSTFQRLWTKKSDWLE 374

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score =  230 bits (586), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 123/378 (32%), Positives = 204/378 (53%), Gaps = 17/378 (4%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDV 63
           + PIV+D G+G +K G +GE  P     S+VG       ++  +     D  +G++A  +
Sbjct: 12  NQPIVIDNGSGIIKAGFSGEERPKALEYSLVGHT---KYDKVMLEGLQGDTFVGNKAQKL 68

Query: 64  RSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMC 123
           R  L++ YPM++G++++W  MEL+W Y   E ++L +     +L+TE PMNPL+NRE + 
Sbjct: 69  RGLLRLRYPMKHGVVEDWDSMELIWSYVLNEVLQLQNIEEHPLLITEAPMNPLKNREMIA 128

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDV 183
           +VMFE ++   +YV+  AVL+LYA G                VP+Y+   L     R+D+
Sbjct: 129 QVMFETFNLSAIYVSDPAVLSLYASGRTTGCVVDCGEGYCSSVPIYDGFALPASIMRMDI 188

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDT-KLARETTTLVE 241
            G D+T  L   +    G +   S++ E VR IKEK+CY++ D   +  K  + T  L+ 
Sbjct: 189 GGGDITEQLQFQIRKSAGVSLFSSSEREIVRTIKEKVCYLAKDAKKEEDKYLQGTQDLIS 248

Query: 242 NYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVV 301
            ++LPDG+ I+VG++R+ APE LF P ++     G+  M   ++   D+D+R  L  +V+
Sbjct: 249 AFKLPDGKSIEVGNDRYRAPEILFSPQIIGSGYDGLSNMCMQSIWKVDLDLRKNLLSSVI 308

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++   G   R+  +L+ L                K++I  PP RK+  +IGG++L 
Sbjct: 309 LSGGTTTLKGFGDRMLHDLEAL-----------TKGTSKIKIIAPPERKYTAWIGGSILT 357

Query: 362 NIMADKDHMWLTKQEWQE 379
             ++    +W  K +W E
Sbjct: 358 G-LSTFQKLWTKKSDWLE 374

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score =  229 bits (584), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 126/385 (32%), Positives = 212/385 (55%), Gaps = 17/385 (4%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRS 65
           P+V+D GTG +K+G  G++ P     +IVG P     ++  I     ++ IG++A + R 
Sbjct: 10  PVVIDNGTGVLKVGFVGDDKPKCFQHNIVGTPKF---DKVMIGGLDDNMYIGNKAQENRG 66

Query: 66  YLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEV 125
            L++ +PME+G +K+W +ME +W +     + +       +L+TE P+N  +NRE MCE+
Sbjct: 67  LLRLRHPMEHGEVKHWDEMEAVWKHTLLHDLNIQHIEEHPILITEAPLNSSKNREHMCEI 126

Query: 126 MFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAG 185
           +FE ++   ++V   AVLALY+ G                VP+YE   L+   +R+D+ G
Sbjct: 127 LFESFNIPAIHVENPAVLALYSGGRTTGCVIDCGEGYCSAVPIYEGFALTPSIRRIDIGG 186

Query: 186 RDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDT-KLARETTTLVENY 243
           R++T  L   +    G +   S + E VR IKE+ CYV+ D+  +  K   ++ +    +
Sbjct: 187 REITEQLQFQIRKSVGMSLFSSNEKEIVRTIKERACYVADDISKEEHKYILDSESNSSKF 246

Query: 244 ELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLS 303
           +LPDG+ + +G+ RF A E LF P L+  E   V E++F T+   D+D+R  LY+++VL+
Sbjct: 247 KLPDGKSLSIGNVRFRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKSLVLN 306

Query: 304 GGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANI 363
           GG+++ PG  +R+ KEL+ L          ++ D  K+RI   P RK+  +IGG++LA  
Sbjct: 307 GGTTVLPGFGNRILKELQIL----------TKQDT-KLRIIASPERKYTTWIGGSILAG- 354

Query: 364 MADKDHMWLTKQEWQEMGPAAMSKF 388
           ++    + +TK  W E      S F
Sbjct: 355 LSTFQKILVTKSNWNEDRSRVYSSF 379

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score =  228 bits (582), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 119/378 (31%), Positives = 205/378 (54%), Gaps = 17/378 (4%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDV 63
           + PIV+D G+G +K+G +GE  P     S+VG       E+  +     D  +G++A  +
Sbjct: 12  NQPIVIDNGSGIIKVGFSGEERPKALEYSLVGHV---KYEKVMLEGLQGDTFVGNKAQKL 68

Query: 64  RSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMC 123
           R  L++ YPM +G++++W  MEL+W Y   E ++L +     +L+TE PMNPL+NRE M 
Sbjct: 69  RGLLRLRYPMTHGVVEDWDSMELIWSYMLNEVLQLQNIEEHPLLITEAPMNPLKNREVMA 128

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDV 183
           +V+FE ++   +Y++  AVL+LYA G                VP+Y+   L     R+D+
Sbjct: 129 QVLFETFNLPALYISNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALPASIMRMDI 188

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDT-KLARETTTLVE 241
            GRD+T  L   L    G +   S++ E VR IKEK+CY++ ++  +  +  +    L  
Sbjct: 189 GGRDITEQLQFQLRKSAGISLFSSSELEVVRMIKEKVCYLAKNIKKEEDRYLQGHHDLGS 248

Query: 242 NYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVV 301
            ++LPDG+ I++G++R+ APE LF P ++     G+ +M   ++   D+D+R  L  +++
Sbjct: 249 VFKLPDGKCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRKTLLSSII 308

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++   G   R+  +L+ L                K++I  PP RK+  ++GG++L 
Sbjct: 309 LSGGTTTLRGFGERMLHDLEAL-----------SKGTCKIKIIAPPERKYTTWVGGSILT 357

Query: 362 NIMADKDHMWLTKQEWQE 379
             ++    +W  K +W E
Sbjct: 358 G-LSTFQKLWTKKSDWLE 374

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score =  226 bits (576), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 130/379 (34%), Positives = 202/379 (53%), Gaps = 19/379 (5%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLK-DIMIGDEASD 62
           + P+V+D G+  VK G  GE  P     S++G     A     +   L+ D  +G++A  
Sbjct: 9   NQPVVIDNGSAVVKAGFCGEEKPRCMEYSLIGD----ANYNKIMVGGLECDSFVGNKAQR 64

Query: 63  VRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQM 122
           +R  L++ +PME G++ +W DMELLW +  ++ ++L S     +L+TE P+NP  N+E+M
Sbjct: 65  LRGLLKLKHPMERGVVSDWDDMELLWSHILFDSLQLTSGMEHPLLITEAPLNPESNKEKM 124

Query: 123 CEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLD 182
            EV FE ++   + V+I  VL+LYA G                VPV E   L+   KR++
Sbjct: 125 LEVFFETFNIPAICVSIPGVLSLYASGRTTGCVVDCGEGYCSSVPVCEGYTLASSIKRIN 184

Query: 183 VAGRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLCYVSYD-LDLDTKLARETTTLV 240
           + G DVT+ L   L    G     S + E VR +KEK CYVS + L  + K   E   + 
Sbjct: 185 LGGIDVTKQLQFQLRKESGVWLFSSGERELVRTMKEKSCYVSLNQLKDEEKFTFEPGKMN 244

Query: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300
            N++LPDG ++ +   RF APE LFQP ++  E+P + EM   ++ + DV++R  L   +
Sbjct: 245 TNFKLPDGNMLTLSKSRFRAPEILFQPQIIASEEPSLPEMCLQSILSVDVELRPRLMSRI 304

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
            LSGG++M+ G   R  +EL+            S   K  +RI  PP RK+  +IGG++L
Sbjct: 305 TLSGGTTMFRGFGDRFLQELQ-----------ISTCKKSNIRILAPPERKYTAWIGGSML 353

Query: 361 ANIMADKDHMWLTKQEWQE 379
           A +   +  M  TK +W+E
Sbjct: 354 AGLTTFR-KMLTTKSDWRE 371

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score =  223 bits (567), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 123/384 (32%), Positives = 210/384 (54%), Gaps = 27/384 (7%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDI--MIGDEAS 61
           + PIV+D G+  +K G + ++ P     ++ G P     ++  IT  L+++   IG+ A 
Sbjct: 9   NQPIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMP---KYDKIMITGQLENLDKYIGNRAQ 65

Query: 62  DVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQ 121
            +R  L++ +PM  G++ NW DMELLW + F + + + +     +L+TE P+   + R  
Sbjct: 66  SIRGLLRLQHPMNRGVVDNWDDMELLWWHIFNDTLNVQNIEEHPLLITEAPLTIEKQRHI 125

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRL 181
           MCE +FE ++   +YVA  +VL+LYA G                 P+YE  VL    +++
Sbjct: 126 MCERLFETFNIPSLYVANPSVLSLYASGNTTGCVVDCGDGYCSSTPIYEGFVLPASIRKM 185

Query: 182 DVAGRDVTRHL-IDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           +V GRD+T HL   +    G +   S + E VR IKEK+CY+S D +     + E+  L 
Sbjct: 186 EVGGRDITEHLQFQIRKSSGISLYSSNEKEIVRTIKEKVCYISEDFN----KSEESYYLR 241

Query: 241 EN-----YELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTA 295
           ++     ++LPDG+ + +  ERF +PE LF P L+ +E   V  M F ++   D+++R  
Sbjct: 242 QDEMSCKFKLPDGKELTLNKERFRSPEVLFNPQLMGLENENVSAMCFESISKVDLELRPK 301

Query: 296 LYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFI 355
           L+  ++L+GGS+++ G  SRL  +L++L   R            K++I  PP RK+  +I
Sbjct: 302 LFSNILLTGGSTLFKGFGSRLLGDLQELTNNRA-----------KIKILAPPERKYTSWI 350

Query: 356 GGAVLANIMADKDHMWLTKQEWQE 379
           GG++L  +   K+ +W+TK +W+E
Sbjct: 351 GGSILTGLSTFKN-LWVTKSDWEE 373

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score =  209 bits (533), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 128/395 (32%), Positives = 209/395 (52%), Gaps = 29/395 (7%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKD-IMIGDEASD 62
           + P+VLD G+  +K G +G+  P     ++ G+P      +  +TT L+D   +G+EA  
Sbjct: 11  NQPVVLDNGSAILKAGFSGDETPAILEYTMAGKP----RYKKVMTTGLEDRTFVGNEAQR 66

Query: 63  VRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSG----GKVLLTEPPMNPLRN 118
           +R  L +  P+  G + NW DMELLW + FY +++L   +       +L+TE P+N  +N
Sbjct: 67  LRGLLALRRPISRGEVTNWDDMELLWSHIFYSKLQLGQGNSQIGDHPLLITEAPLNSTKN 126

Query: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLT 178
           RE MCE+++E ++F  +YVA  AVL+LYA G             +   PVY+   L    
Sbjct: 127 RETMCEILYETFNFDALYVAHPAVLSLYATGQTTGCVLECGEGYSASTPVYQGFALPSSI 186

Query: 179 KRLDVAGRDVTRHLIDLLSRR-GYAFNRSADFETVRQIKEKLCYVSYDLDLDTKL----A 233
           +R+D+ GRD+T+ L   + +  G +   +++ E VR IKEK  YV+ D   + +      
Sbjct: 187 RRIDIGGRDITQELQFYIRKSTGLSLFSNSEQEIVRTIKEKANYVALDYKFEEEKFFIHE 246

Query: 234 RETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVR 293
           RE T+ V+   LPDG+ +  G  ++   E LFQP L+  E   V EML  ++   D+D+R
Sbjct: 247 RENTSTVK---LPDGQELTFGKGKYRTSEILFQPQLIGSECVSVPEMLLESINKVDMDLR 303

Query: 294 TALYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMV 353
           T L   +VLSGG++M  G   R   E K++         P      KV+I     R ++ 
Sbjct: 304 TQLLENIVLSGGTTMLKGFDQRTMSETKKML--------PKHT---KVKIRSLAERSYIA 352

Query: 354 FIGGAVLANIMADKDHMWLTKQEWQEMGPAAMSKF 388
           +IGG++L+ +   ++ +WLT++ ++E       KF
Sbjct: 353 WIGGSILSGLYGFRN-LWLTREMYEEDPSMVHRKF 386

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score =  184 bits (467), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 110/380 (28%), Positives = 187/380 (49%), Gaps = 20/380 (5%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDV 63
           + P++LD G+  +K G AG   PD    + +G P+    ER+ +T   K+  IG+ A + 
Sbjct: 10  NQPVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPL---AERSMVTVSNKETYIGNSAYER 66

Query: 64  RSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMC 123
           R+ L +  P     I +W  +E LWDY    ++++       V+LT       +  E+MC
Sbjct: 67  RATLHLESPYSTNAIMSWDRLEDLWDYVLLNKLEIEQLQEHPVVLTNSMSTSKKEEEKMC 126

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDV 183
           EV+FEK+    +Y +   +++LY  G               I  V + +++   ++  + 
Sbjct: 127 EVLFEKFSIPAIYCSRDPIMSLYGLGRTTGCSVSCGHRGIGITTVIDGMIVGGSSQISNT 186

Query: 184 AGRDVTRHLIDLLSRRGYAF-NRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVEN 242
            G  VT  ++DLL        N     E +R IKE+ C +S D   + +     T+   N
Sbjct: 187 GGSAVTNTMLDLLRHNHPKLENGQNGIELIRSIKERCCVLSKDFYNEIRAYELITSKTSN 246

Query: 243 --YELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300
             Y LPDG +I++GSERFEAPE +F P      +  + +M+ N++  A +  R+ L  ++
Sbjct: 247 NKYRLPDGNIIEIGSERFEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILPRSQLLESI 306

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLD-KFKVRIEDPPRRKHMVFIGGAV 359
           VLSGGSS+  G   RL KE+++             +D   K+ +  P  R+ + +IGG+V
Sbjct: 307 VLSGGSSLIKGFGERLTKEIRK------------EIDGNQKIMLNAPHERRFLPWIGGSV 354

Query: 360 LANIMADKDHMWLTKQEWQE 379
           L+ +   K  +W +K  ++E
Sbjct: 355 LSGLSTMK-LLWKSKSAYRE 373

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score =  177 bits (449), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 134/446 (30%), Positives = 211/446 (47%), Gaps = 71/446 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASIT-------------- 48
           +V+D GTG  K+G AG + P + FP+ +    G      + +A  T              
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWIFPTAIATSQGTATGSNKNKAQATGGSNAGGSNPYFGN 68

Query: 49  -------------------------TPLKDIMIGDEA---SDVRSYLQISYPMENGIIKN 80
                                    T   D  IG+EA   S   SY  +SYP+ +G ++N
Sbjct: 69  STSATSFNNLSSQMLMSNNLAGKRGTEDLDFYIGNEALIASQGASY-SLSYPIRHGQVEN 127

Query: 81  WADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQ 140
           W  ME  W+ + ++ ++         LLTEPP+NP  NREQ+ E+ FE ++  G+Y+A+Q
Sbjct: 128 WDHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQIAEIFFESFNCAGLYIAVQ 186

Query: 141 AVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTKRLDVAGRDVTRHL 192
           AVLAL A                       TH++PV E  V+    K + +AGRD+T+ +
Sbjct: 187 AVLALAASWTSSKVVDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITQFI 246

Query: 193 IDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVENYELPD 247
             LL  RG A        T  +IK++ CYV  D+       D    +    +VEN E   
Sbjct: 247 QTLLRERGEA---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDPEKFAQYVVENQEKTQ 303

Query: 248 GRVIKVGSERFEAPECLFQPSLV--DVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGG 305
            +V+ VG ERF APE  F P +   D   P +  ++  T+QA  +DVR  LY  +VLSGG
Sbjct: 304 KKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRKGLYNNIVLSGG 362

Query: 306 SSMYPGLPSRLEKELKQLWFTRVLRND---PSRLDKFKVRIEDPPRRKHMVFIGGAVLAN 362
           S+M+     RL+++LK +   R+ +N+    ++     V +    ++++ V+ GG++LA 
Sbjct: 363 STMFKDFGRRLQRDLKSIVNNRIAQNELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQ 422

Query: 363 IMADKDHMWLTKQEWQEMGPAAMSKF 388
               K +   TK++++E GP  +  F
Sbjct: 423 TAEFKSYCH-TKKDYEEYGPEIVRNF 447

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score =  177 bits (449), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 135/444 (30%), Positives = 208/444 (46%), Gaps = 69/444 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVG-----------------------RPILRAEE 43
           IV+D GTG  K+G AG + P + FP+ +                         P      
Sbjct: 9   IVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQRSTTKQGGSGSGAGQSQGSGNPYFGNST 68

Query: 44  RASITTPLK------------------DIMIGDEA---SDVRSYLQISYPMENGIIKNWA 82
            A+    L                   D  IG+EA   S   SY  +SYP+ +G ++NW 
Sbjct: 69  SATSFNSLASAALLSNNLAGKRGTEDLDFYIGNEALAASQGPSY-SLSYPIRHGQVENWD 127

Query: 83  DMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAV 142
            ME  W+ + ++ ++         LLTEPP+NP  NREQ+ E+ FE ++  G+Y+A+QAV
Sbjct: 128 HMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAV 186

Query: 143 LALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTKRLDVAGRDVTRHLID 194
           LAL A                       TH++PV E  V+    K + +AGRD+T  +  
Sbjct: 187 LALAASWTSSKVVDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQS 246

Query: 195 LLSRRGYAFNRSADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVENYELPDGR 249
           LL  RG          T  +IK++ CYV  D+       D    +    +VEN E    +
Sbjct: 247 LLRERG---EEDTTLRTAERIKQEYCYVCSDIVKEFNKFDRDPQKFAQFIVENSEKTKRK 303

Query: 250 VIKVGSERFEAPECLFQPSLV--DVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSS 307
           VI VG ERF APE  F P +   D   P +  ++  T+QA  +DVR  LY  +VLSGGS+
Sbjct: 304 VIDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGST 362

Query: 308 MYPGLPSRLEKELKQLWFTRVLRNDP---SRLDKFKVRIEDPPRRKHMVFIGGAVLANIM 364
           M+     RL+++LK +   R+  ++    ++     V++    R+++ V+ GG++LA   
Sbjct: 363 MFKDFGRRLQRDLKGIVNNRIALSEHLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAQTA 422

Query: 365 ADKDHMWLTKQEWQEMGPAAMSKF 388
             K +   TKQ+++E+GP  +  F
Sbjct: 423 EFKSYCH-TKQDYEEIGPEIVRNF 445

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score =  177 bits (448), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 130/451 (28%), Positives = 214/451 (47%), Gaps = 76/451 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGR------------PILRAEERASITTPLK-- 52
           IV+D GTG  K+G AG + P + FP+ +              P      +A ++ P    
Sbjct: 9   IVMDNGTGLTKLGFAGNDSPSWIFPTAIATAQSSNAKSSANAPQGLGNAKAGVSNPATSN 68

Query: 53  ----------------------------------DIMIGDEA---SDVRSYLQISYPMEN 75
                                             D  IG+EA   S   +Y  +SYP+ +
Sbjct: 69  PYFGNSTSATSFASNSNAFLLSNNLAGKRGTEDLDFYIGNEALVASQGPAY-SLSYPIRH 127

Query: 76  GIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVMFEKYDFGGV 135
           G ++NW  ME  W+ + ++ ++         LLTEPP+NP  NREQ+ E+ FE ++  G+
Sbjct: 128 GQVENWDHMERFWENSIFKYLR-AEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGL 186

Query: 136 YVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTKRLDVAGRD 187
           Y+A+QAVLAL A                       TH++PV E  V+    K + +AGRD
Sbjct: 187 YIAVQAVLALAASWTSAQVTDRSLTGTVIDSGDGVTHVIPVAEGYVVGSAIKNIPIAGRD 246

Query: 188 VTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVEN 242
           +T  +  LL  RG A    +  +T  +IK++ CYV  D+       D +  +    ++EN
Sbjct: 247 ITLFIQSLLRERGEA---DSSLKTAERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIIEN 303

Query: 243 YELPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGVGEMLFNTVQAADVDVRTALYRAV 300
            +    +VI +G ERF APE  F P +   D   P +  ++  T+QA  +DVR  LY  +
Sbjct: 304 QDKTTKKVIDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNI 362

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDP---SRLDKFKVRIEDPPRRKHMVFIGG 357
           VLSGGS+M+     RL++++K +   R+ +N+    ++     V++    ++++ V+ GG
Sbjct: 363 VLSGGSTMFKDFSRRLQRDVKSIVSNRIAQNEALTGTKSTGVDVQVISHRKQRNAVWFGG 422

Query: 358 AVLANIMADKDHMWLTKQEWQEMGPAAMSKF 388
           ++LA     K +   TK++++E GP  +  F
Sbjct: 423 SLLAQTAEFKGYCH-TKKDYEEHGPEIVRNF 452

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score =  176 bits (446), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 133/442 (30%), Positives = 210/442 (47%), Gaps = 67/442 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFP--------------SIVGRPILRAEERASITTPLK 52
           +V+D GTG  K+G AG + P + FP              S VG P   + E +       
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKSSGVGAPSAVSNEASYFGNSTS 68

Query: 53  -------------------------DIMIGDEA---SDVRSYLQISYPMENGIIKNWADM 84
                                    D  IG+EA   S   SY  +SYP+ +G ++NW  M
Sbjct: 69  ATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVENWDHM 127

Query: 85  ELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLA 144
           E  W+ + ++ ++         LLTEPP+NP  NREQ+ E+ FE ++  G+Y+A+QAVLA
Sbjct: 128 ERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLA 186

Query: 145 LYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLL 196
           L A                       TH++PV E  V+    K + +AGRD+T  +  LL
Sbjct: 187 LAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 197 SRRGYAFNRSADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVENYELPDGRVI 251
             RG A        T  +IK++ CYV  D+       D   ++    +VEN E    +V+
Sbjct: 247 RERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDKDPSKFAQFVVENQEKTRRKVV 303

Query: 252 KVGSERFEAPECLFQPSLV--DVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMY 309
            +G ERF APE  F P +   D   P +  ++  T+QA  +DVR  LY  +VLSGGS+M+
Sbjct: 304 DIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMF 362

Query: 310 PGLPSRLEKELKQLWFTRVLRND---PSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
                RL+++LK +   R+ +++    ++     V +    ++++ V+ GG++LA     
Sbjct: 363 KDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEF 422

Query: 367 KDHMWLTKQEWQEMGPAAMSKF 388
           K +   TK++++E GP  +  F
Sbjct: 423 KGYCH-TKKDYEEYGPEIVRNF 443

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score =  176 bits (447), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 133/449 (29%), Positives = 209/449 (46%), Gaps = 74/449 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIV----------------------------GRPI 38
           +V+D GTG  K+G AG + P + FP+ +                            G P 
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQPSNTKKSSAVATMGGSGAQPGGSAGNPY 68

Query: 39  LRAEERASITTPLK------------------DIMIGDEA---SDVRSYLQISYPMENGI 77
                 A+    L                   D  IG+EA   S   SY  +SYP+ +G 
Sbjct: 69  FGNSTSATSFDSLAASALLSNNLAGKRGTEDLDFYIGNEALAASRGPSY-SLSYPIRHGQ 127

Query: 78  IKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVMFEKYDFGGVYV 137
           ++NW  ME  W+ + ++ ++         LLTEPP+NP  NREQ+ E+ FE ++  G+Y+
Sbjct: 128 VENWDHMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYI 186

Query: 138 AIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTKRLDVAGRDVT 189
           A+QAVLAL A                       TH++PV E  V+    K + +AGRD+T
Sbjct: 187 AVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDIT 246

Query: 190 RHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVENYE 244
             +  LL  RG          T  +IK++ CYV  D+       D    +    +VEN E
Sbjct: 247 LFIQSLLRERGEV---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDAGKFAQFIVENSE 303

