Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0C02662g1.83ON54854826490.0
SAKL0C02640gsingletonON54854823560.0
SAKL0C02684gsingletonON58854819950.0
Smik_5.241.83ON59052219180.0
YEL063C (CAN1)1.83ON59052319030.0
Skud_5.261.83ON59052318940.0
Suva_5.41.83ON59052318760.0
NDAI0A006101.83ON56554418730.0
TDEL0C061801.83ON58351418670.0
TPHA0B044801.83ON60356118620.0
CAGL0J08184g1.83ON57252618590.0
KNAG0C007901.83ON57951418540.0
KLLA0C02343g1.83ON58155118540.0
NCAS0B085701.83ON53252918140.0
NDAI0F042001.83ON56650818120.0
Kwal_33.134011.83ON55953518040.0
KLTH0F02398g1.83ON55552918030.0
SAKL0C02728g1.84ON56254718030.0
TPHA0B044701.84ON59952218060.0
Kpol_2000.641.84ON61052617910.0
NDAI0F041901.84ON59951117870.0
Kpol_2000.651.83ON59554017860.0
NCAS0A006001.83ON54451417800.0
ZYRO0F16654g1.83ON58055017710.0
CAGL0J08162g1.84ON59751217710.0
KNAG0F004801.84ON59754417670.0
TDEL0C061701.84ON57351117640.0
Kwal_33.134111.84ON56051417570.0
TBLA0A054601.84ON60855917620.0
KNAG0C05920singletonON59953717610.0
YNL268W (LYP1)1.84ON61153917600.0
KLTH0F02420g1.84ON62153217590.0
Ecym_10881.84ON56755517510.0
Smik_14.681.84ON61150817540.0
NCAS0A006101.84ON60751117520.0
Skud_14.711.84ON61251117520.0
KLLA0C02365g1.84ON57954817450.0
Ecym_10871.83ON57052517440.0
TBLA0A054501.83ON60651917470.0
KAFR0D007001.83ON57453217350.0
Smik_14.671.83ON57352517340.0
Suva_14.751.84ON61151117350.0
Skud_14.701.83ON57353617190.0
YNL270C (ALP1)1.83ON57354417170.0
KAFR0D039401.83ON59755417150.0
Suva_14.731.83ON49747916960.0
AFR667C1.84ON56354116720.0
ZYRO0F16632g1.84ON60752216750.0
AFR668W1.83ON55650915660.0
Kpol_358.3na 1ON5755259281e-118
TBLA0A07060na 1ON6255139081e-114
CAGL0A01199gna 1ON6135329031e-114
SAKL0G14916gna 1ON5815578991e-113
KAFR0B06430singletonON5935758971e-113
TPHA0M00130singletonON6115208781e-110
Kwal_26.69407.44ON5705208731e-110
Kwal_33.15545na 1ON5765378701e-109
Smik_6.473na 1ON6065358701e-109
Skud_16.12na 1ON6075648671e-108
KNAG0L02460singletonON5885228611e-108
TDEL0C065101.50ON6425398611e-107
YPL265W (DIP5)na 1ON6085358561e-107
TPHA0H028507.44ON6015668541e-106
SAKL0F09790gsingletonON5585568491e-106
KLLA0E16281gna 1ON6055218481e-105
KLTH0D01474g7.44ON6245198471e-105
ZYRO0D03762g1.244ON6005218421e-105
SAKL0G14014g5.158ON6055098421e-105
Suva_16.40na 1ON6065358401e-104
TDEL0C00930singletonON5955238391e-104
TDEL0H040707.44ON5775298331e-104
SAKL0B10956g7.44ON5725138321e-104
NCAS0D02260na 1ON5975448331e-103
KNAG0L02470singletonON6385258361e-103
KLTH0B01166gna 1ON5775008231e-102
CAGL0E05632g7.44ON5985208241e-102
SAKL0C01232gsingletonON6135168251e-102
KNAG0E003907.44ON5995298201e-101
NDAI0I02660na 1ON5945108201e-101
Ecym_47895.158ON5885018171e-101
KAFR0A011203.284ON5925288161e-101
CAGL0B01012g1.50ON6235318181e-101
ZYRO0D17908gna 1ON5185168061e-100
Kwal_33.154075.158ON5875188111e-100
Kwal_27.126811.244ON5935308101e-100
KLLA0A11770g5.158ON5815428081e-100
SAKL0D00836gna 2ON6015238091e-100
AGR319W5.158ON6265568111e-100
Kpol_2000.921.50ON6375248121e-100
AFR156W7.44ON5585348051e-100
Kwal_33.14276na 2ON5965098017e-99
NDAI0D021605.158ON5875198008e-99
Ecym_2480na 1ON5865328008e-99
KAFR0D005001.50ON6175378029e-99
Skud_7.5255.158ON6035428001e-98
KLTH0B02046g5.158ON5895437991e-98
KLTH0E15642g1.244ON5965097992e-98
KNAG0C02140singletonON5985357992e-98
CAGL0K05753g1.50ON6605438032e-98
NDAI0E038007.44ON6215637992e-98
Suva_2.6881.50ON6615258013e-98
TPHA0B010901.244ON6065467974e-98
SAKL0C01650g1.50ON6135167974e-98
YDR508C (GNP1)1.50ON6635238005e-98
Suva_7.4855.158ON6035117949e-98
Skud_4.7841.50ON6635237981e-97
Smik_4.7901.50ON6635237972e-97
Suva_2.716singletonON6035217922e-97
Skud_11.2751.244ON6025237922e-97
KAFR0D00520na 3ON5985597894e-97
KAFR0D00510na 4ON6175387905e-97
NDAI0B052201.244ON6115337896e-97
Smik_16.1155.158ON6035067886e-97
Ecym_80357.44ON5635487857e-97
Kpol_367.77.44ON5845627869e-97
Ecym_10561.50ON6065227861e-96
TPHA0E036601.50ON6475457882e-96
YBR068C (BAP2)3.284ON6095227835e-96
YGR191W (HIP1)5.158ON6034997825e-96
KAFR0E018505.158ON5605247796e-96
NCAS0D018705.158ON5955447816e-96
YKR039W (GAP1)1.244ON6025237816e-96
Kwal_33.132041.50ON6075177826e-96
YOR348C (PUT4)7.44ON6275497837e-96
Smik_15.5327.44ON6315637839e-96
Suva_4.3073.284ON6095487801e-95
Ecym_60211.244ON6005377773e-95
Smik_3.531.50ON6335057777e-95
Smik_2.2013.284ON6095427749e-95
Ecym_26643.285ON5755257711e-94
Skud_3.381.50ON6335237742e-94
NDAI0G060301.368ON5995357712e-94
AFR698C1.50ON