Query: 245 LPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGVGEMLFNTVQAADVDVRTALYRAVVL 302
               +++ VG ERF APE  F P +   D   P +  ++  T+QA  +DVR  LY  +VL
Sbjct: 304 STKKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVL 362

Query: 303 SGGSSMYPGLPSRLEKELKQLWFTRVLRND---PSRLDKFKVRIEDPPRRKHMVFIGGAV 359
           SGGS+M+     RL+++LK +   R+ +++    ++     V++    R+++ V+ GG++
Sbjct: 363 SGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVQVISHRRQRNAVWFGGSL 422

Query: 360 LANIMADKDHMWLTKQEWQEMGPAAMSKF 388
           LA     K +   TKQ+++E GP  +  F
Sbjct: 423 LAQTAEFKSYCH-TKQDYEEYGPEIVRNF 450

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score =  175 bits (444), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 134/438 (30%), Positives = 210/438 (47%), Gaps = 63/438 (14%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVG--RPILRAEERASIT---------------- 48
           IV+D GTG  K+G AG + P + FP+ +   +P    ++  S                  
Sbjct: 9   IVMDNGTGLTKLGFAGNDSPSWIFPTAIATAQPSTTTKQSGSSGGVGPGSGSIQTQGVGS 68

Query: 49  -----------------TPLKDIMIGDEA---SDVRSYLQISYPMENGIIKNWADMELLW 88
                            T   D  IGDEA   S   SY  +SYP+ +G ++NW  ME  W
Sbjct: 69  SSLSAALLSNNLAGKRGTEDLDFYIGDEAIAASQGPSY-SLSYPIRHGQVENWDHMERFW 127

Query: 89  DYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQ 148
           + + ++ ++         LLTEPP+NP  NREQ+ E+ FE ++  G+Y+A+QAVLAL A 
Sbjct: 128 ENSIFKYLRT-EPEDHYFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAAS 186

Query: 149 GLXXXXXXXXXXXX--------THIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRG 200
                                 TH++PV E  V+    K + +AGRD+T  +  LL  RG
Sbjct: 187 WTSSKVVDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERG 246

Query: 201 YAFNRSADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVENYELPDGRVIKVGS 255
                     T  +IK++ CYV  D+       D    +    +VEN E    +VI VG 
Sbjct: 247 ---EEDTTLRTAERIKQEYCYVCSDIVKEFNKFDRDSEKFAQFIVENSEKTRRKVIDVGY 303

Query: 256 ERFEAPECLFQPSLV--DVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLP 313
           ERF APE  F P +   D   P +  ++  T+QA  +DVR  LY  +VLSGGS+M+    
Sbjct: 304 ERFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFG 362

Query: 314 SRLEKELKQLWFTRVLRNDP---SRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHM 370
            RL+++LK +   R+  ++    ++     V++    R+++ V+ GG++LA     + + 
Sbjct: 363 RRLQRDLKGIVNNRIALSEHLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAETAEFRGYC 422

Query: 371 WLTKQEWQEMGPAAMSKF 388
             +KQ+++E+GP  +  F
Sbjct: 423 H-SKQDYEEIGPEIVRNF 439

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score =  175 bits (444), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 131/442 (29%), Positives = 212/442 (47%), Gaps = 67/442 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERAS-------------------- 46
           +V+D GTG  K+G AG + P + FP+ +        ++AS                    
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKASGVGTSSAAGNEASYFGNSTS 68

Query: 47  -----------ITTPLK--------DIMIGDEA---SDVRSYLQISYPMENGIIKNWADM 84
                      ++  L         D  IG+EA   S   SY  +SYP+ +G ++NW  M
Sbjct: 69  ATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVENWDHM 127

Query: 85  ELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLA 144
           E  W+ + ++ ++         LLTEPP+NP  NREQ+ E+ FE ++  G+Y+A+QAVLA
Sbjct: 128 ERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLA 186

Query: 145 LYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLL 196
           L A                       TH++PV E  V+    K + +AGRD+T  +  LL
Sbjct: 187 LAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 197 SRRGYAFNRSADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVENYELPDGRVI 251
             RG A        T  +IK++ CYV  D+       D   ++    +VEN E    +V+
Sbjct: 247 RERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRKVV 303

Query: 252 KVGSERFEAPECLFQPSLV--DVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMY 309
            +G ERF APE  F P +   D   P +  ++  T+QA  +DVR  LY  +VLSGGS+M+
Sbjct: 304 DIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMF 362

Query: 310 PGLPSRLEKELKQLWFTRVLRND---PSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
                RL+++LK +   R+ +++    ++     V +    ++++ V+ GG++LA     
Sbjct: 363 KDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEF 422

Query: 367 KDHMWLTKQEWQEMGPAAMSKF 388
           K +   TK++++E GP  +  F
Sbjct: 423 KGYCH-TKKDYEEYGPEIVRNF 443

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score =  174 bits (441), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 129/441 (29%), Positives = 212/441 (48%), Gaps = 65/441 (14%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERAS-------------------- 46
           +V+D GTG  K+G AG + P + FP+ +        +++S                    
Sbjct: 9   VVMDNGTGLTKLGFAGNDAPSWVFPTAIATAAPSNTKKSSGVGATSATGSEASYFGNATS 68

Query: 47  -----------ITTPLK--------DIMIGDEA---SDVRSYLQISYPMENGIIKNWADM 84
                      ++  L         D  IG+EA   S   SY  +SYP+ +G ++NW  M
Sbjct: 69  ATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVENWDHM 127

Query: 85  ELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLA 144
           E  W+ + ++ ++         LLTEPP+NP  NREQ+ E+ FE ++  G+Y+A+QAVLA
Sbjct: 128 ERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLA 186

Query: 145 LYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLL 196
           L A                       TH++PV E  V+    K + +AGRD+T  +  LL
Sbjct: 187 LAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 197 SRRGYAFNRSADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVENYELPDGRVI 251
             RG A        T  +IK++ CYV  D+       D   ++    +VEN E    +V+
Sbjct: 247 RERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRKVV 303

Query: 252 KVGSERFEAPECLFQPSLVDVEQPGVGEMLFN-TVQAADVDVRTALYRAVVLSGGSSMYP 310
            +G ERF APE  F P +   +      M+ + T+QA  +DVR  LY  +VLSGGS+M+ 
Sbjct: 304 DIGYERFLAPEIFFNPEIASSDFLTPLPMVVDQTIQACPIDVRKGLYNNIVLSGGSTMFK 363

Query: 311 GLPSRLEKELKQLWFTRVLRND---PSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADK 367
               RL+++LK +  +R+ +++    ++     V +    ++++ V+ GG++LA     K
Sbjct: 364 DFGRRLQRDLKSIVNSRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFK 423

Query: 368 DHMWLTKQEWQEMGPAAMSKF 388
            +   TK++++E GP  +  F
Sbjct: 424 GYCH-TKKDYEEYGPEIVRNF 443

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score =  174 bits (441), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 130/442 (29%), Positives = 211/442 (47%), Gaps = 67/442 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERAS-------------------- 46
           +V+D GTG  K+G AG + P + FP+ +        ++AS                    
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKASGVGASSAAGSDTSYFGNSTS 68

Query: 47  -----------ITTPLK--------DIMIGDEA---SDVRSYLQISYPMENGIIKNWADM 84
                      ++  L         D  IG+EA   S   SY  +SYP+ +G ++NW  M
Sbjct: 69  ATNFNGVTGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVENWDHM 127

Query: 85  ELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLA 144
           E  W+ + ++ ++         LLTEPP+NP  NREQ+ E+ FE ++  G+Y+A+QAVLA
Sbjct: 128 ERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLA 186

Query: 145 LYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLL 196
           L A                       TH++PV E  V+    K + +AGRD+T  +  LL
Sbjct: 187 LAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 197 SRRGYAFNRSADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVENYELPDGRVI 251
             RG A        T  +IK++ CYV  D+       D   ++    +VEN E    + +
Sbjct: 247 RERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRKAV 303

Query: 252 KVGSERFEAPECLFQPSLV--DVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMY 309
            +G ERF APE  F P +   D   P +  ++  T+QA  +DVR  LY  +VLSGGS+M+
Sbjct: 304 DIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMF 362

Query: 310 PGLPSRLEKELKQLWFTRVLRND---PSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
                RL+++LK +   R+ +++    ++     V +    ++++ V+ GG++LA     
Sbjct: 363 KDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEF 422

Query: 367 KDHMWLTKQEWQEMGPAAMSKF 388
           K +   TK++++E GP  +  F
Sbjct: 423 KGYCH-TKKDYEEYGPEIVRNF 443

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score =  174 bits (440), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 134/449 (29%), Positives = 211/449 (46%), Gaps = 74/449 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERAS-------------------- 46
           +V+D GTG  K+G AG + P + FP+ +        + +S                    
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQSGKSQSSSNKSTGFGSSSANAQSSYLSG 68

Query: 47  ------------------ITTPLK--------DIMIGDEA---SDVRSYLQISYPMENGI 77
                             I+  L         D  IG+EA   S   SY  +SYP+ +G 
Sbjct: 69  GGNSTSATDFNSLASSTLISNNLAGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQ 127

Query: 78  IKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVMFEKYDFGGVYV 137
           ++NW  ME  W+ + ++ ++         LLTEPP+NP  NR+Q+ E+ FE ++  G+Y+
Sbjct: 128 VENWDHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENRQQVAEIFFESFNCAGLYI 186

Query: 138 AIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTKRLDVAGRDVT 189
           A+QAVLAL A                       TH++PV E  V+    K + +AGRD+T
Sbjct: 187 AVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDIT 246

Query: 190 RHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVENYE 244
             +  LL  RG    + A   T  +IK++ CYV  D+       D    +    +VEN E
Sbjct: 247 LFIQSLLRERG---EQDASLRTAERIKQEYCYVCPDIVKEFNKFDRDSEKFAQFIVENKE 303

Query: 245 LPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGVGEMLFNTVQAADVDVRTALYRAVVL 302
               +V+ VG ERF APE  F P +   D   P +  ++  T+QA  +DVR  LY  +VL
Sbjct: 304 RTTKKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPVVVDETIQACPIDVRKGLYNNIVL 362

Query: 303 SGGSSMYPGLPSRLEKELKQLWFTRVLRNDP---SRLDKFKVRIEDPPRRKHMVFIGGAV 359
           SGGS+M+     RL+++LK +   R+ +++    +R     V +    R+++ V+ GG++
Sbjct: 363 SGGSTMFKDFGRRLQRDLKGIVNDRISQSEKLSGTRSTGVDVSVISHKRQRNAVWFGGSL 422

Query: 360 LANIMADKDHMWLTKQEWQEMGPAAMSKF 388
           LA     K +   TKQ+++E GP  +  F
Sbjct: 423 LAQTGEFKSYCH-TKQDYEEYGPDIVRNF 450

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score =  171 bits (434), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 129/442 (29%), Positives = 209/442 (47%), Gaps = 67/442 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVG---------------------------RPIL 39
           IV+D GTG  K+G AG + P + FP+ +                                
Sbjct: 9   IVMDNGTGLTKLGFAGNDSPSWIFPTAIATSQNHTKKTSSMSSTSNTTSSNQYFGNSTSA 68

Query: 40  RAEERASITTPLK------------DIMIGDEA---SDVRSYLQISYPMENGIIKNWADM 84
            +    + + PL             D  IG+EA   +   SY  +SYP+ +G I+NW  M
Sbjct: 69  TSFNSLNASMPLSNNLAGKRGTEDLDFYIGNEALAAAQGPSY-SLSYPIRHGQIENWDHM 127

Query: 85  ELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLA 144
           E  W+ + ++ ++         LLTEPP+NP  NREQ+ E+ FE ++  G+Y+A+QAVLA
Sbjct: 128 ERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLA 186

Query: 145 LYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLL 196
           L A                       TH++PV E  V+    K + +AGRD+T  +  LL
Sbjct: 187 LAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 197 SRRGYAFNRSADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVENYELPDGRVI 251
             RG          T  +IK++ CYV  D+       D    +    +VEN E    +++
Sbjct: 247 RERG---ETDTSLRTAERIKQEYCYVCPDIVKEFNKFDRNPDKFAQFIVENQEKTQKKIV 303

Query: 252 KVGSERFEAPECLFQPSLV--DVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMY 309
            VG ERF APE  F P +   D   P +  ++ +T+QA  +DVR  LY  +VLSGGS+M+
Sbjct: 304 DVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMF 362

Query: 310 PGLPSRLEKELKQLWFTRVLRND---PSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMAD 366
                RL++++K +   R+ +++    ++     V +    ++++ V+ GG++LA     
Sbjct: 363 KDFGRRLQRDIKSIVNNRIAQSELLSGTKSTGVDVNVITHRKQRNAVWFGGSLLAQTAEF 422

Query: 367 KDHMWLTKQEWQEMGPAAMSKF 388
           K +   TK++++E GP  +  F
Sbjct: 423 KSYCH-TKKDYEEYGPEIVRNF 443

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score =  172 bits (435), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 130/459 (28%), Positives = 214/459 (46%), Gaps = 78/459 (16%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIV-------------------------- 34
           M+ +  +V+D GTG  K+G AG + P + FP+ +                          
Sbjct: 1   MNLNPAVVMDNGTGLTKLGFAGNDSPSWIFPTAIATASPSGNKKTGSSATSSSVSGSGTN 60

Query: 35  ------------------------GRPILRAEERASITTPLKDIMIGDEA---SDVRSYL 67
                                   G+ +L         T   D  IG+EA   +   SY 
Sbjct: 61  GSNGSSNPYFGNSTSATNFGGLTGGKMLLSNNLAGKRGTEDLDFYIGNEALVAAQSPSY- 119

Query: 68  QISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVMF 127
            +SYP+ +G ++NW  ME  W+ + ++ ++         LLTEPP+NP  NREQ+ E+ F
Sbjct: 120 SLSYPIRHGQVENWDHMERFWENSIFKYLRT-EPEDHYFLLTEPPLNPPENREQVAEIFF 178

Query: 128 EKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTK 179
           E ++  G+Y+A+QAVLAL A                       TH++PV E  V+    K
Sbjct: 179 ESFNCAGLYIAVQAVLALAASWTSSKVIDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIK 238

Query: 180 RLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDL-----DLDTKLAR 234
            + +AGRD+T  +  LL  RG A        T  +IK++ CYV  D+       D +  +
Sbjct: 239 NIPIAGRDITEFIQSLLRERGEA---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRQPEK 295

Query: 235 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGVGEMLFNTVQAADVDV 292
               +VE+ E    +V+ VG ERF APE  F P +   D   P +  ++  T+QA  +DV
Sbjct: 296 FAQFIVESQEKTKQKVVDVGYERFLAPEIFFNPEIASSDYLTP-LPTVVDQTIQACPIDV 354

Query: 293 RTALYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDP---SRLDKFKVRIEDPPRR 349
           R  LY  +VLSGGS+M+     RL++++K +   R+ +N+     +     V++    ++
Sbjct: 355 RKGLYNNIVLSGGSTMFKDFSRRLQRDMKSIVNARISQNEKMTGVKSSGVDVQVISHRKQ 414

Query: 350 KHMVFIGGAVLANIMADKDHMWLTKQEWQEMGPAAMSKF 388
           ++ V+ GG++LA     + +   TK++++E+GP  +  F
Sbjct: 415 RNAVWFGGSLLAQTAEFRGYCH-TKRDYEEIGPEIVRNF 452

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score =  171 bits (433), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 132/447 (29%), Positives = 211/447 (47%), Gaps = 72/447 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIV-------------------------GRPILRA 41
           +V+D GTG  K+G AG + P + FP+ +                         G P    
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWIFPTAIATSQGGSSSNAKKSMSSSAASSATAGNPYYGN 68

Query: 42  EERAS-----------ITTPLK--------DIMIGDEA---SDVRSYLQISYPMENGIIK 79
              A+           ++  L         D  IG+EA   S   SY  +SYP+ +G ++
Sbjct: 69  STSATSFNDNNLSSMLLSNNLAGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVE 127

Query: 80  NWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAI 139
           NW  ME  W+ + ++ ++         LLTEPP+NP  NREQ+ E+ FE ++  G+Y+A+
Sbjct: 128 NWDHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQIAEIFFESFNCAGLYIAV 186

Query: 140 QAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTKRLDVAGRDVTRH 191
           QAVLAL A                       TH++PV E  V+    K + +AGRD+T  
Sbjct: 187 QAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLF 246

Query: 192 LIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVENYELP 246
           +  LL  RG A        T  +IK++ CYV  D+       D    +    +VEN E  
Sbjct: 247 IQSLLRERGEA---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDGEKFAQFVVENQEST 303

Query: 247 DGRVIKVGSERFEAPECLFQPSLV--DVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSG 304
             +++ VG ERF APE  F P +   D   P +  ++  T+QA  +DVR  LY  +VLSG
Sbjct: 304 RKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSG 362

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRND---PSRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           GS+M+     RL+++LK +   R+ +++    ++     V++    ++++ V+ GG++LA
Sbjct: 363 GSTMFKDFGRRLQRDLKGIVNNRIAQSEMLSGTKSTGVNVQVISHRKQRNAVWFGGSLLA 422

Query: 362 NIMADKDHMWLTKQEWQEMGPAAMSKF 388
                K +   TK+++ E GP  +  F
Sbjct: 423 QTAEFKGYCH-TKKDYDEYGPEIVRNF 448

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score =  171 bits (433), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 124/447 (27%), Positives = 212/447 (47%), Gaps = 72/447 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLK-------------- 52
           +V+D GTG  K+G AG + P + FP+ +        +++++                   
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQASNTKKSTVVNKSSAGGADSSGSGYFGN 68

Query: 53  ------------------------------DIMIGDEA---SDVRSYLQISYPMENGIIK 79
                                         D  IG+EA   +  +SY  +SYP+ +G ++
Sbjct: 69  STSATSFNSGDMSSLLLSNNLAGKRGTEDLDFYIGNEALAAAQGQSY-SLSYPIRHGQVE 127

Query: 80  NWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAI 139
           NW  ME  W+ + ++ ++         LLTEPP+NP  NREQ+ E+ FE ++  G+Y+A+
Sbjct: 128 NWDHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAV 186

Query: 140 QAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTKRLDVAGRDVTRH 191
           QAVLAL A                       TH++PV E  V+    K + +AGRD+T  
Sbjct: 187 QAVLALAASWTSPKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLF 246

Query: 192 LIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVENYELP 246
           +  LL  RG    +    +T  +IK++ CYV  D+       D   ++    +VE+ E  
Sbjct: 247 IQQLLRERG---EQDTSLKTAERIKQEYCYVCPDIVKEFNKFDRDASKFAQFVVESQEKT 303

Query: 247 DGRVIKVGSERFEAPECLFQPSLV--DVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSG 304
             +++ VG ERF APE  F P +   D   P +  ++  T+QA  +DVR  LY  +VLSG
Sbjct: 304 RKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDETIQACPIDVRKGLYNNIVLSG 362

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRNDP---SRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           GS+M+     RL++++K +   R+ +++    ++     V++    ++++ V+ GG++LA
Sbjct: 363 GSTMFKDFGRRLQRDMKSIVNNRIAQSEALSGTKSTGVDVQVISHRKQRNAVWFGGSLLA 422

Query: 362 NIMADKDHMWLTKQEWQEMGPAAMSKF 388
                K +   TK+++ E GP  +  F
Sbjct: 423 QTAEFKSYCH-TKKDYDEYGPEIVRNF 448

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score =  171 bits (432), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 130/454 (28%), Positives = 212/454 (46%), Gaps = 79/454 (17%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIV-------------------------------- 34
           +V+D GTG  K+G AG + P + FP+ +                                
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQPSNAKQTSSNAVSAGASSVANTGQSSGS 68

Query: 35  GRPILRAEERASITTPLK-------------------DIMIGDEA---SDVRSYLQISYP 72
           GR        A+    L                    D  IG+EA   +   SY  +SYP
Sbjct: 69  GRQYFGNSTSATAFNSLSSGSALMSNNLAGKRGTEDLDFYIGNEALIAAQGPSY-GLSYP 127

Query: 73  MENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVMFEKYDF 132
           + +G ++NW  ME  W+ + ++ ++         LLTEPP+NP  NREQ+ E+ FE ++ 
Sbjct: 128 IRHGQVENWDHMERFWENSIFKYLRTEPEDHC-FLLTEPPLNPPENREQVAEIFFESFNC 186

Query: 133 GGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTKRLDVA 184
            G+Y+A+QAVLAL A                       TH++PV E  V+    K + +A
Sbjct: 187 AGLYIAVQAVLALAASWTSSKVIDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIA 246

Query: 185 GRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTL 239
           GRD+T  +  LL  RG          T  +IK++ CYV  D+       D    +    +
Sbjct: 247 GRDITLFIQQLLRERG---EEDTSLRTAERIKQEYCYVCPDIVKEFNKFDRDSEKFAQFV 303

Query: 240 VENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGVGEMLFNTVQAADVDVRTALY 297
           VE+ E    +V+ VG ERF APE  F P +   D   P +  ++ +T+QA  +DVR  LY
Sbjct: 304 VESQEKTRRKVVDVGCERFMAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLY 362

Query: 298 RAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND---PSRLDKFKVRIEDPPRRKHMVF 354
             +VLSGGS+M+     RL+++LK +   R+++++    ++     V++    ++++ V+
Sbjct: 363 NNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIVQSEYLSGTKSTGVDVQVISHRKQRNAVW 422

Query: 355 IGGAVLANIMADKDHMWLTKQEWQEMGPAAMSKF 388
            GG++LA     K +   TK++++E+GP  +  F
Sbjct: 423 FGGSLLAQTAEFKSYCH-TKKDYEEIGPEIVRNF 455

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score =  169 bits (429), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 123/450 (27%), Positives = 215/450 (47%), Gaps = 74/450 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIV-------------GRPILRAEERASITTPLKD 53
           +V+D GTG  K+G AG + P + FP+ +             G     ++ +A+ ++ +  
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWIFPTAIATAQPSNSSGKSTGGGNTSSQSQANTSSGVIG 68

Query: 54  IMIGDEAS------------------------DVRSYL-------------QISYPMENG 76
              G+  S                        D+  Y+              +SYP+++G
Sbjct: 69  SYFGNSTSATSFNNFASSLLLSNNLAGKRGTEDLDFYIGNEALTAAQGPAYSLSYPIKHG 128

Query: 77  IIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVMFEKYDFGGVY 136
            ++NW  ME  W+ + ++ ++         LLTEPP+NP  NREQ+ E+ FE ++  G+Y
Sbjct: 129 QVENWNHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGLY 187

Query: 137 VAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTKRLDVAGRDV 188
           +A+QAVLAL A                       TH++PV E  V+    K + +AGRD+
Sbjct: 188 IAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDI 247

Query: 189 TRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVENY 243
           T  +  LL  RG         +T  +IK++ CYV  D+       D  + + +  ++EN 
Sbjct: 248 TLFIQSLLRERGEV---DTSLKTAERIKQEYCYVCPDIVKEFNKFDRDVGKFSQFIIENQ 304

Query: 244 ELPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGVGEMLFNTVQAADVDVRTALYRAVV 301
                +++ VG ERF APE  F P +   D   P +  ++ +T+QA  +DVR  LY  +V
Sbjct: 305 GKTQKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYSNIV 363

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRND---PSRLDKFKVRIEDPPRRKHMVFIGGA 358
           LSGGS+M+     RL+++L+ +   R+ +++    ++     V++    R+++ V+ GG+
Sbjct: 364 LSGGSTMFKDFGRRLQRDLRSIVNDRIAQSELLSGTKSTGVDVQVISHRRQRNAVWFGGS 423

Query: 359 VLANIMADKDHMWLTKQEWQEMGPAAMSKF 388
           +LA     K +   TK++++E GP  +  F
Sbjct: 424 LLAQTAEFKSYCH-TKRDYEEYGPEIVRNF 452

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score =  169 bits (429), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 115/357 (32%), Positives = 189/357 (52%), Gaps = 28/357 (7%)

Query: 53  DIMIGDEA---SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLT 109
           D  IG+EA   S   SY  +SYP+ +G I+NW  ME  W+ + ++ ++         LLT
Sbjct: 105 DFYIGNEALIASQGPSY-SLSYPIRHGQIENWDHMERFWENSIFKYLR-AEPEDHFFLLT 162

Query: 110 EPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX------- 162
           EPP+NP  NREQ+ E+ FE ++  G+Y+A+QAVLAL A                      
Sbjct: 163 EPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSQVTDRSLTGTVIDSGDG 222

Query: 163 -THIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCY 221
            TH++PV E  V+    K + +AGRD+T  +  LL  RG A        T  +IK++ CY
Sbjct: 223 VTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEA---DTSLRTAERIKQEYCY 279

Query: 222 VSYDL-----DLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQ 274
           V  D+       D +  +    ++EN +    +V+ +G ERF APE  F P +   D   
Sbjct: 280 VCPDIVKEFNKFDRQPEKFAQFIIENQDKTKQKVVDIGYERFLAPEIFFNPEIASSDFLT 339

Query: 275 PGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDP- 333
           P +  ++ +T+QA  +DVR  LY  +VLSGGS+M+     RL++++K +  +R+++N+  
Sbjct: 340 P-LPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFSRRLQRDIKSIVNSRIIQNEAV 398

Query: 334 --SRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLTKQEWQEMGPAAMSKF 388
              +     V++    ++++ V+ GG++LA     K +   TK++++E GP  +  F
Sbjct: 399 TGVKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCH-TKKDYEEYGPEIVRNF 454

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 19/29 (65%)

Query: 7  IVLDQGTGFVKIGRAGENFPDYTFPSIVG 35
          IV+D GTG  K+G AG + P + FP+ + 
Sbjct: 9  IVMDNGTGLTKLGYAGNDSPSWIFPTSIA 37

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score =  168 bits (426), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 136/457 (29%), Positives = 212/457 (46%), Gaps = 84/457 (18%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTF---------------------------PSIVGR--- 36
           +V+D GTG  K+G AG + P + F                           PS  G    
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWIFPTAIATSQSSNTKKASSSSSSSAAALGPSNTGTSAN 68

Query: 37  ----PILRAEERASITTPLK------------------DIMIGDEA---SDVRSYLQISY 71
               P       A+    L                   D  IG+EA   S   SY  +SY
Sbjct: 69  SSATPYFGNSTSATSFNNLNKNMLLSNNLAGKRGTEDLDFYIGNEALVASQGPSY-SLSY 127

Query: 72  PMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVMFEKYD 131
           P+ +G ++NW  ME  W+ + ++ ++         LLTEPP+NP  NREQ+ E+ FE ++
Sbjct: 128 PIRHGQVENWDHMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQIAEIFFESFN 186

Query: 132 FGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTKRLDV 183
             G+Y+A+QAVLAL A                       TH++PV E  V+    K + +
Sbjct: 187 CAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPI 246

Query: 184 AGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDL-----DLDTKLARETTT 238
           AGRD+T  +  LL  RG         +T  +IK++ CYV  D+       D   ++    
Sbjct: 247 AGRDITLFIQSLLRERGEV---DTSLKTAERIKQEYCYVCPDIVKEFNKFDRDGSKFAQF 303

Query: 239 LVENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQPGVGEMLFNTVQAADVDVRTAL 296
           +VEN E    +V+ VG ERF APE  F P +   D   P +  ++ +T+QA  +DVR  L
Sbjct: 304 IVENQEQTRKKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDHTIQACPIDVRKGL 362

Query: 297 YRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFK-----VRIEDPPRRKH 351
           Y  +VLSGGS+M+     RL+++LK +   R+ +++  RL   K     V++    ++++
Sbjct: 363 YNNIVLSGGSTMFKDFGRRLQRDLKSIVSNRIAQSE--RLSGTKSTGVDVQVISHRKQRN 420

Query: 352 MVFIGGAVLANIMADKDHMWLTKQEWQEMGPAAMSKF 388
            V+ GG++LA     K +   TK++++E GP  +  F
Sbjct: 421 AVWFGGSLLAQTAEFKSYCH-TKKDYEEYGPEIVRNF 456

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score =  166 bits (419), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 116/357 (32%), Positives = 189/357 (52%), Gaps = 28/357 (7%)

Query: 53  DIMIGDEA---SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLT 109
           D  IG+EA   +   SY  +SYP+ +G +++W  ME  W+ + ++ ++         LLT
Sbjct: 100 DFYIGNEALAAAQGPSY-SLSYPIRHGQVEDWNHMERFWENSIFKYLRT-EPEDHFFLLT 157

Query: 110 EPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX------- 162
           EPP+NP  NREQ+ E+ FE ++  G+Y+A+QAVLAL A                      
Sbjct: 158 EPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDG 217

Query: 163 -THIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCY 221
            TH++PV E  V+    K + +AGRD+T  +  LL  RG          T  +IK++ CY
Sbjct: 218 VTHVIPVAEGYVIGSAIKHIPIAGRDITLFIQSLLRERGEV---DTSLRTAERIKQEYCY 274

Query: 222 VSYDLDLD-TKLARETTT----LVENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQ 274
           V  D+  +  K  R+ T     +VEN E    +V+ VG ERF APE  F P +   D   
Sbjct: 275 VCPDIVKEFNKFDRDATKFAQFIVENKEKTQKKVVDVGYERFLAPEIFFNPEIASSDFLT 334

Query: 275 PGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND-- 332
           P +  ++  T+QA  +DVR  LY  +VLSGGS+M+     RL+++L+ +   R+ +++  
Sbjct: 335 P-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLRSIVNNRIAQSELL 393

Query: 333 -PSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLTKQEWQEMGPAAMSKF 388
             ++    +V++    R+++ V+ GG++LA     K +   TK++++E GP  +  F
Sbjct: 394 SGTKSTGVEVQVISHRRQRNAVWFGGSLLAQTAEFKSYCH-TKKDYEEYGPQIVRNF 449

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 7  IVLDQGTGFVKIGRAGENFPDYTFPSIVG 35
          +V+D GTG  K+G AG + P + FP+ + 
Sbjct: 9  VVMDNGTGLTKLGFAGNDSPSWVFPTAIA 37

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score =  163 bits (413), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 113/356 (31%), Positives = 183/356 (51%), Gaps = 26/356 (7%)

Query: 53  DIMIGDEA--SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTE 110
           D  IG+EA  +   +   ++YP+ +G ++NW  ME  W+ + ++ ++         LLTE
Sbjct: 106 DFYIGNEALTASQGANYSLNYPIRHGQVENWDHMERFWENSIFKYLRT-EPEDHFFLLTE 164

Query: 111 PPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX-------- 162
           PP+NP  NREQ+ E+ FE ++  G+Y+A+QAVLAL A                       
Sbjct: 165 PPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVVDRSLTGTVIDSGDGV 224

Query: 163 THIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYV 222
           TH++PV E  V+    K + +AGRD+T+ +  LL  RG          T  +IK++ CYV
Sbjct: 225 THVIPVAEGYVIGSALKNIPIAGRDITQFIQSLLRERGEV---DTSLRTAERIKQEYCYV 281

Query: 223 SYDL-----DLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLV--DVEQP 275
             D+       D    +    +VEN +    +V+ +G ERF APE  F P +   D   P
Sbjct: 282 CPDIVKEFNKFDRDAEKFAQYVVENQDKTRQKVVDIGYERFLAPEIFFNPEIASSDFLTP 341

Query: 276 GVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVL---RND 332
            +  +L  T+QA  +DVR  LY  +VLSGGS+M+     RL+++LK +   R+    R  
Sbjct: 342 -LPTVLDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAETERLS 400

Query: 333 PSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLTKQEWQEMGPAAMSKF 388
            +R     V++    ++++ V+ GG++LA     K +   TK++++E GP  +  F
Sbjct: 401 GARSTGVDVQVISHRKQRNAVWFGGSLLAQTPEFKGYCH-TKKDYEEYGPEIVRNF 455

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 7  IVLDQGTGFVKIGRAGENFPDYTFPS 32
          +V+D GTG  K+G AG + P + FP+
Sbjct: 9  VVMDNGTGLTKLGFAGNDSPSWIFPT 34

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 87.0 bits (214), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 81/299 (27%), Positives = 125/299 (41%), Gaps = 33/299 (11%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRA-EERASITTPLKDIMIGDEA 60
           D  T IV+D G+    IG +G + P+   PS  G+    A EE    T    +  IG   
Sbjct: 10  DEITSIVIDPGSYTTNIGYSGSDCPESIIPSSYGQYKDTAKEENQKKTKVFSEQSIGLAR 69

Query: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120
            D     +I   +ENG I +W   +  WD+    ++ L S SG  VLLTEP  N + NR+
Sbjct: 70  PD----YEIKRIVENGEIADWDTAQEQWDWVLKNELFLKSNSGIPVLLTEPIWNSVENRK 125

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKR 180
           +  EV+ E  DF   Y++  +    +A G             T + PV + + LS  + R
Sbjct: 126 KSLEVLLEGMDFEACYLSPVSTCVSFAAGRPNCLVVDIGHDTTSVSPVIDGMTLSKSSTR 185

Query: 181 LDVAGRDVTRHLID-------------LLSRRGYAFNRSADFET-------------VRQ 214
             +AGR +  HLI+             + SRR     R+ +++               ++
Sbjct: 186 NFIAGRYI-NHLIETYLKPREIIPLFAIESRRPEFKRRTFNYQVDDSLFTYGNERGFYQE 244

Query: 215 IKEKLCYVSYDLDLDTKLARETTTLVENYELPDGRVIKVGSE-RFEAPECLFQPSLVDV 272
            KE LC +  +  L+      +T    + E P    I   +E R+   E LF P   D+
Sbjct: 245 CKETLCQIIPNSTLEKSQDELSTMTKRSIEAPWAEEIVFDNEARYGFAEQLFSPHREDI 303

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 58/109 (53%), Gaps = 16/109 (14%)

Query: 276 GVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSR 335
           G+ +++  ++  +DVD+R +L   VV++GG+S  P L  RL  EL +            R
Sbjct: 410 GIADLVQRSILDSDVDLRASLAHNVVITGGTSCIPRLNDRLMYELSK------------R 457

Query: 336 LDKFKVRIEDPPR---RKHMVFIGGAVLANIMADKDHMWLTKQEWQEMG 381
           L   K RI        +++  ++GG++L + +     +W+ K+E++E+G
Sbjct: 458 LPALKFRILTTGHLREKQYQAWLGGSILTS-LGTFHQLWVGKEEYKEVG 505

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 86.7 bits (213), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 78/293 (26%), Positives = 121/293 (41%), Gaps = 27/293 (9%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS 61
           D  T +++D G+    IG +G ++P    PS  G      E + S TT  K I       
Sbjct: 12  DEITAVIIDPGSFSTNIGYSGTDYPQSILPSSYGTYKETTEGQES-TTKRKRIFSESSIQ 70

Query: 62  DVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQ 121
             R   +I   +ENG I +W   +  W +A   Q+ L STSG   LLTEP  N + NR++
Sbjct: 71  IPRPDYEIKRIVENGSIMDWDAAQEQWSWALKSQLHLQSTSGIPALLTEPIWNSVENRKK 130

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRL 181
             E++ E  +F   Y++       +A G             T + PV + + LS  + R 
Sbjct: 131 SLEILLEGMNFEACYLSSVPTCVSFAAGRPNCLVVDIGHDTTSVSPVVDGMTLSKSSMRN 190

Query: 182 DVAGRDVT---------RHLIDLLS---RRGYAFNRSADF-------------ETVRQIK 216
            +AG+ +          R +I L S   RR     R+ D+             E  ++ K
Sbjct: 191 FIAGKYINTLIEKYLQPREIIPLFSIKQRRPEFIKRTFDYTVDSSLYQYANEHEFFQECK 250

Query: 217 EKLCYVSYDLDLDTKLARETTTLVENYELPDGRVIKVGSE-RFEAPECLFQPS 268
           E LC ++    L+    +  T    + E P    +   +E RF   E LF P+
Sbjct: 251 ETLCQITSTGSLEKNKDQLKTISSRSIEAPWAEELVFENETRFGFGEELFVPN 303

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 64/121 (52%), Gaps = 18/121 (14%)

Query: 264 LFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELKQL 323
           + +P+  D+   G+ +++++ +  +DVD+R +L   VVL+GGSS  PGL  RL  EL + 
Sbjct: 382 ISEPTKNDI--AGLADLVYSAIIKSDVDLRASLAHNVVLTGGSSSIPGLSDRLILELNR- 438

Query: 324 WFTRVLRNDPSRLDKFKVRI---EDPPRRKHMVFIGGAVLANIMADKDHMWLTKQEWQEM 380
                      RL   K RI        R++  ++GG++L + +     +W+ K E+ E+
Sbjct: 439 -----------RLPALKFRILSTGHTKERQYQAWLGGSILTS-LGTFHQLWVGKNEYNEV 486

Query: 381 G 381
           G
Sbjct: 487 G 487

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 84.3 bits (207), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 73/303 (24%), Positives = 120/303 (39%), Gaps = 46/303 (15%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA-----SITTPLKDIMI 56
           D  + +V+D G+    IG +G +FP    PS+ G+     + +      SI  P KD   
Sbjct: 12  DEISAVVIDPGSYTTNIGYSGSDFPQSILPSVYGKSTSDKDSKTIFSEQSIGIPRKD--- 68

Query: 57  GDEASDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPL 116
                      ++   +ENG++ +W   +  W +A   ++ L S SG   LLTEP  N  
Sbjct: 69  ----------YELKPIIENGLVIDWDTAQEQWQWALKNELYLDSNSGIPALLTEPVWNST 118

Query: 117 RNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSH 176
            NR++  EV+ E   F   Y+A  +    +A G               + P+ + + LS 
Sbjct: 119 ENRKKSLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSK 178

Query: 177 LTKRLDVAGRDVTRHLID-------------LLSRRGYAFNRSADFET------------ 211
            T+R  +AG+ +  HLI              +  R+     +  D+E             
Sbjct: 179 STRRNFIAGKFI-NHLIKKAIEPKEIIPLFAIKQRKPKLIKKIFDYEIDQSLYEYANNRG 237

Query: 212 -VRQIKEKLCYVSYDLDLDTKLARETTTLVENYELPDGRVIKVGSE-RFEAPECLFQPSL 269
             ++ KE LC++     L+   A    T   + E P    I   +E R+   E LF P  
Sbjct: 238 FFQECKETLCHICPTKTLEEAKAELNATTKRSIETPWNEEIVFDNETRYGFAEELFLPKK 297

Query: 270 VDV 272
            D+
Sbjct: 298 DDI 300

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 65/110 (59%), Gaps = 12/110 (10%)

Query: 273 EQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND 332
           E  G+ +++++++ ++DVD+R  L   VVL+GG+S  PGL  RL  EL ++         
Sbjct: 381 EITGLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKIL-------- 432

Query: 333 PSRLDKFKVRIEDPPR-RKHMVFIGGAVLANIMADKDHMWLTKQEWQEMG 381
           PS   KF++      R R++  ++GG++L + +     +W+ KQE++E+G
Sbjct: 433 PSL--KFRILTTGHTRERQYQSWLGGSILTS-LGTFHQLWVGKQEYEEVG 479

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 84.0 bits (206), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 72/290 (24%), Positives = 124/290 (42%), Gaps = 34/290 (11%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G +FP    PS+ G+  L A+E +      + I I     
Sbjct: 12  DEISAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK--LTADENSKKMFSEQSIGIP---- 65

Query: 62  DVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQ 121
             R   ++   +ENG++ +W   +  W +A   ++ L S SG   LLTEP  N + NR++
Sbjct: 66  --RKDYELKPIIENGLVIDWDTAQEQWQWALRNELYLDSNSGIPALLTEPVWNSMENRKK 123

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRL 181
             EV+ E   F   Y+A  +    +A G               + P+ + + LS  T+R 
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRN 183

Query: 182 DVAGRDVT---------RHLIDLLSRR-----------GYAFNRSA-DFETVR----QIK 216
            +AG+ +          + +I L + +            Y  ++S  D+   R    + K
Sbjct: 184 FIAGKFINHLIQKALEPKEIIPLFAIKQRKPELIKKVFDYKVDKSLYDYANSRGFFQECK 243

Query: 217 EKLCYVSYDLDLDTKLARETTTLVENYELP-DGRVIKVGSERFEAPECLF 265
           E LC++     L+   A  +TT   + E P +  +I     R+   E LF
Sbjct: 244 ETLCHICPTKPLEEAKAELSTTTKRSIESPWNEEIIFDNETRYGFAEELF 293

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 64/110 (58%), Gaps = 12/110 (10%)

Query: 273 EQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND 332
           E  G+  ++++++ ++DVD+R  L   VVL+GG+S  PGL  RL  EL ++         
Sbjct: 380 ELAGLAGLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKIL-------- 431

Query: 333 PSRLDKFKVRIEDPPR-RKHMVFIGGAVLANIMADKDHMWLTKQEWQEMG 381
           PS   KF++      R R++  ++GG++L + +     +W+ KQE++E+G
Sbjct: 432 PSL--KFRILTTGHIRERQYQSWLGGSILTS-LGTFHQLWVGKQEYEEVG 478

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/298 (24%), Positives = 123/298 (41%), Gaps = 36/298 (12%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G +FP    PS+ G+    A+E        K+I       
Sbjct: 12  DEISAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK--YTADEGK------KNIFSEQSIG 63

Query: 62  DVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQ 121
             R   ++   +++G++ +W   +  W +A   ++ L S SG   LLTEP  N   NR++
Sbjct: 64  IPRKDYELKPIVKDGLVIDWDTAQEQWQWALKNELYLNSNSGTPALLTEPVWNSTENRKK 123

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRL 181
             EV+ E   F   Y+A  +    +A G               + P+ + + LS  T+R 
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRN 183

Query: 182 DVAGRDVTRHLID-------------LLSRRGYAFNRSADFETVRQI------------- 215
            +AG+ +  HLI              +  R+     +S ++E  + I             
Sbjct: 184 FLAGKFI-NHLIKKALEPKEIIPLFAIKQRKPELIKKSFNYEVDKSIYDYANNRGFFQEC 242

Query: 216 KEKLCYVSYDLDLDTKLARETTTLVENYELPDGRVIKVGSE-RFEAPECLFQPSLVDV 272
           KE LC++     L+   A  +TT   + E P    I   +E R+   E LF P   DV
Sbjct: 243 KETLCHICPTKTLEETKADLSTTTKRSIESPWNEEIVFDNETRYGFAEKLFLPKEDDV 300

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 63/114 (55%), Gaps = 16/114 (14%)

Query: 271 DVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLR 330
           D E  G+  ++++++ ++DVD+R  L   VVL+GG+S+ PGL  RL  EL ++       
Sbjct: 379 DNELIGLAHLVYSSIMSSDVDLRATLAHNVVLTGGTSLIPGLSDRLMTELNKI------- 431

Query: 331 NDPSRLDKFKVRI---EDPPRRKHMVFIGGAVLANIMADKDHMWLTKQEWQEMG 381
                L   K RI        R++  ++GG++L + +     +W+ K+E++E+G
Sbjct: 432 -----LPSLKFRILTTGHTMERQYQSWLGGSILTS-LGTFHQLWVGKKEYEEVG 479

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 74/305 (24%), Positives = 123/305 (40%), Gaps = 50/305 (16%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEE-------RASITTPLKDI 54
           D  + +V+D G+    IG +G +FP    PS+ G+    A+E         SI  P KD 
Sbjct: 12  DEVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK--YTADEGNKKIFSEQSIGIPRKD- 68

Query: 55  MIGDEASDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMN 114
                        ++   +ENG++ +W   +  W +A   ++ L S SG   LLTEP  N
Sbjct: 69  ------------YELKPIIENGLVIDWDTAQEQWQWALQNELYLNSNSGIPALLTEPVWN 116

Query: 115 PLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 174
              NR++  EV+ E   F   Y+A  +    +A G               + P+ + + L
Sbjct: 117 STENRKKSLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTL 176

Query: 175 SHLTKRLDVAGRDVTRHLID-------------LLSRRGYAFNRSADFET---------- 211
           S  T+R  +AG+ +  HLI              +  R+     ++ D+E           
Sbjct: 177 SKSTRRNFIAGKFI-NHLIKKALEPKEIIPLFAIKQRKPEFIKKTFDYEVDKSLYDYANN 235

Query: 212 ---VRQIKEKLCYVSYDLDLDTKLARETTTLVENYELPDGRVIKVGSE-RFEAPECLFQP 267
               ++ KE LC++     L+      ++T   + E P    I   +E R+   E LF P
Sbjct: 236 RGFFQECKETLCHICPTKTLEETKTELSSTAKRSIESPWNEEIVFDNETRYGFAEELFLP 295

Query: 268 SLVDV 272
              D+
Sbjct: 296 KEDDI 300

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 65/119 (54%), Gaps = 16/119 (13%)

Query: 266 QPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELKQLWF 325
           +P   + E  G+ +++++++ ++DVD+R  L   VVL+GG+S  PGL  RL  EL ++  
Sbjct: 374 KPPKENNELIGLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKI-- 431

Query: 326 TRVLRNDPSRLDKFKVRI---EDPPRRKHMVFIGGAVLANIMADKDHMWLTKQEWQEMG 381
                     L   K RI        R++  ++GG++L + +     +W+ K+E++E+G
Sbjct: 432 ----------LPSLKFRILTTGHTIERQYQSWLGGSILTS-LGTFHQLWVGKKEYEEVG 479

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 86/371 (23%), Positives = 143/371 (38%), Gaps = 72/371 (19%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASITTPLKDIMIGDEA 60
           TPI++D G+  VK G A  + P     ++     G P L  +      + LKDI      
Sbjct: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQ-----VSRLKDI------ 52

Query: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYE----QMKLPSTSGGKVLLTEPPMNPL 116
               S +Q   P E G + +W     +WDY  Y       ++ +T G  ++L+E  M+  
Sbjct: 53  ----SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMP 108

Query: 117 RNREQMCEVMFEKYDFGGVYVA-IQAVLALYAQGLXXXXXXXXXXX-------------- 161
              +   +V+FE+Y+FG  +   +   +    Q L                         
Sbjct: 109 ELSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYN 168

Query: 162 -----------XTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFE 210
                       T +VP+ + +      K+LD+ GR +   L + LS R Y  N   +  
Sbjct: 169 DFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETI 226

Query: 211 TVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELPD-------------------GRVI 251
            V  IKEK  ++S     ++   +E TT    Y LPD                    + I
Sbjct: 227 LVNNIKEKCLFMSPVSYFNSFQKKEDTT--AEYVLPDFQTSFQGYVKQQKQKIPEDSQTI 284

Query: 252 KVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPG 311
           K+  E F  PE  F P +  + +PG+ E +  ++      +R  +    V++GG+     
Sbjct: 285 KLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRN 344

Query: 312 LPSRLEKELKQ 322
              RL  EL++
Sbjct: 345 FARRLATELQR 355

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 119/295 (40%), Gaps = 38/295 (12%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS 61
           D  T +V+D G+    IG +G + P    PS  G+           T   KD +  +++ 
Sbjct: 12  DEITAVVIDPGSFTTNIGYSGTDCPQAILPSCYGK----------YTEGEKDELFSEQSI 61

Query: 62  DV-RSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120
            + R   +I   ++NG + +W   E  WD+A   +++  + SG   LLTEP  N   NR+
Sbjct: 62  GLPRKDYEIHNIVQNGEVVDWEKAEKQWDWAIRSELRFETNSGMPALLTEPIWNSEENRK 121

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKR 180
           +  EV+ E  DF   Y+   A    +A G             T + PV + + LS  + R
Sbjct: 122 KSLEVLLESMDFSACYLVPTATAVSFAMGRPTCLVVDIGHDVTSVCPVVDGMTLSKSSMR 181

Query: 181 LDVAG---RDVTRH---------LIDLLSRRGYAFNRSADFET-------------VRQI 215
             +AG    ++ R          L  +  RR     R  D+E               ++ 
Sbjct: 182 SYIAGSLLNELIRSQLAPRKVIPLFQVAQRRPVFMERKFDYEIHPSLQKFVNERQFFQEF 241

Query: 216 KEKLCYVSYDLDLDTKLARETTTLVENYELPDGRVIKVGS-ERFEAPECLFQPSL 269
           KE +  V+       K   ETT+   + E P G  +   S +R E  E LF P L
Sbjct: 242 KETMLQVAPTSISKFKSEIETTS-KRSIEAPWGEELVYDSLQRLEFAEQLFTPDL 295

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 65/110 (59%), Gaps = 12/110 (10%)

Query: 273 EQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND 332
           E  G+ +++++++ + DVD+RT L   VV++GG+S  PGL  R+  EL         R+ 
Sbjct: 371 EVSGLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELN--------RSL 422

Query: 333 PSRLDKFKVRIEDPPR-RKHMVFIGGAVLANIMADKDHMWLTKQEWQEMG 381
           P+   KF++      R R++  ++GG++LA+ +     +W+ KQE+ E+G
Sbjct: 423 PAL--KFRMLTSGQLRERQYQGWLGGSILAS-LGTFHQLWVGKQEYAEVG 469

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 91/382 (23%), Positives = 147/382 (38%), Gaps = 78/382 (20%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASITTPLKDIMIGDEAS 61
           PIV+D G+  +K G A  N P     SI     G   L  + R+     +KDI       
Sbjct: 5   PIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRS-----IKDI------- 52

Query: 62  DVRSYLQISYPMENGIIKNWADMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPMNPL 116
              S +  + P + G + +W     +WDY  +     +   L +T    ++ +E  M   
Sbjct: 53  ---SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLP 109

Query: 117 RNREQMCEVMFEKYDFGGVYVA-IQAVLALYAQGLXXXXXXXXXXX-------------- 161
              + M +V+FE+Y++  ++ A +   +   A+G                          
Sbjct: 110 ELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDY 169

Query: 162 ------------XTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADF 209
                        T +VPV + V      K+LD+ GR +   L + LS R Y  N   + 
Sbjct: 170 RDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDET 227

Query: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELPD-------------------GRV 250
             V  IKEK  ++S +   D+  +R  T   + Y LPD                    + 
Sbjct: 228 ILVNSIKEKCLFMSPNSYFDSFQSRLKT--AKEYVLPDFSTSFQGYLRKPGQTLPEDSQT 285

Query: 251 IKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYP 310
           I +  E F  PE  F P +  +  PG+ E +  ++      +R  L   VV++GG+   P
Sbjct: 286 IILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNFNIP 345

Query: 311 GLPSRLEKELKQL----WFTRV 328
              SRL  EL++     W  RV
Sbjct: 346 NFASRLATELQRQCPTDWSCRV 367

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 83/366 (22%), Positives = 143/366 (39%), Gaps = 64/366 (17%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRS 65
           P+V+D G+  VK G +  + P +   + + R    A   ++    +KDI          S
Sbjct: 5   PLVVDNGSYEVKFGYSTTSQP-FRALNALARDKFGATYLSNQINQIKDI----------S 53

Query: 66  YLQISYPMENGIIKNWADMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPMNPLRNRE 120
            +    P E G + +W     +WDY F+     +   L  + G  ++ +E  M      +
Sbjct: 54  SVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSK 113

Query: 121 QMCEVMFEKYDFGGVYVA-----------IQAVLALYAQGLXXXXXXXXXXX-------- 161
            M +V+FE+Y+F  +  A            +    +  +G                    
Sbjct: 114 NMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVISGKGDSESGTSTSETKDYEPFQMV 173

Query: 162 ------XTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQI 215
                  T +VP+ + V      K+LD+ GR +   L + LS R Y  N   +   V  I
Sbjct: 174 IDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDETILVNNI 231

Query: 216 KEKLCYVSYDLDLDTKLARETTTLVENYELPDGRVIKVG-------------------SE 256
           KEK  ++S     D+  A++  T VE Y LPD +   +G                    E
Sbjct: 232 KEKCLFMSPVSYFDS-FAKKDQTAVE-YVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289

Query: 257 RFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRL 316
            F  PE  F P +  + +PG+ E +  ++      +R  +   ++ +GG+   P  P RL
Sbjct: 290 LFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERL 349

Query: 317 EKELKQ 322
             EL++
Sbjct: 350 ATELQR 355

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 94/384 (24%), Positives = 146/384 (38%), Gaps = 72/384 (18%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSY 66
           +V+D G+  +K G +G + P      +      R    ++ T  ++DI          S 
Sbjct: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFH-LSNQTKKMRDI----------SQ 54

Query: 67  LQISYPMENGIIKNWADMELLWDYAFYEQMKLP-------STSGGKVLLTEPPMNPLRNR 119
             I  P E G + +W     +WDY FY +            T    ++++E  M      
Sbjct: 55  ALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELS 114

Query: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXX------------------X 161
           + M +V+FE+YDF  ++    A    + QG                              
Sbjct: 115 KNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174

Query: 162 XTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCY 221
            T  VP+ + V      K+LD+ GR +T  L + +S R Y  N   +   V  IKE+  +
Sbjct: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKEQCTF 232

Query: 222 V---SYDLDLDTKLARETTTLVENYELPD------GRVIKVGSER--------------F 258
           V   SY      K+     T VE Y LPD      G V K G E+              F
Sbjct: 233 VPPESYFSSFHNKM----NTKVE-YVLPDFQTSFLGYVKKPGKEKLTDDAQTLLLTDEVF 287

Query: 259 EAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEK 318
             PE  F P +  + +PG+ E +   +      VR  L   +V +GG+   P    RL+ 
Sbjct: 288 SVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQT 347

Query: 319 ELKQL----WFTRVLRNDPSRLDK 338
           EL++     W  +V  + P   DK
Sbjct: 348 ELQRQCPIDWSCKV--HSPQEKDK 369

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 87/382 (22%), Positives = 145/382 (37%), Gaps = 77/382 (20%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASITTPLKDIMIGDEA 60
           +P+++D G+  +K G   E  P     SI     G   L  + R+     +KDI      
Sbjct: 4   SPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRS-----IKDI------ 52

Query: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYE-----QMKLPSTSGGKVLLTEPPMNP 115
               S +  + P E G + +W     +WDY  +         + +T G  ++ +E  M  
Sbjct: 53  ----SSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTI 108

Query: 116 LRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXX--------------- 160
               + M +V+FE+Y+F  ++ A   V   +  G                          
Sbjct: 109 PELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNY 168

Query: 161 -----------XXTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADF 209
                        + IVPV + V      K+LD+ GR +   L + LS R Y  N   + 
Sbjct: 169 NDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDET 226

Query: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELPD------------GRVIKVGS-- 255
             V  IKE   ++S +   ++  +R  T   + Y LPD            G+V+   S  
Sbjct: 227 ILVNSIKENCLFMSPNAYFESFQSRSKT--AKEYVLPDFNTSFQGYLRKPGQVLPAESQT 284

Query: 256 -----ERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYP 310
                E F  PE  F P +  +   G+ E +  ++      +R  +   +V++GG+   P
Sbjct: 285 IVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIP 344

Query: 311 GLPSRLEKELKQL----WFTRV 328
              SRL  EL++     W  RV
Sbjct: 345 NFASRLATELQRQCPTDWSCRV 366

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 85/372 (22%), Positives = 141/372 (37%), Gaps = 72/372 (19%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVR 64
           TP+V+D G+  VK G A    P Y   + +      A   ++    +KDI          
Sbjct: 4   TPVVIDNGSYRVKFGPASLEAP-YCALNAIANDKYDASYLSNQIKSIKDI---------- 52

Query: 65  SYLQISYPMENGIIKNWADMELLWDYAFYEQ-----MKLPSTSGGKVLLTEPPMNPLRNR 119
           S + I  P   G + +W    L+WDY  Y         +  T    ++ +E  M      
Sbjct: 53  SSVSIKRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELG 112

Query: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXX---------------------- 157
           + M +V+FE+Y+FG +   +++ +A Y   L                             
Sbjct: 113 KNMDQVIFEEYEFGSL---MKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDF 169

Query: 158 -----XXXXXTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETV 212
                     T I+PV + +      K+LD+ GR +   L + LS R Y  N   +   V
Sbjct: 170 QLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILV 227

Query: 213 RQIKEKLCYVSYDLDLDTKLARETTTLVENYELPD----------------------GRV 250
             IKEK  +VS     D+   ++ T+    Y LPD                       + 
Sbjct: 228 NNIKEKCLFVSPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDSQS 285

Query: 251 IKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYP 310
           I +  E F  PE  F P +  + +PG+ E +  ++      +R  +   ++  GG+   P
Sbjct: 286 ITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLP 345

Query: 311 GLPSRLEKELKQ 322
              SR+ KEL++
Sbjct: 346 HFASRVAKELQR 357

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 79/362 (21%), Positives = 140/362 (38%), Gaps = 60/362 (16%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRS 65
           PIV+D G+  +K G      P   F + + R    +   ++    +KDI          S
Sbjct: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSYYLSNQIKTIKDI----------S 53

Query: 66  YLQISYPMENGIIKNWADMELLWDYAFYEQ-----MKLPSTSGGKVLLTEPPMNPLRNRE 120
            +    P E G + +W     +WDY F+         L  + G  ++++E  M      +
Sbjct: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXX---------------------XXXXX 159
            M +V+FE+Y+F  ++ +  A  A + +                                
Sbjct: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173

Query: 160 XXXTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL 219
              T +VPV + +      K+LD+ GR +   L + LS R Y  N   +   V  IKE  
Sbjct: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENC 231

Query: 220 CYVSYDLDLDTKLARETTTLVENYELPD-------------------GRVIKVGSERFEA 260
            +VS     ++   +E T +   Y LPD                    + +++  E F  
Sbjct: 232 LFVSPVSYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSV 289

Query: 261 PECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKEL 320
           PE  F P +  + +PG+ E +  ++      +R  +   +V +GG+   P   +RL  EL
Sbjct: 290 PETFFHPEIPQLLKPGIIETILESLSILPEQLRPLMLGNIVCTGGNFNLPNFATRLATEL 349

Query: 321 KQ 322
           ++
Sbjct: 350 QR 351

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score = 74.7 bits (182), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 82/374 (21%), Positives = 145/374 (38%), Gaps = 68/374 (18%)

Query: 4   HTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDV 63
             PIV+D G+  VK G +    P+    ++  +    A   ++    +KDI         
Sbjct: 3   QNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAWYLSNQMNNIKDI--------- 52

Query: 64  RSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPS-----TSGGKVLLTEPPMNPLRN 118
            S + I  P E G + +W     +WDY F+   + P+     T G  ++++E  M     
Sbjct: 53  -SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111

Query: 119 REQMCEVMFEKYDFGGVYVAIQA--------------------------VLALYAQGLXX 152
              M +VMFE+Y+F  ++ +  A                          +  + +Q +  
Sbjct: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171

Query: 153 -----XXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSA 207
                          T I+P+ + V      K++++ GR +     + +S R Y  + + 
Sbjct: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTD 229

Query: 208 DFETVRQIKEKLCYVS-----------------YDL-DLDTKLARETTTLVENYELP-DG 248
           +   V  IKEK  ++S                 Y L D  T           N +LP + 
Sbjct: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENS 289

Query: 249 RVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSM 308
           +VI +  E F  PE +F P +  + +PG+ E +  ++      +R  L   +V  GG+  
Sbjct: 290 QVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFN 349

Query: 309 YPGLPSRLEKELKQ 322
            P   SRL  EL++
Sbjct: 350 MPNFGSRLATELQR 363

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 74.7 bits (182), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 101/234 (43%), Gaps = 10/234 (4%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS 61
           DPH PI +D G+  ++ G   +  P + FP+++ +   R  +     T + +  + D+A 
Sbjct: 35  DPHVPIAIDFGSSKLRAGFVNQAAPTHIFPNVLTK--FRDRKLNKNFTFVGNDTLLDQA- 91

Query: 62  DVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTS-GGKVLLTEPPMNPLRNRE 120
            VRS  Q   P +   + NW   E + DY F+     P+      +LLTE        R 
Sbjct: 92  -VRS--QSRSPFDGPFVTNWNFTEEIMDYTFHHLGVSPNNGVRNPILLTERMATVQSQRA 148

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLXXXXXXXXXXXXTHIVPVYESVVLSHL 177
              ++MFE Y+  GV   I ++   Y Q   G             T+++PV +   +   
Sbjct: 149 NWYQIMFETYNVPGVTFGIDSLYGFYNQNTSGNKTGLVIDCGHEDTNVIPVVDGTGVLTD 208

Query: 178 TKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTK 231
            KR++  GR    +L DL++ +   F     +     + +  CYVS + D D K
Sbjct: 209 AKRINWGGRQAVDYLSDLMALKYPYFPTKLSYLQYETMYQDYCYVSPNYDEDIK 262

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 62/144 (43%), Gaps = 28/144 (19%)

Query: 251 IKVGSERFEAPECLFQPSLVDVEQPGVGEM-------LFNTVQAADVDVRTALYRAVVLS 303
           + +  ER   PE +FQP+L   +Q G+ E+        F +           +   V ++
Sbjct: 612 MHLNVERIRVPEVVFQPTLGGQDQAGICELSETILLKKFGSQPGKLSSTSLDMVNNVFIT 671

Query: 304 GGSSMYPGLPSRLEKELKQLW-----FTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGA 358
           GG+S  PGL  R+ +E  +       F+  + +DPS LD +K               G A
Sbjct: 672 GGNSKVPGLRERIVREFTEFLPVGTNFSVNMSSDPS-LDAWK---------------GMA 715

Query: 359 VLANIMADKDHMWLTKQEWQEMGP 382
            LA    +     ++K+E++E GP
Sbjct: 716 ALAQNKEEYKKTVISKKEYEEYGP 739

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 90/206 (43%), Gaps = 20/206 (9%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G + P    PS  G    +   + S     K     DE++
Sbjct: 12  DEISAVVIDPGSYSTNIGYSGTDCPHSILPSRYGS--FKKTNKDSGDEDTK----SDESA 65

Query: 62  DVRSYL-------------QISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLL 108
             R+++             +I   +ENG + +W   +  W++A   ++ L ST G   LL
Sbjct: 66  TKRAHIFSEQSLGLPRKDYEIKTIVENGAVTDWDAAQEQWEWALKNELFLESTKGIPALL 125

Query: 109 TEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPV 168
           TEP  N  +NR++  E + E  +F   Y+A  +    +A G               + PV
Sbjct: 126 TEPVWNTKKNRKKSLETLLESMNFEACYLAPTSTCVSFATGRANCLVVDIGHDTCSVSPV 185

Query: 169 YESVVLSHLTKRLDVAGRDVTRHLID 194
            + + LS  T+R   AG+ +  HLI+
Sbjct: 186 VDGMTLSKSTRRSFFAGKYIN-HLIE 210

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 61/109 (55%), Gaps = 16/109 (14%)

Query: 276 GVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSR 335
           G+ +++ +++ A+DVD+R +L   V L+GG+S+ PGL  RL  EL             +R
Sbjct: 400 GLADLVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELN------------AR 447

Query: 336 LDKFKVRI---EDPPRRKHMVFIGGAVLANIMADKDHMWLTKQEWQEMG 381
           L   K RI        R++  ++GG+VL + +     +W+ +QE++E+G
Sbjct: 448 LPALKFRILTTGHKKEREYQSWLGGSVLTS-LGTFHQLWVGRQEYEEVG 495

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/302 (23%), Positives = 119/302 (39%), Gaps = 37/302 (12%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRA---------EERASITTPLK 52
           D  + +V+D G+    IG +G + P    PS  G   L+          EE ++     K
Sbjct: 12  DEISAVVIDPGSFTTNIGYSGTDCPQAILPSYYGEISLKEVASEGNEEIEENSASNNKSK 71

Query: 53  DIMIGDEASDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPP 112
            I      +  R+  +I   ++NG + +W   +  WD+A    + L S SG    LTEP 
Sbjct: 72  KIFGEQSINYPRADYEIKPIVKNGEVIDWDGAQEQWDWALKNALYLESNSGIPAFLTEPI 131

Query: 113 MNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESV 172
            N + NR++  EV+ E   F   Y++       +A G               + PV + +
Sbjct: 132 WNTVENRKKSLEVLLEGLQFEACYLSPTPTCISFASGRPNCLVVDIGHDVASVSPVIDGM 191

Query: 173 VLSHLTKRLDVAGRDVTRHLIDLLSRR-------------------------GYAFNRSA 207
            LS  + R  ++GR +   + + L  R                            ++ + 
Sbjct: 192 TLSKSSMRNFISGRFINEKIKEFLKPREIIPLFEVKQRKPEFIKKTFDFPIHQSVYDYAN 251

Query: 208 DFETVRQIKEKLCYVSYDLDLDTKLARETTTLVE-NYE-LPDGRVIKVGSERFEAPECLF 265
           D    ++ KE LC ++    LD K+A E  +L + +YE L    ++     R+   E LF
Sbjct: 252 DHGIFQECKETLCQIAPTAALD-KMAPELESLAKRSYETLWKEDIVFDNVTRYSFAEHLF 310

Query: 266 QP 267
            P
Sbjct: 311 VP 312

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 62/111 (55%), Gaps = 18/111 (16%)

Query: 275 PGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSR----LEKELKQLWFTRVLR 330
           PG+ +++ +++ A DVD+R +L   +VL+GG+S  PG   R    L K+L  L F RVL 
Sbjct: 395 PGIVDLIESSIMATDVDLRASLAHNIVLTGGTSCIPGFSDRLMLELNKKLPALKF-RVLT 453

Query: 331 NDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLTKQEWQEMG 381
              +R             R++  ++GG++L++ +     +W+ KQE++E G
Sbjct: 454 TGQTR------------ERQYQAWLGGSILSS-LGTFHQLWVGKQEYEESG 491

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 75/306 (24%), Positives = 117/306 (38%), Gaps = 48/306 (15%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGR------PILRAEE---RASITTPLK 52
           D  + +V+D G+    IG +G + P    PS  G       P  + ++     SI  P K
Sbjct: 12  DEISAVVIDPGSYSTNIGYSGTDCPQAILPSCYGDYTNTDDPEGKKKKVFSEQSICIPRK 71

Query: 53  DIMIGDEASDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPP 112
           D              +I   +ENG++ +W   +  W +A   Q+ L S SG   LLTEP 
Sbjct: 72  D-------------YEIKPIVENGVVIDWDAAQEQWSWALENQLYLRSNSGIPALLTEPI 118

Query: 113 MNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESV 172
            N + NR++  E++ E  DF   Y+A       +  G               + PV + +
Sbjct: 119 WNTVENRKKSLELLLEGMDFEACYLASTPTCVSFGTGRSSCLVVDLGHDTCSVSPVVDGM 178

Query: 173 VLSHLTKRLDVAGRDVTRHLIDLLS------------------RRGYAF-------NRSA 207
            LS  TKR   AG  +   + + +S                  ++ + F         + 
Sbjct: 179 TLSKSTKRNFFAGGYLNELIKNYISPEKIIPLFAIDKRRPELKKKVFEFPVHESLYKYAN 238

Query: 208 DFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELPDGRVIKVGSE-RFEAPECLFQ 266
           D    ++ KE LC V+    LD   +   T    + E P    I   +E R+   E LF 
Sbjct: 239 DRGIFQECKETLCQVAAPSTLDKMKSELATVAKRSIETPWTEEIIFDNETRYGFAEQLFL 298

Query: 267 PSLVDV 272
           P   DV
Sbjct: 299 PRKEDV 304

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 60/109 (55%), Gaps = 16/109 (14%)

Query: 276 GVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSR 335
           GV +++ +++ A+DVD+R  L   VVL+GG+S  PGL  RL  EL             SR
Sbjct: 380 GVADLVHSSIMASDVDLRATLAHNVVLTGGTSTIPGLSDRLMAELN------------SR 427

Query: 336 LDKFKVRI---EDPPRRKHMVFIGGAVLANIMADKDHMWLTKQEWQEMG 381
           L   K R+        R++  ++GG+VL + +     +W+ K+E+Q++G
Sbjct: 428 LPALKFRMITTGHTRERQYQSWLGGSVLTS-LGTFHQLWVGKEEYQDVG 475

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 83/198 (41%), Gaps = 7/198 (3%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G + P    PS  G+     +E          IM      
Sbjct: 12  DEISAVVIDPGSYSTNIGYSGTDSPQLNIPSCYGQYTAGGKEGQKSFNDQFMIM------ 65

Query: 62  DVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQ 121
             R   +I   +ENG + +W   +  W +A  +++K  S  G    LTE   NP  NR++
Sbjct: 66  -PRPDFEIKRILENGCVVDWEAAQEQWAWAIRDELKFESFKGTPAFLTEAIWNPEENRKK 124

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRL 181
             EV+ E  +F   Y+A  A    +A G               + PV + + LS  + R 
Sbjct: 125 SLEVLLEGMEFEACYIAPTATCTSFAMGRPTCLVLDIGHDVASVCPVVDGMTLSKSSTRN 184

Query: 182 DVAGRDVTRHLIDLLSRR 199
            +AG+ + + + + L  R
Sbjct: 185 FLAGKLLNKLIENHLKPR 202

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 57/109 (52%), Gaps = 16/109 (14%)

Query: 276 GVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSR 335
           G+ +++   + A DVD+R  L   +V++GGSS  PGL  RL  EL +            +
Sbjct: 376 GLADLVNTAITATDVDLRATLAHNLVVTGGSSSIPGLTDRLMTELNK------------K 423

Query: 336 LDKFKVRIEDPPR---RKHMVFIGGAVLANIMADKDHMWLTKQEWQEMG 381
           L   K RI        R+   ++GG++L++ +     +W+ +QE++E+G
Sbjct: 424 LPALKFRILTSGHLRERQSRAWLGGSILSS-LGTFHQLWVGRQEYEEVG 471

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 100/234 (42%), Gaps = 10/234 (4%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS 61
           DPH PI +D G+  ++ G   +  P + FP+++ +   R  +     T + +  + D+A 
Sbjct: 35  DPHLPIAIDFGSSRLRAGFVNQATPTHIFPNVLTK--FRDRKLNKNFTFVGNDTLLDQA- 91

Query: 62  DVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTS-GGKVLLTEPPMNPLRNRE 120
            VRS  Q   P +   + NW   E + DY F+    LP+      +LLTE        R 
Sbjct: 92  -VRS--QSRSPFDGPFVTNWNFTEEIMDYTFHHLGVLPNNGISNPILLTERMATVQSQRA 148

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLXXXXXXXXXXXXTHIVPVYESVVLSHL 177
              +++FE Y+  GV   I ++ + Y     G             T +VP+ +   +   
Sbjct: 149 NWYQILFETYNVPGVTFGIDSLYSFYNNNPSGNKTGLVIDCSHEDTSVVPIVDGAGILTD 208

Query: 178 TKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTK 231
            KR++  G     +L DL++ +   F     +     + +  CYVS + D D K
Sbjct: 209 AKRINWGGHQAVDYLNDLMALKYPYFPTKMSYLQYETMYQDYCYVSPNYDEDIK 262

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 61/139 (43%), Gaps = 18/139 (12%)

Query: 251 IKVGSERFEAPECLFQPSLVDVEQPGVGEM-------LFNTVQAADVDVRTALYRAVVLS 303
           + +  ER   PE +FQP++   +Q G+ E+        F + +         +   ++++
Sbjct: 612 MHLNVERIRVPEVVFQPTMGGQDQAGICELSETILMKKFGSQRGKLSSTSLDMVNNILIT 671

Query: 304 GGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANI 363
           GG++  PGL  R+ KE  +  F  V  N         V I   P      + G A LA  
Sbjct: 672 GGNAKVPGLRERIVKEFTE--FLPVGTN-------VAVNISSNPSLD--AWRGMAALARN 720

Query: 364 MADKDHMWLTKQEWQEMGP 382
            A+     ++K+E++E GP
Sbjct: 721 KAEYKKTVISKEEYEEYGP 739

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 77/189 (40%), Gaps = 5/189 (2%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS 61
           D  T +V+D G+    IG +G + P    PS  G      E+ A      K I       
Sbjct: 12  DEITAVVIDPGSFSTNIGFSGTDCPQAILPSCYGEQKAETEDNAP-----KKIFAEQSIG 66

Query: 62  DVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQ 121
             R   +I   ++N ++ +W   E  W +A  + + L S SG   LLTEP  N L N+ +
Sbjct: 67  IPRPDYEIKPIVQNSMVVDWDAAEEQWSWALKDILYLNSNSGIPALLTEPIWNTLENKTK 126

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRL 181
             E++ E   F   Y++       +A G             T + PV + + LS  T R 
Sbjct: 127 SLEILLESLQFEACYLSSTPTCVSFASGRPNCLVVDLGHDTTSVSPVVDGMTLSKSTMRN 186

Query: 182 DVAGRDVTR 190
            +AG  +  
Sbjct: 187 FLAGNCINE 195

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 58/110 (52%), Gaps = 16/110 (14%)

Query: 276 GVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSR 335
           G  +++  ++ A+DVD+R  L   +VL+GG+S  PG   RL  EL +            +
Sbjct: 375 GAADLVNASILASDVDLRATLAHNIVLTGGTSSIPGFSDRLMSELNK------------K 422

Query: 336 LDKFKVRIEDPPR---RKHMVFIGGAVLANIMADKDHMWLTKQEWQEMGP 382
           L   K RI        R++  ++GG++L + +     +W+ KQE++E+GP
Sbjct: 423 LPALKFRILTTGHLRERQYQAWLGGSILTS-LGSFHQLWVGKQEYEEVGP 471

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 82/203 (40%), Gaps = 6/203 (2%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERAS-----ITTPLKDIMI 56
           D  T +++D G+    IG AG + P    PS  G  I  AEE  S      T   + +  
Sbjct: 12  DEITAVIIDPGSYTTNIGYAGTDCPQSILPSSFGE-IHEAEESTSEDNTEKTRKTRKVFS 70

Query: 57  GDEASDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPL 116
                  R   ++   +ENG + +W      W +A   ++ + S  G   +LTEP  N  
Sbjct: 71  EQSIPIPRPDYEVKRVVENGQVCDWDSAVEQWSWALRNELHIESNRGIPAMLTEPLWNSK 130

Query: 117 RNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSH 176
            NR +  E++ E  +F   Y+   +    +A G               + PV + + LS 
Sbjct: 131 ENRSKSLEILLEGMEFEACYLTATSTAVSFATGRPNSLIVDIGHDIASVTPVIDGMSLSK 190

Query: 177 LTKRLDVAGRDVTRHLIDLLSRR 199
            T+    AGR + + L D L  R
Sbjct: 191 STRCNHFAGRFLNKLLTDYLKPR 213

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 65/113 (57%), Gaps = 18/113 (15%)

Query: 273 EQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELK----QLWFTRV 328
           E PG+ +++ +++ + DVD+R +L   +V++GGSS  PGL  R+  EL      L F RV
Sbjct: 385 ELPGIVDLISSSISSCDVDIRASLAHNLVITGGSSTIPGLSDRILNELNMKFPALKF-RV 443

Query: 329 LRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLTKQEWQEMG 381
           L    S        IE    R++  ++GG++L++ +     +W+ K+E++E+G
Sbjct: 444 LATGQS--------IE----RQYQSWLGGSILSS-LGTFHQLWIGKKEYEEVG 483

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 77/367 (20%), Positives = 141/367 (38%), Gaps = 65/367 (17%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRS 65
           P+++D G+  +K G + +  P +   + + +        ++    +KDI          S
Sbjct: 5   PLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQINNIKDI----------S 53

Query: 66  YLQISYPMENGIIKNWADMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPMNPLRNRE 120
            + I  P + G + +W     +WDY FY     +  ++   S   ++LTE PM       
Sbjct: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSR 113

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTH---------------- 164
              +V+FE+Y F  +Y A  A    + +              T+                
Sbjct: 114 NTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVI 173

Query: 165 --------IVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIK 216
                   I+P+ + V      K++D+ GR +   L + +S R Y     +    V  IK
Sbjct: 174 DSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESML--VNNIK 231

Query: 217 EKLCYVSYDLDLDTKLARETTTLVENYELPDGRVIKVG---------------------S 255
           E   ++S  +       ++  T VE Y LPD +   +G                      
Sbjct: 232 ENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILED 289

Query: 256 ERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSR 315
           E F  PE  F P + +V +PG+ E +  ++      +R+ +   +V +GG+   P   SR
Sbjct: 290 ELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSR 349

Query: 316 LEKELKQ 322
           +  EL++
Sbjct: 350 IYTELQK 356

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score = 70.9 bits (172), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 85/369 (23%), Positives = 149/369 (40%), Gaps = 58/369 (15%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVR 64
            PI++D G+  +K G +    P Y   + + R       R  ++  +K I    E S+  
Sbjct: 3   VPIIIDNGSYEIKFGPSSLKSP-YRALNCLAR---DKYGRYHLSNQMKQIR---EVSNC- 54

Query: 65  SYLQISYPMENGIIKNWADMELLWDYAFYEQ----MKLPSTSGGKVLLTEPPMNPLRNRE 120
               +  P E G + +W   E +WDY  +        L  +    ++++E  M+     +
Sbjct: 55  ---HVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISK 111

Query: 121 QMCEVMFEKYDFGGV-------YVAIQ--AVLALY-AQGL----------XXXXXXXXXX 160
            M +V+FE+Y+FG +       Y+     A   +Y + GL                    
Sbjct: 112 HMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGF 171

Query: 161 XXTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLC 220
             T ++PV + V      K+LD+ GR +T  L + +S R Y  N   +      IKE+ C
Sbjct: 172 NCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQCC 229

Query: 221 Y---VSY--------DLDLDTKLARETTTLVENYELP------DGRVIKVGSERFEAPEC 263
           +   VSY        +  +D  L    T+L+     P      D + + +  E F  PE 
Sbjct: 230 FMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPET 289

Query: 264 LFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELKQL 323
            F P + ++ +PG+ E +  ++      +R  +   + + GG+       SRL  EL++ 
Sbjct: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQ 349

Query: 324 ----WFTRV 328
               W  RV
Sbjct: 350 CPTDWSVRV 358

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 79/334 (23%), Positives = 132/334 (39%), Gaps = 64/334 (19%)

Query: 58  DEASDVRSYLQISYPMENGIIKNWADMELLWDYAFYE----QMKLPSTSGGKVLLTEPPM 113
           D+  D+ S+  I  P E G + +W   E +WDY  +       +L  +    ++ +E  M
Sbjct: 46  DQIRDI-SHCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCM 104

Query: 114 NPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGL-------------------XXXX 154
                 + M +V+FE+Y+FG +     A    + +                         
Sbjct: 105 TIPEISKNMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQL 164

Query: 155 XXXXXXXXTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQ 214
                   T ++PV + V     TK+LD+ GR +   L + +S R Y  N   +   +  
Sbjct: 165 VVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINN 222

Query: 215 IKEKLCY---VSYDLDLDTKLARETTTLVENYELPD-------------------GRVIK 252
           IKE+ C+   VSY    D+   R+  T VE Y LPD                    ++++
Sbjct: 223 IKEQCCFMPPVSY---FDS-FQRKEETRVE-YILPDFQTSLIGYVRQPKQAIPKTSQILR 277

Query: 253 VGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGL 312
           +  E F  PE  F P + ++ +PG+ E +   V      +R  L   +V  GG+      
Sbjct: 278 LEDELFTVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANF 337

Query: 313 PSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDP 346
            +RL  EL+        R  P+    +KVR+  P
Sbjct: 338 ATRLATELQ--------RQCPT---DWKVRVHQP 360

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 87/390 (22%), Positives = 147/390 (37%), Gaps = 67/390 (17%)

Query: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60
           M     IV+D G+  VK G A E  P     ++       A+++  +T       + ++ 
Sbjct: 1   MTADQAIVIDNGSYQVKFGLASEVRPRVALNAL-------AKDKYGVT------HLSNQV 47

Query: 61  SDVRSYLQISY--PMENGIIKNWADMELLWDYAFYE----QMKLPSTSGGKVLLTEPPMN 114
            +++    + +  P E G + +W     +WDY  Y      +   S     V+L+E  M 
Sbjct: 48  QNIKDISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMT 107

Query: 115 PLRNREQMCEVMFEKYDFGGVYVA-IQAVLALYAQGLXXXXXXXXX-------------- 159
                +   +V+FE+Y+   +Y A   A +  Y                           
Sbjct: 108 LPELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAG 167

Query: 160 -------------XXXTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRS 206
                           T ++P+ + V      K+LDV GR +   L + +S R Y  N  
Sbjct: 168 KEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVM 225

Query: 207 ADFETVRQIKEKLCYV---SYDLDLDTKLARETTTLVENYE-------------LPD-GR 249
            +   V  IKE+  YV   SY      K   +   ++ +++             LPD  +
Sbjct: 226 DESILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQ 285

Query: 250 VIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMY 309
           ++ +  ERF  PE  F P +    +PG+ E +  ++      +R  +   +V  GG+   
Sbjct: 286 ILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNL 345

Query: 310 PGLPSRLEKEL-KQLWFTRVLRNDPSRLDK 338
           PG   RL  EL +QL    V R   S  DK
Sbjct: 346 PGFTDRLVSELQRQLPTDWVCRAKISSGDK 375

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 84/189 (44%), Gaps = 13/189 (6%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDV--R 64
           IV+D G+    IG +G + P    PS  G          ++ T      I +E   +  R
Sbjct: 17  IVIDPGSFVTNIGYSGTDCPQSIMPSSYG----------NVETDGDTKRIFNEQPLLFPR 66

Query: 65  SYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCE 124
           + ++I   +EN  I +W   +  W+YA    +K  S  G  VLLTEP  N   +R++  E
Sbjct: 67  AGMEIKPIVENSTIVDWDRAQEQWEYALNTDLKFESNKGTPVLLTEPIWNSEASRKKSLE 126

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVA 184
           ++ E  +F   Y+A  +    +A G             + + PV + + LS  + R  VA
Sbjct: 127 ILLESMEFEACYLAANSSAVSFAMGRPTCLVVDIGHDVSTVSPVIDGMTLSKSSTRNYVA 186

Query: 185 GRDVTRHLI 193
           G+ +  HLI
Sbjct: 187 GKYLN-HLI 194

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 62/115 (53%), Gaps = 10/115 (8%)

Query: 273 EQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND 332
           E  G+ +++  ++  ADVD+R  L   VVL+GG+S  PGL  R+  EL +       R  
Sbjct: 412 EVAGIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPALKFR-- 469

Query: 333 PSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLTKQEWQEMGPAAMSK 387
              L    +R      R++  ++GG++LA+ +     +W+ ++E++E+GP  + K
Sbjct: 470 --MLSSGHLR-----ERQYQGWLGGSILAS-LGTFHQLWVGREEYEEVGPERLLK 516

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 78/198 (39%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS 61
           D  T +V+D G+    IG +G + P    PS  G                  +      +
Sbjct: 12  DEITAVVIDPGSFTTNIGYSGTDCPQAILPSCYGHHKTNENADGDDEKSKPKVFAEQSLT 71

Query: 62  DVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQ 121
             R   +I   +ENG++ +W   +  WD+A    + L S  G   L+TE   N + N+ +
Sbjct: 72  FPRPDYEIKPIVENGLVVDWDAAQEQWDWALRNVLHLESNKGVPALMTESIWNTMENKTK 131

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRL 181
             EV+ E  DF   Y++       +A G                 PV + + LS  T+R 
Sbjct: 132 SLEVLLETLDFEACYISSTPTCVSFATGRPNCLVVDVGHDTASSSPVVDGMTLSRSTRRN 191

Query: 182 DVAGRDVTRHLIDLLSRR 199
            ++G+ V + +   L  R
Sbjct: 192 FISGKFVDQLIGKYLQPR 209

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 60/112 (53%), Gaps = 16/112 (14%)

Query: 273 EQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND 332
           E  G+ +++ +++ +ADVD+R  L   +VL+GGSS  PG   RL  EL +          
Sbjct: 375 ELAGISDLVHSSITSADVDLRATLAHNIVLTGGSSSVPGFSDRLMNELTK---------- 424

Query: 333 PSRLDKFKVRIEDPPR---RKHMVFIGGAVLANIMADKDHMWLTKQEWQEMG 381
             +L   K R+        R++  ++GG++L + +     +W+ K+E++E+G
Sbjct: 425 --KLPALKFRVLTTGHLRERQYQSWLGGSILTS-LGSFHQLWVGKREYEEVG 473

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 88/213 (41%), Gaps = 15/213 (7%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDE-A 60
           D    +V+D G+    IG +G ++P    PS  G      +++A    P +      E A
Sbjct: 12  DEICAVVIDPGSFTTNIGFSGSDYPQSILPSCYGAITEIEDQQADHNKPDESAANNTENA 71

Query: 61  SDVR-----SYLQISYP---------MENGIIKNWADMELLWDYAFYEQMKLPSTSGGKV 106
           S ++     +   + YP         ++NG + +W   +  W +A   ++ L S  G   
Sbjct: 72  SKIKIRKVFNEQSVGYPRANYEIKPIVQNGEVVDWDAAQEQWSWALENELFLKSNEGVPA 131

Query: 107 LLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIV 166
           LLTEP  N + NR++  EV+ E   F   Y++       +A G               + 
Sbjct: 132 LLTEPIWNTVENRKKSLEVLLEGMGFEACYLSATPTCVSFAAGRSNCLVVDIGHDIISVS 191

Query: 167 PVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRR 199
           PV + +  S  T+R  ++G+ +   + D L  R
Sbjct: 192 PVVDGMTFSKSTRRNVISGKYLNVLINDFLKPR 224

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 66/111 (59%), Gaps = 18/111 (16%)

Query: 275 PGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSR----LEKELKQLWFTRVLR 330
           PG+ +++ +++ AADVD+RT+L   VVL+GG+S  PGL  R    L K L  L F RVL 
Sbjct: 397 PGIVDLIESSINAADVDLRTSLAHNVVLTGGTSCIPGLSDRILLELNKRLPALKF-RVLA 455

Query: 331 NDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLTKQEWQEMG 381
           N  +R             R++  ++GG++L++ +     +W+ KQE++E+G
Sbjct: 456 NGQTR------------ERQYQSWLGGSILSS-LGTFHQLWVGKQEYEEIG 493

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 68.9 bits (167), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 98/229 (42%), Gaps = 13/229 (5%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS 61
           DP+ PI +D G+  V+ G   ++ P + F + + R   R + R ++T       IG++ +
Sbjct: 34  DPNVPIAIDFGSSEVRAGFGNQDQPSHIFTNRISRWRDRRKNR-NLT------FIGNDTN 86

Query: 62  -DVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSG--GKVLLTEPPMNPLRN 118
            D+    Q   P +  I+ NW   E + +Y F+  + +    G    +L+TE        
Sbjct: 87  LDLSVRSQAKSPYDGAIVSNWDYTEEIMEYTFH-HLGVNGNDGVSNPILMTEKLATLQSQ 145

Query: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQ--GLXXXXXXXXXXXXTHIVPVYESVVLSH 176
           RE   +++FE +    V   I ++ + YA                 TH++PV     +  
Sbjct: 146 RENWYQLLFECFGVPQVTFGIDSLFSFYANNDATASGLVINSGNEDTHVIPVMNGKGVLS 205

Query: 177 LTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYD 225
             KR++  GR    +L +LL+ +   F         + + E  CYVS D
Sbjct: 206 EAKRINWGGRQSVEYLSNLLALKYPYFPIKPSTHQFQSLYEDFCYVSVD 254

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 61/133 (45%), Gaps = 18/133 (13%)

Query: 256 ERFEAPECLFQPSLVDVEQPGVGEML-------FNTVQAADVDVRTALYRAVVLSGGSSM 308
           ER   PE +FQPS+  ++Q GV E+        F + ++   +    L   V L+GG+  
Sbjct: 609 ERIRVPEVIFQPSMAGLDQAGVTEICETNFLKKFGSTRSQLSEGSKKLAANVFLTGGNMR 668

Query: 309 YPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKD 368
            PG+  R+ +E     FT +L    +      VR+          + G A L+   +   
Sbjct: 669 LPGVRERIVRE-----FTGMLPMGSN----LNVRMASDSAVD--AWRGMAKLSQAGSQYK 717

Query: 369 HMWLTKQEWQEMG 381
             ++T++E+QE+G
Sbjct: 718 GSYITRKEYQELG 730

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 81/390 (20%), Positives = 138/390 (35%), Gaps = 92/390 (23%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI--LRAEERASITTPLKDIMIGDEASDV 63
           PIV+D G+  +K G           PS   +P   L A  +    T      + +   ++
Sbjct: 5   PIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTS----YLSNHIKNI 49

Query: 64  RSYLQISY--PMENGIIKNWADMELLWDYAFYEQMK-----LPSTSGGKVLLTEPPMNPL 116
           +    +++  P E G +  W     +WDY F+  ++     L    G  ++ +E  M   
Sbjct: 50  KDISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLP 109

Query: 117 RNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXX---------------- 160
              +   +V+FE+Y+F  ++ +  A    + +                            
Sbjct: 110 ELSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADM 169

Query: 161 --------------------------XXTHIVPVYESVVLSHLTKRLDVAGRDVTRHLID 194
                                       T I+PV + +      K+LDV GR +T  L +
Sbjct: 170 PSNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKE 229

Query: 195 LLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELPD------- 247
            LS R Y  N   +   V  IKEK  +VS     D+   ++   L   Y LPD       
Sbjct: 230 TLSFRHY--NMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTSFLG 285

Query: 248 ---------------GRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDV 292
                           + I +  E F  PE  F P +  + +PG+ E +  ++      V
Sbjct: 286 YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIV 345

Query: 293 RTALYRAVVLSGGSSMYPGLPSRLEKELKQ 322
           R  +   +V +GG+   P    RL  EL++
Sbjct: 346 RPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 98/232 (42%), Gaps = 10/232 (4%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS 61
           DP  PI +D G+  ++ G   ++ P + FP+++ +   R  +     T + +  + D+A 
Sbjct: 35  DPQLPIAIDFGSSKLRAGFVNQSAPTHVFPNVLTK--FRDRKLNKNFTFVGNDTLLDQA- 91

Query: 62  DVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTS-GGKVLLTEPPMNPLRNRE 120
            VRS  Q   P +   + NW   E + DY F+    +P       +LLTE        R 
Sbjct: 92  -VRS--QSKSPFDGPFVTNWNFTEEILDYTFHHLGIVPENGISNPILLTERMATVQSQRA 148

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYA---QGLXXXXXXXXXXXXTHIVPVYESVVLSHL 177
              +++FE Y+  GV   I ++   Y     G             T+++P+ +   +   
Sbjct: 149 NWYQILFETYNVPGVTFGIDSLYGFYNYYPSGKQTGLVIDCGHEDTNVIPIVDGAGILTD 208

Query: 178 TKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLD 229
            KR++  G     +L DL++ +   F     +     + +  CYVS + D D
Sbjct: 209 AKRINWGGHQAVDYLNDLMALKYPYFPTKMSYLQYETMYQDYCYVSRNYDED 260

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 59/144 (40%), Gaps = 28/144 (19%)

Query: 251 IKVGSERFEAPECLFQPSLVDVEQPGVGEML-------FNTVQAADVDVRTALYRAVVLS 303
           + +  ER   PE +FQP++   +Q G+ E+        F +           +   V ++
Sbjct: 612 MHLNVERTRVPEIVFQPTMGGQDQAGICELAETILLKKFGSQPGKLSQTSIDMANNVFIT 671

Query: 304 GGSSMYPGLPSRLEKELKQLW-----FTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGA 358
           GG++  PGL  R+ KE              + +DPS LD +K               G A
Sbjct: 672 GGNAKVPGLKERIVKEFTGFLPVGTNININMSSDPS-LDAWK---------------GMA 715

Query: 359 VLANIMADKDHMWLTKQEWQEMGP 382
            LA    +     ++++E++E GP
Sbjct: 716 ALAQNEEEYKRTIISRKEYEEYGP 739

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/246 (26%), Positives = 105/246 (42%), Gaps = 37/246 (15%)

Query: 163 THIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYV 222
           T I+P+ + V      K+LD+ GR +T  L + LS R Y          V  IKEK  +V
Sbjct: 201 TWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMDETLL--VNNIKEKCLFV 258

Query: 223 SYDLDLDTKLARETTTLVENYELPD--------------------GRVIKVGSERFEAPE 262
           S     D+  A+E T++   Y LPD                     +V+K+  E F  PE
Sbjct: 259 SPTSYFDSFKAKEETSV--EYILPDISSSYLGYTRENKSKPLPEGSQVVKLYDELFSVPE 316

Query: 263 CLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELKQ 322
             F P +  + +PG+ E +  ++      +R  L   +V +GG+   P   +RL  EL+ 
Sbjct: 317 TFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGNFNLPHFAARLAAELQ- 375

Query: 323 LWFTRVLRNDPSRLDKFKVRIEDPPRRKHMV-FIGGAVLANIMADKDHMWLTKQEWQEMG 381
               R L  D      +  RI  P +   +  +      AN  + K    ++K+E+ E G
Sbjct: 376 ----RQLPTD------WTCRISVPKKECELFSWKSMCQFANTDSYKKTR-ISKEEYYEHG 424

Query: 382 PAAMSK 387
           P  ++K
Sbjct: 425 PDWLTK 430

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 67/142 (47%), Gaps = 16/142 (11%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVR 64
           TP+VLD G+  +K G +    P   + ++ G  + +    A ++  +K I    E S+V 
Sbjct: 4   TPLVLDNGSYEIKFGLSNSERP---YRALNGFAVDKYGS-AYLSNQMKKIQ---EVSEV- 55

Query: 65  SYLQISYPMENGIIKNWADMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPMNPLRNR 119
               +  P E G + +W     +WDY  Y     +  +L  +    ++++EP M      
Sbjct: 56  ---TLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELS 112

Query: 120 EQMCEVMFEKYDFGGVYVAIQA 141
           + M +V+FE+Y+F  ++ A  A
Sbjct: 113 KNMDQVIFEEYEFDSLFKAPTA 134

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 99/236 (41%), Gaps = 27/236 (11%)

Query: 64  RSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMC 123
           RS  Q+   +ENG++ +W   E  W +A  E++ + S  G   LLTEP  N ++NR++  
Sbjct: 156 RSDYQVKRIIENGMVADWDIAEEQWSWALREKLYMDSFKGIPALLTEPVWNTVQNRKKSL 215

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDV 183
           EV+ EK +F   Y+        +A G               + PV + + L+   +R   
Sbjct: 216 EVLLEKMEFEACYLTTIPTNVSFAAGKPNCLVVDVGHDTCSVSPVIDGMTLTKSVRRNFF 275

Query: 184 AGRDVTRHLIDLL------------------SRRGYAFN-------RSADFETVRQIKEK 218
           AGR + R L + +                   R+ + FN        + D +  ++ KE 
Sbjct: 276 AGRYLNRLLENYIKPREIIPLFMVEKRRPEFKRKIFDFNIDPSVISYANDHQFFQECKET 335

Query: 219 LCYVSYDLDLDTKLARE-TTTLVENYELPDGRVIKVGS-ERFEAPECLFQPSLVDV 272
           LC +  +      +  E  ++   + E P G  I+  +  RF   E LF P+  ++
Sbjct: 336 LCQIYPNNSFLANVKDELESSAKRSIEAPWGEKIEFDNMTRFGFAEELFNPNESNI 391

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 76/154 (49%), Gaps = 21/154 (13%)

Query: 242 NYELPDGRVIKVGSERFEAPECLFQPSLVDVEQ-----PGVGEMLFNTVQAADVDVRTAL 296
           N + P   + + G    E  E +  P   D +      PG+ +++  TV ++DVD+R  L
Sbjct: 452 NADTPSENINENGKRSIEDGENVDVPKKSDKKDIDNIIPGIADLVEATVNSSDVDLRATL 511

Query: 297 YRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPR---RKHMV 353
              V+L+GG+S+ PGL  RL  EL +            +L   K RI        RK+  
Sbjct: 512 AHNVILTGGTSLIPGLADRLMYELNK------------KLPALKFRILSSGHRRERKYQA 559

Query: 354 FIGGAVLANIMADKDHMWLTKQEWQEMGPAAMSK 387
           ++GG++L + +     +W+ K+E++E+GP  + K
Sbjct: 560 WLGGSILTS-LGTFHQLWVGKREYEEVGPDRLLK 592

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 79/184 (42%), Gaps = 8/184 (4%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS 61
           D  T I++D G+    IG +G + P    PS  G+ I   EE+ S+     +  IG    
Sbjct: 12  DEITAIIIDPGSFNTNIGYSGTDCPQAILPSCYGQYI-NDEEKPSL---FNEQSIGLPRK 67

Query: 62  DVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQ 121
           D     +I   + +G + +W   +  W++A    +   S  G   LLTEP  N   NR++
Sbjct: 68  D----YEIKEIVRSGEVVDWDKAQEQWEWAIKSVLLFESNKGLPALLTEPIWNSEDNRKK 123

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRL 181
             EV+ E  DF   Y+   A    +A G             T + PV + + LS  + R 
Sbjct: 124 SLEVLLEGMDFEACYLTPTATAVSFAMGRPTCLVVDIGHDITSVSPVIDGMTLSKSSMRS 183

Query: 182 DVAG 185
            +AG
Sbjct: 184 FIAG 187

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 63/113 (55%), Gaps = 18/113 (15%)

Query: 273 EQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSR----LEKELKQLWFTRV 328
           E  G+ +++ +++ + DVD+RT L   VV++GGSS  PGL  R    L K L  L F R+
Sbjct: 372 EISGLADLIHSSIMSTDVDLRTTLAHNVVITGGSSSIPGLTDRILAELNKSLPALKF-RM 430

Query: 329 LRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLTKQEWQEMG 381
           L +  +R             +++  ++GG++LA+ +     +W+ KQE+ E+G
Sbjct: 431 LTSGQAR------------EKQYQSWLGGSILAS-LGTFHQLWVGKQEYAEVG 470

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 80/371 (21%), Positives = 136/371 (36%), Gaps = 70/371 (18%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVR 64
           +PI +D G+  +K G    + P             RA    +I        + ++  +++
Sbjct: 4   SPIAIDNGSYEIKFGTTDLSSP------------YRAINAFAID-KYHTTYLSNQIKNIK 50

Query: 65  SYLQISY--PMENGIIKNWADMELLWDYAFYEQMKLPS-----TSGGKVLLTEPPMNPLR 117
               +++  P E G + +W     +WDYA +   + P        G  ++ +E  M    
Sbjct: 51  DITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPE 110

Query: 118 NREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXX----------------- 160
             + M +V+FE+Y+F   Y +  A    +A                              
Sbjct: 111 LSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYN 170

Query: 161 ----------XXTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFE 210
                       T I+PV + V      K+LD+ GR +   L + LS R Y         
Sbjct: 171 DYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETIL- 229

Query: 211 TVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELPD-------------------GRVI 251
            V  IKE   +VS     D+    +  T VE Y LP+                    + I
Sbjct: 230 -VNNIKENCLFVSPTSYFDS-FKNKNETAVE-YVLPNFQTTFLGHVRDKTKPLPENTQTI 286

Query: 252 KVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPG 311
           K+  E F  PE  F P +  + +PG+ E +  ++      +R  L   +V +GG+   P 
Sbjct: 287 KLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPH 346

Query: 312 LPSRLEKELKQ 322
             +RL  EL++
Sbjct: 347 FATRLTSELQR 357

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 88/384 (22%), Positives = 144/384 (37%), Gaps = 77/384 (20%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERAS-ITTPLKDIMIGDEASDVR 64
           P V+D G+  +K G A     +   P      I + +  AS ++  +K I       D+ 
Sbjct: 3   PFVIDNGSYEIKFGHA-----NLVTPFRANNGIAKDKYGASYLSNHMKTI------RDIS 51

Query: 65  SYLQISYPMENGIIKNWADMELLWDYAFYEQMKLP------STSGGKVLLTEPPMNPLRN 118
           S   I  P E G + +W     +WDY  Y   +        +T    ++LTE        
Sbjct: 52  S-ATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPEL 110

Query: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX------------------- 159
            +   +V+FE+Y+F  ++ +  +    +A  +                            
Sbjct: 111 SKNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKDTAVNTDYTTATTKEYR 170

Query: 160 ---------XXXTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFE 210
                       T +VP+ + V      K++D+ GR +   L + LS R Y  N   +  
Sbjct: 171 DFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDETI 228

Query: 211 TVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELPD--------------------GRV 250
            +  IKEK  +VS     D+   ++   +   Y LPD                    G V
Sbjct: 229 LLNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGSV 286

Query: 251 --IKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSM 308
             I +  ERF  PE  F P + ++ +PG+ E +   +      +R  L   +V  GG+  
Sbjct: 287 QTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFK 346

Query: 309 YPGLPSRLEKEL-KQL---WFTRV 328
            P + SRL  EL +QL   W  RV
Sbjct: 347 LPHMSSRLTSELQRQLPTDWTCRV 370

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 77/185 (41%), Gaps = 7/185 (3%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G + P    PS  G+     +E         D  +G    
Sbjct: 12  DEISAVVIDPGSYSTNIGYSGTDSPQINIPSSYGQYTGGEKEGKK---SFNDQFMGM--- 65

Query: 62  DVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQ 121
             R   +I   +E+G + +W   +  W +A  +++K  S  G    LTE   N   NR++
Sbjct: 66  -ARPDFEIKRILEDGCVVDWEAAQEQWTWAIRDELKFGSFKGTPAFLTEAIWNSEENRKK 124

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRL 181
             EV+ E  +F   Y+A  A    +A G               + PV + + LS  + R 
Sbjct: 125 SLEVLLEGMEFEACYIAPTATCVSFAMGRPTCLVVDIGHDVASVCPVVDGMTLSKSSTRN 184

Query: 182 DVAGR 186
            +AG+
Sbjct: 185 FLAGK 189

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 56/115 (48%), Gaps = 16/115 (13%)

Query: 276 GVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSR 335
           G+  ++   +   DVD+R  L   +V++GGSS   GL  RL  EL +            +
Sbjct: 376 GLANLVNTAIMETDVDLRATLAHNLVVTGGSSSILGLADRLMTELNK------------K 423

Query: 336 LDKFKVRIEDPPR---RKHMVFIGGAVLANIMADKDHMWLTKQEWQEMGPAAMSK 387
           L   K RI        R+   ++GG++L++ +     +W+ +QE++E+G   + K
Sbjct: 424 LPALKFRILTSGHLRERQSRAWLGGSILSS-LGTFHQLWVGRQEYEEVGAERLLK 477

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 63/282 (22%), Positives = 111/282 (39%), Gaps = 32/282 (11%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITT-----PLKDIMI 56
           D  + +V+D G+    IG +G + P  T PS  G+ I   EE+           LK  + 
Sbjct: 12  DEISAVVIDPGSYTTNIGYSGTDCPQVTLPSRYGQYISEEEEKDEQEQQEDDRKLKQKVF 71

Query: 57  GDEASDV-RSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNP 115
            +++  + R+  QI   + NG + +W   +  W +A   ++   ST G    LTEP  N 
Sbjct: 72  SEQSIGLPRNNYQIKPIVRNGSVIDWDSAQEQWSWAIQHELHFESTKGMPAFLTEPIWNT 131

Query: 116 LRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLS 175
             NR++  EV+ E  +F   +++       +A G               + PV + + LS
Sbjct: 132 EENRKKSLEVLLENMEFEACFLSPTPTCVSFAMGRPTCLVVDIGHDVCSVSPVVDGMTLS 191

Query: 176 HLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARE 235
             +    +AG      L++ L  +     ++     + Q         +D ++D  L   
Sbjct: 192 KSSTSNFIAG-----SLLNALLSKQLDPKKTVPLFQIAQRHPNFIPKKFDFEVDPSL--- 243

Query: 236 TTTLVENYELPDGRVIKVGSERF---EAPECLFQPSLVDVEQ 274
                           K G+ER+   E  E LFQ +   +E+
Sbjct: 244 ---------------FKFGNERWFFQECKETLFQVAPATLEK 270

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 64/118 (54%), Gaps = 16/118 (13%)

Query: 273 EQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND 332
           E  G+ +++++++ A DVD+R  L   VV++GG+S  PGL  R+  EL +          
Sbjct: 389 EIAGLTDLIYSSIMATDVDLRATLAHNVVVTGGTSSIPGLTDRIMAELNK---------- 438

Query: 333 PSRLDKFKVRIEDP---PRRKHMVFIGGAVLANIMADKDHMWLTKQEWQEMGPAAMSK 387
              L   K R+        R++  ++GG++L++ +     +W+ KQE++E+G + + K
Sbjct: 439 --SLPALKFRMLTSGHLKERQYQSWLGGSILSS-LGTFHQLWVGKQEYEEVGASRLLK 493

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 100/233 (42%), Gaps = 11/233 (4%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVR 64
           TPI +D G+  V+ G    + P + FP+ + R   R  + +   T + + ++ D+   VR
Sbjct: 37  TPIAIDFGSYEVRAGYTSSSIPSHIFPNKLTRH--RDRKLSKTFTFIGNDVLLDQT--VR 92

Query: 65  SYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRN-REQMC 123
           S  Q   P +   I NW  +E +  Y F     +   S    L+   P+  L++ R+   
Sbjct: 93  S--QSKSPFDGSFIANWDYVEDIMQYTFNHLGVVGDNSVRNPLIINEPLGSLQSQRKNWY 150

Query: 124 EVMFEKYDFGGVYVAIQAVLALYA--QGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRL 181
           E++FE +    V   I  +   YA  +G             T ++PV +   +    KR+
Sbjct: 151 ELLFECFHLPNVSFGIDGMFGFYANNEGNQDGIVINCSNEETDVIPVVDGRGVLTDAKRI 210

Query: 182 DVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDL--DLDTKL 232
           +  GR    +L DL+S +   F         +Q+    CYVS D   D+DT L
Sbjct: 211 NWGGRQAVDYLSDLMSLKYPYFPSKLSTFQYQQMYTNYCYVSPDYSNDIDTML 263

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 7/77 (9%)

Query: 251 IKVGSERFEAPECLFQPSLVDVEQPGVGEML-------FNTVQAADVDVRTALYRAVVLS 303
           + +  ER   PE LFQP +   +Q G+ E+        F +      +    + + + L+
Sbjct: 609 LHLNVERIRVPEILFQPIIGGQDQAGISELCETILSNKFGSKPRELSETSLGMAKNIWLT 668

Query: 304 GGSSMYPGLPSRLEKEL 320
           GG S  PGL  R+ KE 
Sbjct: 669 GGHSKLPGLRERIVKEF 685

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 78/180 (43%), Gaps = 22/180 (12%)

Query: 163 THIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYV 222
           T I+PV + +      K+LD+ GR +T  L + LS R Y  N   +   V  +KEK  +V
Sbjct: 198 TWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY--NMMDETILVNNVKEKCLFV 255

Query: 223 SYDLDLDTKLARETTTLV-------------------ENYELP-DGRVIKVGSERFEAPE 262
           S     D+  A++   L                    EN  LP D + I +  E F  PE
Sbjct: 256 SPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQTIALTDELFTIPE 315

Query: 263 CLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELKQ 322
             F P +  + +PG+ E +  ++      VR  +   +V +GG+   P    RL  EL++
Sbjct: 316 TFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 97/232 (41%), Gaps = 10/232 (4%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS 61
           +P +PI +D G+  ++ G      P + FP+ + +   R  +     T + +  + D+A 
Sbjct: 35  NPQSPIAIDFGSSKLRAGFVNHATPTHIFPNALTK--FRDRKLNKNFTFVGNDTLLDQA- 91

Query: 62  DVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTS-GGKVLLTEPPMNPLRNRE 120
            VRS  Q   P +   + NW   E + DY F+    +P       +LLTE        R 
Sbjct: 92  -VRS--QSRSPFDGPFVTNWNLTEEILDYTFHHLGVVPDNGIPNPILLTERLATVQSQRT 148

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYA---QGLXXXXXXXXXXXXTHIVPVYESVVLSHL 177
              +++FE Y+  GV   I ++ + Y     G             T+++PV +   +   
Sbjct: 149 NWYQILFETYNVPGVTFGIDSLFSFYNYNPSGNKTGLVISCGHEDTNVIPVVDGAGILTD 208

Query: 178 TKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLD 229
            KR++  G     +L DL++ +   F     +     + +  CYVS + D D
Sbjct: 209 AKRINWGGHQAVDYLNDLMALKYPYFPTKMSYLQYETMYKDYCYVSRNYDED 260

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 60/144 (41%), Gaps = 28/144 (19%)

Query: 251 IKVGSERFEAPECLFQPSLVDVEQPGVGEM-------LFNTVQAADVDVRTALYRAVVLS 303
           + +  ER   PE +FQP++   +Q G+ E+        F +           +   V+++
Sbjct: 612 MHLNVERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGSQPGKLSQTSIDMVNNVLIT 671

Query: 304 GGSSMYPGLPSRLEKELKQLW-----FTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGA 358
           GG++  PGL  R+ KE           T  + +DPS LD +K               G A
Sbjct: 672 GGNAKVPGLKERIVKEFTGFLPTGTNITVNMSSDPS-LDAWK---------------GMA 715

Query: 359 VLANIMADKDHMWLTKQEWQEMGP 382
            LA          ++K+E++E GP
Sbjct: 716 ALARNEEQYRKTVISKKEYEEYGP 739

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 78/180 (43%), Gaps = 22/180 (12%)

Query: 163 THIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYV 222
           T I+PV + +      K+LD+ GR +T  L + LS R Y  N   +   V  IKE+  +V
Sbjct: 198 TWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY--NMMDETILVNNIKEQCLFV 255

Query: 223 SYDLDLDTKLARETTTL-------------------VENYELP-DGRVIKVGSERFEAPE 262
           S     D+   ++   L                    EN  LP D ++I +  E F  PE
Sbjct: 256 SPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQIITLTDELFTIPE 315

Query: 263 CLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELKQ 322
             F P +  + +PG+ E +  ++      VR  +   +V +GG+   P    RL  EL++
Sbjct: 316 TFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 61/153 (39%), Gaps = 24/153 (15%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI--LRAEERASITTPLKDIMIGDEASDV 63
           PIV+D G+  +K G           PS   +P   L A  +    T      + +   ++
Sbjct: 5   PIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTS----YLSNHIKNI 49

Query: 64  RSYLQISY--PMENGIIKNWADMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPMNPL 116
           +    I++  P E G +  W     +WDY  +     +   L    G  ++ +E  M   
Sbjct: 50  KDISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLP 109

Query: 117 RNREQMCEVMFEKYDFGGVYVAIQAVLALYAQG 149
              +   +V+FE+Y+F  ++ +  AV   + + 
Sbjct: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKS 142

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/283 (22%), Positives = 115/283 (40%), Gaps = 32/283 (11%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS 61
           +P T I +D G+  V+ G   +  P + FP+ + R   R   R ++T       IG++ +
Sbjct: 34  NPETAIAIDFGSSEVRAGYGNQERPSHIFPNRIARWRDRKLNR-NLT------FIGNDTN 86

Query: 62  -DVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSG--GKVLLTEPPMNPLRN 118
            D+    Q   P +  ++ NW   E + +Y F+  + +  T G    +++TE        
Sbjct: 87  LDLSVRSQSRSPYDGALVTNWDYTEDIMEYTFH-HLGVKGTDGIPNPIIMTEKLGALHSQ 145

Query: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXX--XXXXXXXXTHIVPVYESVVLSH 176
           R+   +++FE +    V   + ++ + YA                 THI+PV +   +  
Sbjct: 146 RDNWYQLLFECFGAPQVTFGLDSLFSFYANNDASASGLVISSGNEDTHIIPVVDGKGVLG 205

Query: 177 LTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARET 236
             KR++  GR    +L +LL+ +   F         + + ++ CYVS D           
Sbjct: 206 EAKRINWGGRQSVDYLSNLLALKYPYFPIKPSTHQFKALYDEFCYVSPD----------- 254

Query: 237 TTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGE 279
                 Y+    R++ +  E  E    L +   VDV QP   E
Sbjct: 255 ------YQDEIQRILTL--EELETKNVLVEAPFVDVVQPEKSE 289

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 41/80 (51%), Gaps = 7/80 (8%)

Query: 251 IKVGSERFEAPECLFQPSLVDVEQPGVGEML-------FNTVQAADVDVRTALYRAVVLS 303
           + +  ER   PE +FQPS+  ++Q G+ E+        F + ++    +  +L   V L+
Sbjct: 604 MHLNVERIRVPEVIFQPSMGGLDQAGIIEICETNFLKKFGSSRSELSSISRSLASNVFLT 663

Query: 304 GGSSMYPGLPSRLEKELKQL 323
           GG+   PG+  R+ +E + L
Sbjct: 664 GGNMRLPGMRERVVREFRGL 683

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 78/180 (43%), Gaps = 22/180 (12%)

Query: 163 THIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYV 222
           T I+PV + +      K+LD+ GR +T  L + LS R Y  N   +   V  IKEK  +V
Sbjct: 198 TWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY--NMMDETILVNNIKEKCLFV 255

Query: 223 SYDLDLDTKLARETTTLV-------------------ENYELP-DGRVIKVGSERFEAPE 262
           S     D+  ++    L                    E+  LP D + I +  E F  PE
Sbjct: 256 SPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTDAQSITLTDELFTIPE 315

Query: 263 CLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELKQ 322
             F P +  + +PG+ E +  ++      VR  +   +V +GG+   P    RL +EL++
Sbjct: 316 TFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLARELQR 375

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 96/233 (41%), Gaps = 17/233 (7%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS 61
           D   PI +D G+  ++ G   ++ P + FP+ + R   R   +           IG++ S
Sbjct: 34  DSTIPIAIDFGSSQIRAGYTNQSTPSHIFPNRLTRYRDRKINKTFT-------FIGNDVS 86

Query: 62  -DVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSG--GKVLLTEPPMNPLRN 118
            D     Q   P +  II NW  +E +  Y F   + +   +G    +LLTE        
Sbjct: 87  LDQAIRTQSKSPFDGSIITNWDYVEDIMQYIF-NHLGVVGHNGVSNPILLTEKLATLQSQ 145

Query: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXX----XXXXXXTHIVPVYESVVL 174
           R    +++FE +D   V + I ++ A Y  GL                T ++PV E   +
Sbjct: 146 RSNWYQLLFECFDIPEVTLGIDSMFAFY--GLNERSSTGLVIDCGNEETDVIPVVEGAGM 203

Query: 175 SHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLD 227
               KR++  GR    +L DLL+ +   F         +++ +  CYV+ D D
Sbjct: 204 LTDAKRINWGGRQAVDYLNDLLTLKYPYFPTKLSTAQYQRVYQDYCYVAKDYD 256

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 7/72 (9%)

Query: 256 ERFEAPECLFQPSLVDVEQPGVGEML-------FNTVQAADVDVRTALYRAVVLSGGSSM 308
           ER   PE LFQPS+   +Q G+ E+        F + Q        A+   + ++GG+S 
Sbjct: 614 ERIRVPEILFQPSMGGQDQAGIIELCETILTKKFGSEQRKLSPTALAMANNLWITGGNSK 673

Query: 309 YPGLPSRLEKEL 320
            PG+  R+ KE 
Sbjct: 674 LPGMKERIVKEF 685

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 88/202 (43%), Gaps = 15/202 (7%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS 61
           +P+TPI LD G+  V+ G   ++ P + FP+     I+R +ER  I   L    IG++ S
Sbjct: 37  NPNTPIALDFGSYEVRAGFTSQDTPSHVFPT----KIVRYKER-KIQKAL--TFIGNDCS 89

Query: 62  ---DVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTS-GGKVLLTEPPMNPLR 117
               VRS+ +   P +  +I NW  ME +  Y F+     P+      ++LTE       
Sbjct: 90  LDNAVRSHSR--SPYDGSLITNWEYMEDMLSYTFHHLGVQPNDGISNPMILTEKMATVQA 147

Query: 118 NREQMCEVMFEKYDFGGVYVAIQAVLALYAQGL--XXXXXXXXXXXXTHIVPVYESVVLS 175
            R    +++FE Y    V   I  + + YA                 T+I+PV +   + 
Sbjct: 148 QRSNWYQLLFECYGIPQVTFGIDGLFSFYANNSPDSTGLIINSGHEDTNIIPVIKGKGIL 207

Query: 176 HLTKRLDVAGRDVTRHLIDLLS 197
              KR+D  G     +L  LLS
Sbjct: 208 SEAKRIDWGGNQSIDYLKSLLS 229

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 7/72 (9%)

Query: 256 ERFEAPECLFQPSLVDVEQPGVGEML-------FNTVQAADVDVRTALYRAVVLSGGSSM 308
           ER  APE +FQPS+  ++Q G+ E+        F +  +        +   + ++GG++ 
Sbjct: 611 ERIRAPEVIFQPSMGGLDQAGIAELADGILTKKFGSGSSKLSQQCLDMASNIFITGGNTK 670

Query: 309 YPGLPSRLEKEL 320
            P L  R+  E 
Sbjct: 671 IPNLRERIVNEF 682

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 92/234 (39%), Gaps = 17/234 (7%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS 61
           +P  PI +D G+  V+ G   E  P + FP+ + R   R   +    T       G++ S
Sbjct: 34  NPEIPIAIDFGSSTVRAGYTNEARPSHIFPTKLTRYRDRKINKTFTFT-------GNDCS 86

Query: 62  ---DVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTS-GGKVLLTEPPMNPLR 117
               +RS  Q+  P +  +I NW  +E +  Y F     +P       +++TE       
Sbjct: 87  LDQTIRS--QMKSPFDGALITNWDYVEDILQYTFNHLGVVPDHGVQNPIIITEKLATIQS 144

Query: 118 NREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTH----IVPVYESVV 173
            R    +++FE Y+       I ++ A Y                +H    I+P+ +   
Sbjct: 145 QRSNWYQLLFETYNVPKATFGIDSLFAFYNNNNGSATSTGMVIDCSHEETNIIPIVDGQG 204

Query: 174 LSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLD 227
           +    KR++  GR    +L +LL+ +   F           + +  CYVS D D
Sbjct: 205 ILTDAKRINWGGRHAIDYLSNLLALKYPYFPTKLSSYQYESMYQNFCYVSQDYD 258

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 61/139 (43%), Gaps = 18/139 (12%)

Query: 251 IKVGSERFEAPECLFQPSLVDVEQPGVGEM-------LFNTVQAADVDVRTALYRAVVLS 303
           I +  ER   PE +FQPS+  ++Q G+ E+        F +      ++   +   + L+
Sbjct: 611 IHLNVERIRVPEIVFQPSMGGLDQAGIAELSETILLRKFGSEPKHLSELSLTMANNIWLT 670

Query: 304 GGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANI 363
           GG+S  PGL  R+ KE ++               +F V +   P      + G A LA  
Sbjct: 671 GGNSKIPGLRERIVKEFREFLPVNT---------QFNVNMTSDP--TFDAWNGMAKLAQN 719

Query: 364 MADKDHMWLTKQEWQEMGP 382
             D     ++K+E++E GP
Sbjct: 720 ETDYKKTIISKKEYEEYGP 738

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 103/238 (43%), Gaps = 18/238 (7%)

Query: 3   PHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS- 61
           P  PI +D G+  VK G   ++ P + F + + R   R  + A   T      IG++ + 
Sbjct: 35  PDIPIAIDFGSYNVKAGYTNQSLPTHVFTNKLTR--YRDRKLAKTMT-----FIGNDTNL 87

Query: 62  DVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSG---GKVLLTEPPMNPLRN 118
           D    +Q   P +   I NW   E ++DY  +  + + +T+G     ++LTE        
Sbjct: 88  DQPLRIQAKRPYDGLFIANWEYAEEIFDYTLH-HLGVQTTNGSISNPIILTEKMACLQSQ 146

Query: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXX----XXXXXXTHIVPVYESVVL 174
           R    +++FE +D       + ++ A Y                    T+IVP+ +   +
Sbjct: 147 RANWYQLLFETFDVPSATFGLDSLYAFYNNCANPFESDGLVINCGHEDTNIVPIVQGKGI 206

Query: 175 SHLTKRLDVAGRDVTRHLIDLLS-RRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTK 231
               KR++  GR  T +L  LL+ +  Y   + ++F+  + + E  CYVS + + D K
Sbjct: 207 LTEAKRINWGGRHSTEYLSSLLTLKYPYFPTKLSEFQ-YQTMYEDFCYVSPNYNEDIK 263

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 64/147 (43%), Gaps = 28/147 (19%)

Query: 251 IKVGSERFEAPECLFQPSLVDVEQPGVGEM-------LFNTVQAADVDVRTALYRAVVLS 303
           I +  ER   PE +FQPS+   +Q G+ E+        FN+       +   +   V L+
Sbjct: 617 IHMNVERIRVPEVMFQPSIGGCDQAGISELSETLFLRKFNSSPRKLSSISERMLNNVWLT 676

Query: 304 GGSSMYPGLPSRLEKELKQLW-----FTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGA 358
           GG +  PGL  R+ KE  +        +  + NDPS LD +K               G A
Sbjct: 677 GGHAKLPGLKERIVKEYTEFLPVGTKMSINISNDPS-LDTWK---------------GMA 720

Query: 359 VLANIMADKDHMWLTKQEWQEMGPAAM 385
            LA+       + +TK++++E GP  M
Sbjct: 721 KLASNTDYLKKIQVTKKDYEEYGPEYM 747

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 65/139 (46%), Gaps = 28/139 (20%)

Query: 256 ERFEAPECLFQPSLVDVEQPGVGEML-------FNTVQAADVDVRTALYRAVVLSGGSSM 308
           ER   PE LFQP++   +Q G+ E+        F + Q    DV T++ + V ++GG++ 
Sbjct: 611 ERIRVPEVLFQPNMGGEDQAGIPELCETLLLRKFGSTQRQLSDVSTSMAQNVWITGGNAK 670

Query: 309 YPGLPSRLEKELKQLW-----FTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANI 363
            PGL  R+ KE  +       F+     DPS LD ++               G A LA  
Sbjct: 671 LPGLRERIVKEFSEFLPSGSPFSIRKSQDPS-LDAWR---------------GMAKLAQN 714

Query: 364 MADKDHMWLTKQEWQEMGP 382
             D  H ++TKQE+ E GP
Sbjct: 715 TEDFKHGYITKQEYLEYGP 733

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 101/239 (42%), Gaps = 15/239 (6%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS 61
           +P+ PI +D G+  ++ G   +  P + FP+ + R   R  + A   T      IG++ S
Sbjct: 34  NPNVPIAIDFGSSKLRAGYVNDPNPSHIFPNRLTR--YRDRKLAKTMT-----FIGNDTS 86

Query: 62  -DVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSG--GKVLLTEPPMNPLRN 118
            D    +Q     +  ++ NW  +E   +Y F   + + +  G    +++ E        
Sbjct: 87  LDQAVRVQAKSAFDGPLVTNWDYVEDTLEYTF-NHLGVAANGGISNPLVINERLATIQSQ 145

Query: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQG--LXXXXXXXXXXXXTHIVPVYESVVLSH 176
           R    +++FE +D  GV   I ++   Y                  T+++PV +   +  
Sbjct: 146 RANWYQILFECFDVPGVTFGIDSLFGFYHNSGPNSTGLVIGCGNEDTNVIPVVDGKGVLT 205

Query: 177 LTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYV--SYDLDLDTKLA 233
            +KR++  G   T +L +L+S +   F         + + E  CYV  SYD +L+  L+
Sbjct: 206 ESKRINWGGNQATEYLTNLMSLKYPYFPTKLSPFQYKTMYEDYCYVSQSYDEELEKYLS 264

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 84/188 (44%), Gaps = 24/188 (12%)

Query: 163 THIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYV 222
           T I+PV + +      K++D+ GR +T  L + LS R Y  N + +   V  IKEK  +V
Sbjct: 204 TWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFRHY--NVTDETILVNNIKEKCLFV 261

Query: 223 ---SY--DLDLDTKLARE------TTTLV------ENYELPD-GRVIKVGSERFEAPECL 264
              SY     L  K A E       TT +         +LPD  ++I +  E F   E +
Sbjct: 262 APKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETI 321

Query: 265 FQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKEL-KQL 323
           F P +  + +PG+ E +  ++      +R  +   +V  GG+   P    RL  EL +QL
Sbjct: 322 FHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQL 381

Query: 324 ---WFTRV 328
              W T V
Sbjct: 382 PTDWTTHV 389

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 60/136 (44%), Gaps = 16/136 (11%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRS 65
           PIV+D G+  +K G +    P         R I    +    T  L + + G    D+ S
Sbjct: 5   PIVIDNGSYEIKFGVSNSRIP--------FRAINAIAKDKYNTVYLSNQIKG--IKDISS 54

Query: 66  YLQISYPMENGIIKNWADMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPMNPLRNRE 120
            +    P E G + +W     +WDY FY     +  +L  TS   ++++E  ++      
Sbjct: 55  -VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR 113

Query: 121 QMCEVMFEKYDFGGVY 136
            +  ++FE+Y++G +Y
Sbjct: 114 NIDHIIFEEYNYGSIY 129

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 94/231 (40%), Gaps = 13/231 (5%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS 61
           DP+ PI +D G+  V+ G   ++ P + FP+ + R   R   +           +G++ +
Sbjct: 34  DPNVPIAIDFGSSEVRAGYTNQSLPSHVFPTRLTRHRDRKINKTF-------TFVGNDTN 86

Query: 62  DVRSY-LQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSG--GKVLLTEPPMNPLRN 118
             ++   Q   P +  +I NW  +E + +Y F   + +    G    +LLTE        
Sbjct: 87  LEQTLRTQSRSPFDGPMITNWDYVEDMMEYTF-NHLGVVGHDGISNPILLTEKMATLQSQ 145

Query: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYA--QGLXXXXXXXXXXXXTHIVPVYESVVLSH 176
           R    ++MFE +    +   I ++ + +A  Q              T+++PV     +  
Sbjct: 146 RSNWYQLMFECFGVPKLTFGIDSLFSYFANNQSDSTGLVISSGNEDTNVIPVVCGKGILS 205

Query: 177 LTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLD 227
             KR++  GR    +  +LLS +   F         + I    CYVS D D
Sbjct: 206 EAKRINWGGRHSVEYTTNLLSLKYPYFPTKLVSSQFQSIYHDFCYVSRDYD 256

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 62/139 (44%), Gaps = 18/139 (12%)

Query: 251 IKVGSERFEAPECLFQPSLVDVEQPGVGEM-------LFNTVQAADVDVRTALYRAVVLS 303
           + +  ER   PE +FQP +  ++Q G+ E+        F + +     V   +   V L+
Sbjct: 605 MHLNVERIRVPEVIFQPPMGGLDQAGIIELSETIIMNKFGSSRRQLSSVSQEMANNVFLT 664

Query: 304 GGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANI 363
           GG+   PGL  R+ +E     FT  L   P    K+ +++   P      + G A  A  
Sbjct: 665 GGNVRVPGLRDRIVRE-----FTEFL---PVGT-KYNIKVASDPAID--AWKGMAKFAQS 713

Query: 364 MADKDHMWLTKQEWQEMGP 382
             D    ++TK+E++E GP
Sbjct: 714 STDYKGSYVTKKEYEEYGP 732

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 95/232 (40%), Gaps = 9/232 (3%)

Query: 3   PHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASD 62
           P  PI +D G+  ++ G      P + F + + R   R  +     T + + +  D+A  
Sbjct: 35  PDVPIAVDFGSNQLRAGLINRATPSHVFTNRITR--FRDRKLMKTMTFIGNDVNLDQA-- 90

Query: 63  VRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTS-GGKVLLTEPPMNPLRNREQ 121
           VR+  Q   P +  ++ NW  +E + +Y F      P+      +L+TE        R  
Sbjct: 91  VRA--QSKSPFDGPMVTNWDYVEDILEYTFNHLGSTPNNGISNPILVTERLATLQTQRSS 148

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXX--XXXXXTHIVPVYESVVLSHLTK 179
             +V+FE ++  GV   I ++ A Y                  T+I+PV +   +    K
Sbjct: 149 WYQVLFECFNVPGVTFGIDSLFAYYQNTTANSTGLVIGCGNEDTNIIPVVDGQGMLTEAK 208

Query: 180 RLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTK 231
           R++  G     +L +L++ +   F         R + E  CYVS D D + K
Sbjct: 209 RINWGGSQAADYLTNLMTLKYPYFPTKLSNFHYRTMYEDYCYVSQDYDEELK 260

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 61/139 (43%), Gaps = 18/139 (12%)

Query: 251 IKVGSERFEAPECLFQPSLVDVEQPGVGEML-------FNTVQAADVDVRTALYRAVVLS 303
           + +  ER   PE  FQP++   +Q GV E+        F         + + + + V ++
Sbjct: 607 MHLNVERIRVPEVFFQPTMCGEDQAGVSELCERVLLSKFGASPRQMSSITSEMAKNVWVT 666

Query: 304 GGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANI 363
           GG++  PGL  R+ KE     FT  L  + S    F V I   P      + G A  A  
Sbjct: 667 GGNAKIPGLRERIVKE-----FTGFLPVNTS----FNVNISSDPSLD--AWRGMAKYAQN 715

Query: 364 MADKDHMWLTKQEWQEMGP 382
             D    +++K+E++E GP
Sbjct: 716 ETDYKKSFISKKEYEEYGP 734

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/230 (23%), Positives = 96/230 (41%), Gaps = 15/230 (6%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS 61
           D   PI +D GT  VK G   +  P + FP+ + R   R  + +   T      IG++ +
Sbjct: 35  DSSIPIAIDFGTCSVKAGYVNKADPAFNFPTRLTR--FRDRKMSRTMT-----FIGNDTN 87

Query: 62  -DVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSG--GKVLLTEPPMNPLRN 118
            D     Q   P +   + NW   E + +Y F + + + +  G    +++TE        
Sbjct: 88  LDYAVRSQSKTPFDGPFVTNWEYAEDILEYTF-KHLGVTANHGISNPLIMTEKLATLQSQ 146

Query: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXX--XXXXXTHIVPVYESVVLSH 176
           R    +++FE ++   V   I  V A YA                 T+++P+ +   +  
Sbjct: 147 RANWYQLLFETFNTSNVSFGIDNVFAFYANTDKHSSGLVFGLNNQDTNVIPIIDGKPVLT 206

Query: 177 LTKRLDVAGRDVTRHLIDLLS-RRGYAFNRSADFETVRQIKEKLCYVSYD 225
            TKR++  G     +L DL++ +  Y   +  +F+     K+  CYVS D
Sbjct: 207 DTKRINWGGSQSVGYLSDLMTLKYPYFPTKLTEFQYETLYKD-YCYVSPD 255

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 63/134 (47%), Gaps = 18/134 (13%)

Query: 256 ERFEAPECLFQPSLVDVEQPGVGEM-------LFNTVQAADVDVRTALYRAVVLSGGSSM 308
           ER   PE LFQP +   +Q G+ E+        F +  +   D   A+ + V ++GG + 
Sbjct: 618 ERPRVPEILFQPRMGGCDQAGIIELSETMLLKKFGSKPSKLSDQAEAMAKNVWITGGHAQ 677

Query: 309 YPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKD 368
            PGL +R+ KE     FT  L ND     KF V I   P      + G A  ++  AD  
Sbjct: 678 LPGLKTRIVKE-----FTSFLPNDA----KFSVNISKHPSLD--AWKGMAKFSSDDADFK 726

Query: 369 HMWLTKQEWQEMGP 382
              ++K+E++E GP
Sbjct: 727 SSLISKKEYEEYGP 740

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/231 (20%), Positives = 92/231 (39%), Gaps = 9/231 (3%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS 61
           DP+ PI +D G+  ++ G    + P + FP+   +       R   T      +  D   
Sbjct: 38  DPNIPIAIDFGSYELRAGYTNISRPSHIFPNRFSK------YRDRKTNKYLPCIGYDTWL 91

Query: 62  DVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRN-RE 120
           D  +  Q   P +  ++ NW  +E +  Y F+     P       ++    +  L++ R 
Sbjct: 92  DQTTRSQARSPFDGPLVVNWDMVEDILQYTFHHLGVQPDNGVTNPIIINEKLACLQSQRS 151

Query: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQ--GLXXXXXXXXXXXXTHIVPVYESVVLSHLT 178
              + +FE +    V +A++ +LA Y    G             T+++P+ E   +    
Sbjct: 152 NWYQTLFESFGVPKVSMAVEGMLAFYGHNGGSSTGIVIDCGYEDTNVIPIVEGQGMMLDA 211

Query: 179 KRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLD 229
           KR++  G     +L +LL  +   F     +    ++ +  CYVS D + D
Sbjct: 212 KRINWGGHSSIDYLSNLLYLKYPYFPTKLSYLQYEKMYKDYCYVSQDYETD 262

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 59/138 (42%), Gaps = 18/138 (13%)

Query: 251 IKVGSERFEAPECLFQPSLVDVEQPGVGEML-------FNTVQAADVDVRTALYRAVVLS 303
           + +  ER   PE +FQP L   +Q G+ E+        F +           + + V L 
Sbjct: 612 MHINVERIRVPEVMFQPILGGQDQAGITEICETIITKKFGSTPRNLSQQSLDMAKNVWLV 671

Query: 304 GGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANI 363
           GG++  PGL SR+ KE     FT  L +D     K  V I + P     V+ G   LAN 
Sbjct: 672 GGNAQVPGLKSRVVKE-----FTEFLPSDT----KINVNISEAPTLD--VWNGMYRLANT 720

Query: 364 MADKDHMWLTKQEWQEMG 381
             D     +T +E+ E G
Sbjct: 721 EEDYQRTIVTSEEYDECG 738

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/227 (21%), Positives = 92/227 (40%), Gaps = 10/227 (4%)

Query: 2   DPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS 61
           DP+  I +D G+  ++ G   +N P Y FP+ + +   R  ++ + T    D ++     
Sbjct: 34  DPNARIAIDFGSYNIRAGYTNQNTPSYIFPTRLTKHRDRKLQK-TFTFIGNDTLLD---Q 89

Query: 62  DVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSG--GKVLLTEPPMNPLRNR 119
            +RS  Q   P +  ++ NW  +E + +Y F+  + +   +G    +++ E        R
Sbjct: 90  TIRS--QSKSPFDGTLLTNWDYVEDMLEYTFH-HLGVSGNNGVSNPLIINERLACLQSQR 146

Query: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXX-XXXXXXXXXTHIVPVYESVVLSHLT 178
               +++FE +D   V   I ++ + Y                 T ++P+     +    
Sbjct: 147 NSWYQLLFETFDLPEVSFGIDSLFSFYGNSTKEDGLVINCGNEETDVIPIVGGRGILSEC 206

Query: 179 KRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYD 225
           KR++  G   T  L  LL+ +   F          Q+ E  CY S D
Sbjct: 207 KRINWGGSQSTNFLSSLLTLKYPYFPAKLSTLQYTQMYEDYCYTSPD 253

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 65/144 (45%), Gaps = 28/144 (19%)

Query: 251 IKVGSERFEAPECLFQPSLVDVEQPGVGEML-------FNTVQAADVDVRTALYRAVVLS 303
           + + +ER   PE LF+PS+   +Q G+ E+        F +         + +   V ++
Sbjct: 608 LHLNTERIRVPEILFEPSIAGQDQAGIAELCETILLKKFGSKPGNLSAASSRMVNNVWIT 667

Query: 304 GGSSMYPGLPSRLEKELKQLW-----FTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGA 358
           GG++  PG+ +R+ KE  +        +  +  DPS LD +K               G A
Sbjct: 668 GGNARIPGIKNRIVKEFTEFLPAGTPLSVHMSEDPS-LDAWK---------------GMA 711

Query: 359 VLANIMADKDHMWLTKQEWQEMGP 382
            LAN   D  +  +T++E++E GP
Sbjct: 712 KLANNETDYKNTAVTRKEYEEYGP 735

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 92/227 (40%), Gaps = 9/227 (3%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRS 65
           PI +D G+  +K G   ++ P   FP+ + R   R   R ++T    DI + D+A  VR+
Sbjct: 39  PIAIDFGSNTLKAGYTNQDVPSLVFPTRLTRFRDRRLNR-TMTFIGNDISL-DQA--VRA 94

Query: 66  YLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLR-NREQMCE 124
             Q   P +  ++ NW  ++ + +Y F     L        L+    +  ++  R Q  +
Sbjct: 95  --QSKSPFDGSMVTNWEYIDEMLEYTFKHLGVLGDNGISNPLIFSEKLAVVQAQRSQWYQ 152

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXX--XXXXTHIVPVYESVVLSHLTKRLD 182
           ++FE ++       I    A +A                 T+++P+   V      KR++
Sbjct: 153 LLFETFNISKATFGIDNQFAFFANNSIDSTGLMIGCNNEDTNVIPIVNGVASLQECKRIN 212

Query: 183 VAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLD 229
             G     ++ +LLS +   F         +++    CYVS D   D
Sbjct: 213 WGGNHAVSYMNNLLSLKYPYFPTKLTDLQYQKLYHDYCYVSPDYSAD 259

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 59/134 (44%), Gaps = 19/134 (14%)

Query: 256 ERFEAPECLFQPSLVDVEQPGVGEML-------FNTVQAADVDVRTALYRAVVLSGGSSM 308
           ER   PE LFQP++   +Q GV E+        F +           +   + LSGG++ 
Sbjct: 613 ERIRVPEVLFQPTMGGCDQAGVAELCETILLKKFGSSPNQLSKTAEDMANNIWLSGGNAK 672

Query: 309 YPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKD 368
            PGL +R+ KE     FT  L   P    K  V +   P      + G A  A    D +
Sbjct: 673 VPGLKNRIVKE-----FTSFL---PVGT-KLSVNMSSDPLLDS--WKGMAKWAK-SEDYN 720

Query: 369 HMWLTKQEWQEMGP 382
             ++TK+E++E GP
Sbjct: 721 KSFITKKEYEEYGP 734

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 93/232 (40%), Gaps = 23/232 (9%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRS 65
           PI +D G+  V+ G      P   FP+ + R   R   +AS T        G +AS +R+
Sbjct: 42  PIAIDFGSYEVRAGYVANKEPALVFPTRLARYRDR---KASRTYTFVGRDTGLDAS-IRT 97

Query: 66  YLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGG----KVLLTEPPMNPLRNREQ 121
             Q   P +  ++ NW  ++ +  Y F+    L    GG     V+LTE        R  
Sbjct: 98  --QSRSPFDGPMVTNWDYVDDMLAYTFHH---LGVRGGGGVPNAVVLTERLATLQSQRAN 152

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQ------GLXXXXXXXXXXXXTHIVPVYESVVLS 175
             E+++E Y+   V   I ++ + Y +      GL            T +VPV +   + 
Sbjct: 153 WYELLYEAYNLQEVTFGIDSLFSFYGERGPGSTGLVVSSGNED----TCVVPVVDGRGVV 208

Query: 176 HLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLD 227
              KR++  G+    +L  LL+ +   F           I  + CYV+ D +
Sbjct: 209 SEAKRINWGGQQAVDYLTGLLALKYPYFPTKLSGSQFETIYREHCYVAEDFE 260

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 64/139 (46%), Gaps = 18/139 (12%)

Query: 251 IKVGSERFEAPECLFQPSLVDVEQPGVGEML-------FNTVQAADVDVRTALYRAVVLS 303
           + +  ER   PE +FQPS+  ++Q GV E+        F++ + A       + + V ++
Sbjct: 609 MHINVERIRVPEVIFQPSIGGLDQAGVVELCETVLLKKFDSSRRALSATCEKMAKNVFIT 668

Query: 304 GGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANI 363
           GG++  PG+  R+ +E     FT  L   P   +  KV +   P      + G A  A+ 
Sbjct: 669 GGNTKLPGIRERIVRE-----FTGFL---PVGTE-LKVTLAKDP--SLSAWKGMAKFASD 717

Query: 364 MADKDHMWLTKQEWQEMGP 382
                   LTK+E++E GP
Sbjct: 718 PTSYKSSILTKREYEEYGP 736

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 64/134 (47%), Gaps = 18/134 (13%)

Query: 256 ERFEAPECLFQPSLVDVEQPGVGEML-------FNTVQAADVDVRTALYRAVVLSGGSSM 308
           ER   PE +FQPS+  ++Q G+ E+        F + +    ++   + + + ++GG++ 
Sbjct: 609 ERIRVPEVIFQPSIGGLDQAGIVELCETLLLKKFGSNRRELSEISKMMAKNIFITGGNAK 668

Query: 309 YPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKD 368
            PG+  R+ +E     F  V  N   +L       EDP       + G A  AN  +  +
Sbjct: 669 LPGIRERVVREF--TGFLPVGTNLNVKL------AEDPS---MSAWRGMAKFANNTSLYE 717

Query: 369 HMWLTKQEWQEMGP 382
              +TK+E++E+GP
Sbjct: 718 TSIMTKKEYEELGP 731

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 56/250 (22%), Positives = 93/250 (37%), Gaps = 21/250 (8%)

Query: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEAS-DV 63
           TPI +D G+  V+ G   +  P   F + + R   R   R           +G++ + D 
Sbjct: 37  TPIAIDFGSYEVRAGYVNQGDPALVFTNRLARYRDRKASRTYT-------FVGNDTNLDQ 89

Query: 64  RSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSG--GKVLLTEPPMNPLRNREQ 121
               Q   P +  +I NW  ++ +  Y F+  + +    G    VL+TE        R  
Sbjct: 90  SIRTQSKSPFDGSMITNWDYVDDILAYTFH-HLDVRGNGGVPNPVLITERMAALQSQRSN 148

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQG--LXXXXXXXXXXXXTHIVPVYESVVLSHLTK 179
             E++FE Y+   V   I ++ + Y +                T ++PV     +    K
Sbjct: 149 WYELLFECYNLQKVTFGIDSLFSFYGEHPPGTTGIAINSGNEDTSVIPVVNGKGILTEAK 208

Query: 180 RLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTL 239
           R++  G+    +L  LLS +   F           +    CY S      T    E +TL
Sbjct: 209 RINWGGQQSVGYLNGLLSLKYPYFPTKLVNNQFESMYRDFCYFS------TNFEEEISTL 262

Query: 240 V--ENYELPD 247
           +  EN E  D
Sbjct: 263 LTMENLESKD 272

>SAKL0H17358g Chr8 complement(1535040..1535975) [936 bp, 311 aa]
           {ON} weakly similar to uniprot|Q04549 Saccharomyces
           cerevisiae YDR106W ARP10 Actin-related protein
          Length = 311

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/250 (18%), Positives = 100/250 (40%), Gaps = 42/250 (16%)

Query: 83  DMELLWD--YAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQ 140
           D E LW   Y  Y    + + S  KV++ E  + PL  +E +C+V+ ++     +     
Sbjct: 37  DEEFLWRLFYKCYHDELMVAPSSTKVVIIENVLLPLNCKELLCQVLLKRLLVSSIVFVPD 96

Query: 141 AVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAGRDVTRHL-------- 192
            ++  ++ G+              +VP+ +  +L + +   + AG+ +  +L        
Sbjct: 97  VLMTCFSSGVKDGLVIDVGWEYVAVVPILDLRILDNWSHISNKAGKFLYDNLKEILPPGT 156

Query: 193 -IDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELPDGRVI 251
            +D+L  +  A     DF+                       RE +      E+ +G + 
Sbjct: 157 DLDILVPQIMACEGDKDFQY----------------------REISI---TKEVRNGFLK 191

Query: 252 KVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPG 311
           K      E       P   D ++  + +++  T++   VDV+  ++  ++++G +S  PG
Sbjct: 192 KTIGHFDE------DPLEYDDDELPISQVVLKTLKDLPVDVKKRVFPHLMITGLASNIPG 245

Query: 312 LPSRLEKELK 321
              +L KE+K
Sbjct: 246 FKMKLLKEVK 255

>AFR135W Chr6 (680340..682715) [2376 bp, 791 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR141C (ARP8)
          Length = 791

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 59/150 (39%), Gaps = 15/150 (10%)

Query: 69  ISYPMENGIIK----NWADM-ELLWDYAFYEQMKLPSTSGG---------KVLLTEPPMN 114
           I YP  NG       +++ + ELL D        L  T  G         KV+L  P + 
Sbjct: 302 IRYPFSNGAFNVECPDYSSLQELLNDVTKLITFALSETKLGISRSQFPNYKVILIIPDLF 361

Query: 115 PLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX-XXXTHIVPVYESVV 173
                EQM  ++  + +F  V +  +++   Y  GL             T I  V E  V
Sbjct: 362 EKNYVEQMIRLLLSEMNFQAVALIQESLATCYGAGLSNSTCVIDIGASETKISCVDEGQV 421

Query: 174 LSHLTKRLDVAGRDVTRHLIDLLSRRGYAF 203
           + +   RL   G D+TR  ++LL +  + +
Sbjct: 422 IQNSCIRLSYGGDDITRLFVELLLQSNFPY 451

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 37.0 bits (84), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 54/281 (19%), Positives = 111/281 (39%), Gaps = 41/281 (14%)

Query: 76  GIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPM----NPLRNR--EQMCEVMFEK 129
           G+  NW  +E  W+Y F +Q+K   T    VL+T P        + N+  EQ C++ FEK
Sbjct: 73  GVPYNWEALEKQWEYIFEKQLKCDPTE-LPVLITIPSSISKNEDIENKVIEQYCKIAFEK 131

Query: 130 YDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSH------------- 176
           +    + +  +++      G             + + P+ + V++ +             
Sbjct: 132 FKIPYLQIVNESLSISLGLGKKTSLVIDISGSGSSVTPIVDGVIIKNGIVKSKYGGDFLD 191

Query: 177 --LTKRLDVAGRDVTRHLID----LLSRRGY--AFNRSADFETVRQIKEKLCYVSYDLDL 228
             + K+      D+   + +     +S   +   F ++    T +++++   Y    L L
Sbjct: 192 YQIIKKFSTIDEDLEEEMTNSSNIWVSSNSWIKNFKKTMLQVTDKKLQDVEKYYEEQLRL 251

Query: 229 DTKLARETT---------TLVENYELPDGRVIKVGS-ERFEAPECLFQPSLVDVE---QP 275
             +L  + +         ++ + Y     + +   S E ++  E LFQP L   +     
Sbjct: 252 QAELQNQGSITSVGTNPLSVKKEYLYRSRKTVTFESRELYQFGEYLFQPQLASEQYNRDD 311

Query: 276 GVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRL 316
           G+GE+++ ++ +A +    A   A    GGSS   G  S +
Sbjct: 312 GLGELIYRSITSAAMGNMPAAVAASNNIGGSSGATGGDSNV 352

>Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}
           complement(25137..27767) [2631 nt, 877 aa]
          Length = 876

 Score = 37.0 bits (84), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 57/141 (40%), Gaps = 4/141 (2%)

Query: 67  LQISYPMENGIIKNWADMELLWDYAFY---EQMKLPSTSGGKVLLTEPPMNPLRNREQMC 123
           L +  P  + + +  +D+  L++YA     E +        KV+L  P +    + E + 
Sbjct: 406 LNLDSPYYSSLPELLSDVTRLFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLY 465

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX-XXXTHIVPVYESVVLSHLTKRLD 182
            ++ ++  F  V +  +++ A Y  G+             T I  V E  VL +   +LD
Sbjct: 466 RILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLD 525

Query: 183 VAGRDVTRHLIDLLSRRGYAF 203
             G D+TR     L    + F
Sbjct: 526 YGGDDITRLFTLFLLENNFPF 546

>KLLA0F11913g Chr6 complement(1094612..1095373) [762 bp, 253 aa]
           {ON} weakly similar to uniprot|Q04549 Saccharomyces
           cerevisiae YDR106W ARP10 Actin-related protein
          Length = 253

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 13/98 (13%), Positives = 45/98 (45%)

Query: 91  AFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGL 150
           +++  + + ++ G K++++EP    +  ++++C+V+F +     +      + A    G+
Sbjct: 47  SWFHDILMYNSKGVKIVISEPLWLSILRKQRLCKVLFGRLKVNSICFVPNCLAAFIGAGI 106

Query: 151 XXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAGRDV 188
                       T ++P+++  +L   ++   +   +V
Sbjct: 107 RNGLYIEVNSKNTELIPIFDGRILDSYSRSSKLGSDNV 144

>NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 34/197 (17%), Positives = 76/197 (38%), Gaps = 5/197 (2%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSY 66
           +V+  GT     G    + P    P++  +     +++      L DI       D   Y
Sbjct: 11  VVIQNGTNTTLAGFNNVDLPQCVIPTVYIQD-NSTQKKIFGNFELLDIASSRSNDDAGRY 69

Query: 67  LQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNR---EQMC 123
              +    NG+  NW  ++  W+Y + E +K  S     +++T P  N   +    ++  
Sbjct: 70  EVFTIFDRNGLPYNWDALKEQWEYIYREVLKCNSDE-YPLVITIPSANKDVDEIILKKYF 128

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDV 183
           E+ FE ++   + + I+ +    + G              ++ P+ +  V+ H   +   
Sbjct: 129 ELAFETFNVPVLQIIIEPLAVALSLGKSSSLVVNLGASGCNVTPIVDGTVIKHAVMKSKY 188

Query: 184 AGRDVTRHLIDLLSRRG 200
            G  +   ++++L  +G
Sbjct: 189 GGDFLDFQIVNILQEKG 205

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 63/163 (38%), Gaps = 48/163 (29%)

Query: 256 ERFEAPECLFQPSLVD---VEQPGVGEMLFNTVQAADVDVRT------------------ 294
           E ++  E LFQP L       + G+ E++   V+ A   V T                  
Sbjct: 265 ECYKLAEMLFQPQLASDQFAAKEGLAELVVKAVKKAGAAVTTSNSGPAGGGGPSGSSSMG 324

Query: 295 --------------ALYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRN--DPSRLDK 338
                         AL   +V++G +S+ PG+  R+  EL   +    L +  +P  LD 
Sbjct: 325 IGASSTTTPEQIHAALLTNIVITGSTSLVPGVEQRIVNELSYQFPQYKLSSFANPMVLD- 383

Query: 339 FKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLTKQEWQEMG 381
                     RK   + GG  ++N+ + +   W+T+QE+   G
Sbjct: 384 ----------RKLQSWQGGVTMSNLPSWELGNWITRQEYDANG 416

>KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7.448
           YPR034W
          Length = 490

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 48/115 (41%), Gaps = 4/115 (3%)

Query: 74  ENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMN---PLRNREQMCEVMFEKY 130
           ENG+  NW  +E  W Y F  ++K  S     +++T P M     LR  E+  ++ F K+
Sbjct: 70  ENGVPYNWEALERQWKYIFENELKCKSDE-FPLVITVPIMKDAVALRVMERYFDLAFNKF 128

Query: 131 DFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDVAG 185
           +   + V I+ +    + G              ++ PV +  V  +   +   AG
Sbjct: 129 NVPVLQVIIEPLAIALSMGKSSALVVDLGSSSCNVTPVIDGTVAKNSVLKSKYAG 183

>Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {ON}
           YOR141C (REAL)
          Length = 883

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 55/139 (39%), Gaps = 4/139 (2%)

Query: 67  LQISYPMENGIIKNWADMELLWDYAF-YEQMKLPSTSGG--KVLLTEPPMNPLRNREQMC 123
             I+ P    + +  +D+  L +YA   E + + ST     KV+L  P +    + E   
Sbjct: 410 FNINSPYYESLAELISDVTKLLEYALASETLNVKSTKFNQYKVVLVIPDVFKKNHVETFI 469

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX-XXXTHIVPVYESVVLSHLTKRLD 182
            V+  +  F  V V  +++   Y  G+             T I  V E  VL H    L+
Sbjct: 470 RVLLTELQFQAVAVIQESLATCYGAGISTSTCVVNIGATETRIACVDEGTVLEHSAVTLN 529

Query: 183 VAGRDVTRHLIDLLSRRGY 201
             G D+TR    LL +  +
Sbjct: 530 YGGDDITRLFALLLLQSDF 548

>NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {ON}
           Anc_7.448 YPR034W
          Length = 565

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 38/196 (19%), Positives = 73/196 (37%), Gaps = 7/196 (3%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSY 66
           IV+ QGT     G    + P    PS     I   +E   I      + I     D   Y
Sbjct: 13  IVIQQGTNTTIAGFNNSDLPQCVIPSTY---IYDKQEDKMIFGLYDMLDIATSLEDADRY 69

Query: 67  LQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNR---EQMC 123
              +   +NGI  NW  +E  W+Y F + ++  S     +++T P M    +    E+  
Sbjct: 70  EVFTILDKNGIPYNWEALEQQWNYLFNDVLRC-SPEEYPLVITIPSMKKEIDGEVLEKYF 128

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTKRLDV 183
            ++FE++ F    + ++ +    + G               + P+ +  V+ +       
Sbjct: 129 SLVFERFKFPVFQIILEPLAITLSLGKSSGLVIDMGSSGCRVTPIIDGTVIKNAVLSSKY 188

Query: 184 AGRDVTRHLIDLLSRR 199
            G  +   +I+ L ++
Sbjct: 189 GGAFLDYQIIETLQKK 204

>TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.593
           YMR033W
          Length = 484

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 57/302 (18%), Positives = 109/302 (36%), Gaps = 62/302 (20%)

Query: 72  PMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVL---LTEPPMNPLRNR-------EQ 121
           P+ENG+I N    +    Y +   +K              T  P+  L N        E 
Sbjct: 66  PIENGMIINLEAFQEFLKYIYISLLKQKHDENADSFEYSFTNIPLLLLNNHKWSQFQMES 125

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQ-GLXXXXXXXXXXXXTHIVPVYESVVLSHLTKR 180
           +   +FEK    G+ +   ++ A Y+   L            T IVP+ +   ++HL+  
Sbjct: 126 ITNFVFEKLKLNGLMLLPISLGASYSMVSLQNCCIIDIGLNHTDIVPIVDYTTINHLSNT 185

Query: 181 LDVAGRDVTRHLIDLL----SRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKL---- 232
           L+  G  +   L  LL     ++     +S  FE + + ++      ++  + T      
Sbjct: 186 LNYGGSYINTILQKLLPELNDQQIEDLKKSPIFEVLTEDEKNDSAFDFNNPITTSTKNKD 245

Query: 233 --------------ARETTTLVENYE-------LP------------DGRVIKVGSERFE 259
                          ++T  ++   E       LP            +G  IK+G +RF+
Sbjct: 246 DDDADFDVASIINSGKDTREILAEREKKNQKKSLPNSQLEFNTFKDNNGNQIKIGKQRFQ 305

Query: 260 APECLFQPSLVDVEQPGVGEMLFNTV-QAADVDVRTALYRAVVLSGGSSMYPGLPSRLEK 318
             + L Q          +   + +T+ Q  D+  + A++  +V+ G +S+  G    L  
Sbjct: 306 GCDELIQK---------ISTRVGHTINQLEDLSKQRAIWENIVIVGNTSLITGFKEALLN 356

Query: 319 EL 320
           +L
Sbjct: 357 QL 358

>Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {ON}
           YOR141C (REAL)
          Length = 873

 Score = 33.9 bits (76), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 50/128 (39%), Gaps = 4/128 (3%)

Query: 67  LQISYPMENGIIKNWADMELLWDYAFYEQ---MKLPSTSGGKVLLTEPPMNPLRNREQMC 123
             I+ P    + +  +D+  L +YA   +   +K    +  KV+L  P +    + E   
Sbjct: 400 FNINSPYYKSLAELISDVTKLLEYALKSETLNVKPAKFNQYKVVLVIPDIFKKSHIETFI 459

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX-XXXTHIVPVYESVVLSHLTKRLD 182
            V+  +  F  V +  +++   Y  G+             T I  V E  VL H    LD
Sbjct: 460 RVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGASETRIACVDEGTVLEHSAITLD 519

Query: 183 VAGRDVTR 190
             G D+TR
Sbjct: 520 YGGDDITR 527

>KLTH0B07502g Chr2 (604448..604460,604791..607777) [3000 bp, 999 aa]
           {ON} weakly similar to uniprot|Q07653 Saccharomyces
           cerevisiae YDL223C HBT1
          Length = 999

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 63/162 (38%), Gaps = 9/162 (5%)

Query: 185 GRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYE 244
           G    +HL DL  R+      S         K +    S+   ++T+  R TTT     +
Sbjct: 807 GESANKHLGDLEGRKTKENRSSGSHHDDVDPKTRSSETSH-PQMETRYERHTTTSP--SQ 863

Query: 245 LPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAAD----VDVRTALYRAV 300
            P   + +   E   A E +  PSLVD  QP  G    N    ++    V   +   R V
Sbjct: 864 SPQEGIQRYEEENVYAKEVVNMPSLVDPSQPTYGSGDRNRTSTSETTSYVTHGSQGKRNV 923

Query: 301 -VLSGGSSMYPGLPSRLEKELKQLWF-TRVLRNDPSRLDKFK 340
            V S G       PS++  E  +  +  R+ R++  R DK K
Sbjct: 924 SVGSAGGHEQMTEPSQMPVEKNEHSYEERIPRSERERFDKLK 965

>Suva_13.202 Chr13 (328209..328238,328325..329698) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 49/237 (20%), Positives = 89/237 (37%), Gaps = 44/237 (18%)

Query: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQ-GLXXXXXXXXXXXXTHIVPVYESVVLSHLT 178
           E + + +FE  +   +     ++ A Y+   L            T I+P+ +   L HL 
Sbjct: 125 ETITQYIFESLEINNLIQLPASLAATYSMISLQNCCIIDVGTYHTDIIPIVDYAQLDHLV 184

Query: 179 KRLDVAGRDVTRHLIDLLSR----RGYAFNRSADFETVRQIKEKLCYVSYDLD------- 227
             L V G+ +   L  LL +    +  +  +S  FE +    +KL    +  D       
Sbjct: 185 SSLPVGGQSINDSLKKLLPQWDDDQIESLKKSPIFEVLSDDAKKLSNFDFGNDNEDEDEE 244

Query: 228 -----------------LDTKLARETTTLVENYELP-------DGRVIKVGSERFEAPEC 263
                            L+ +   + T  V+N +L        +G  IKVG +RF+   C
Sbjct: 245 TLNVAEIITSGRDTREVLEERERSQKTKNVKNSDLEFNTFWDRNGNEIKVGKQRFQG--C 302

Query: 264 LFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKEL 320
               SL+      VG  L    +  D++   A++  +++ GG++   G    L  +L
Sbjct: 303 ---NSLLKSISNRVGLTL---DKIDDINKARAVWENIIIVGGTTSISGFKEALLGQL 353

>Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii AGR099C
          Length = 305

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 38/217 (17%), Positives = 87/217 (40%), Gaps = 28/217 (12%)

Query: 105 KVLLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTH 164
           K+++ E  +  +  ++++C V+ ++     V      ++A  A G+            T 
Sbjct: 61  KIVILENVLLDVPKKKRLCHVLLDRLMVSSVVFLPDILMACVAGGVTDAIVVDIGWENTV 120

Query: 165 IVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSY 224
           + P+ +  +L        +  + +        S+    F    + + VR IK        
Sbjct: 121 VAPIMDMRILEQHMGISKIGAKWIG-------SKLSSTFEIDGE-KIVRMIK-------- 164

Query: 225 DLDLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNT 284
              LDT +       +E  ++ D   I     + + PEC       D+++  +  ++  +
Sbjct: 165 ---LDTDINCNGVQ-IEWRDIEDCMEILWNINK-QDPEC-------DIDEFPIISLVLES 212

Query: 285 VQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELK 321
           ++   +DV++ + + V++ GG S   GL  RL + L+
Sbjct: 213 IKQLPIDVKSKVLQNVIIIGGLSKIQGLKERLIENLR 249

>YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON}
           ARP8Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes; has mRNA binding activity
          Length = 881

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 34/87 (39%), Gaps = 1/87 (1%)

Query: 105 KVLLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX-XXXT 163
           KV+L  P +    + E    V+  +  F  V +  +++   Y  G+             T
Sbjct: 449 KVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAET 508

Query: 164 HIVPVYESVVLSHLTKRLDVAGRDVTR 190
            I  V E  VL H    LD  G D+TR
Sbjct: 509 RIACVDEGTVLEHSAITLDYGGDDITR 535

>Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii AFR135W
          Length = 775

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 43/103 (41%), Gaps = 1/103 (0%)

Query: 102 SGGKVLLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX-X 160
           S   V+L  P +      EQM  ++  + DF  V +  +++ + Y  GL           
Sbjct: 333 SSYNVVLIIPDLFEKSYVEQMIRLLISEMDFQAVALIQESLASCYGAGLSNSTCVIDIGG 392

Query: 161 XXTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAF 203
             T I  V E  V+ +   +L   G D+T+   +LL +  + +
Sbjct: 393 SETKISCVDEGQVIQNSCIKLSYGGDDITKLFAELLLQSNFPY 435

>CAGL0F05907g Chr6 (591411..592799) [1389 bp, 462 aa] {ON} similar
           to uniprot|Q05123 Saccharomyces cerevisiae YMR033w ARP9
           Actin-related protein
          Length = 462

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 63/297 (21%), Positives = 111/297 (37%), Gaps = 85/297 (28%)

Query: 163 THIVPVYESVVLSHLTKRLDVAGRDVT----RHLIDLLSRRGYAFNRSADFETV----RQ 214
           T I+PV +   + HLT  +++ G  +     + L  L   +     RS  FE +    R+
Sbjct: 172 TDIIPVVDYTPMEHLTSTINLGGDSINTELAKKLPQLTETQIETLKRSTIFEVLSADARE 231

Query: 215 I-----KEKLCYVSYDLDLDTKLARETTTLVE------------NYEL-------PDGRV 250
           I      E++   + D+       R+T  ++E            N EL        DG+ 
Sbjct: 232 ILDTNDGEEMDEGALDVAAIVTSGRDTREVLEERERKKKQRNVKNAELDTNSFYDDDGQE 291

Query: 251 IKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYP 310
           I VG +RFE  E      L++     VG +L +    A       ++  +++ GG+S   
Sbjct: 292 ITVGKQRFEGTE-----KLIESISHRVGNVLAHIHDKAKA---RHIWENIIVVGGTSSIV 343

Query: 311 GLPSRLEKELKQLWFTRVL---------RNDPSRL---DKFKVRIED------------- 345
           G    L   + QL+   ++         R D ++     K K +  D             
Sbjct: 344 GFREAL---IAQLYKDHIIMEPEEERQDREDAAKASLSSKKKNKFLDNTLPTTEYIQVPT 400

Query: 346 -----------PPRRKH----MVFIGGAVLAN--IMADKDHMWLTKQEWQEMGPAAM 385
                      P  +KH    + F+G  ++        KD  ++T++ + E GPAA+
Sbjct: 401 SIKFAKYPDYFPEWKKHGYSEIPFLGAQIVCKQVFTHPKDTFYITRERYDEKGPAAI 457

>KNAG0B02110 Chr2 complement(399743..401200) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 46/87 (52%), Gaps = 9/87 (10%)

Query: 292 VRTALYRAVVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKH 351
           V T+L   V+++G +S+  G+ SR+ +EL        +R    +L  F    ++   R+ 
Sbjct: 396 VYTSLLTNVIITGAASLIDGIESRIIRELS-------IRFPQYKLVTFAN--QNLMDRQL 446

Query: 352 MVFIGGAVLANIMADKDHMWLTKQEWQ 378
             ++G A +AN+ + +   W TK++++
Sbjct: 447 QSWMGAATMANLPSWELGKWYTKEDYE 473

>Skud_16.321 Chr16 (604148..605587) [1440 bp, 479 aa] {ON} YPR034W
           (REAL)
          Length = 479

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 35/191 (18%), Positives = 75/191 (39%), Gaps = 24/191 (12%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSY 66
           +V+  G+     G +    P    PS     + R +E   +        + D A++ R+ 
Sbjct: 8   VVIHNGSHRTVAGFSNVELPQCIIPSSY---VKRTDEAGKVELIFGTYDMTDAAAEKRNG 64

Query: 67  LQISYPMEN-GIIKNWADMELLWDYAFYEQMK-----------LPSTSGGKVLLTEPPMN 114
            ++   +++ G+  NW  +E  W Y +  Q+K           +P+T+G      +P M+
Sbjct: 65  DEVYTLVDSQGLPYNWEALESQWRYLYDTQLKVSPNELPLVITMPATNG------KPDMS 118

Query: 115 PLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 174
            LR   +  E+ F+K +     + I+ +    + G              ++ P+ + +V+
Sbjct: 119 ILR---RYYELAFDKLNVPVFQIVIEPLAIALSMGKSSAFVIDMGASGCNVTPIIDGIVV 175

Query: 175 SHLTKRLDVAG 185
            +   R    G
Sbjct: 176 KNAVVRSKFGG 186

>KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.477
           YOR141C
          Length = 842

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 23/123 (18%), Positives = 49/123 (39%), Gaps = 1/123 (0%)

Query: 82  ADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQA 141
            D+  L ++   + ++  +    K +L  P +    + E+M  ++  +  F  V +  ++
Sbjct: 359 GDVIKLIEFGLNKLLEAKNKDKYKAILVIPDLFEKSHVEEMIRLLLTELPFNAVAIIQES 418

Query: 142 VLALYAQGLXXXXXXXXX-XXXTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRG 200
           +   Y  G+             T +  + E VVL +    L+  G D+TR    LL    
Sbjct: 419 LATCYGAGISTSTCVVNVGASETSVSCIDEGVVLENSLINLNYGGDDITRLFSVLLKMNN 478

Query: 201 YAF 203
           + +
Sbjct: 479 FPY 481

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,957,495
Number of extensions: 1624651
Number of successful extensions: 3902
Number of sequences better than 10.0: 169
Number of HSP's gapped: 3541
Number of HSP's successfully gapped: 249
Length of query: 391
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 279
Effective length of database: 40,638,807
Effective search space: 11338227153
Effective search space used: 11338227153
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)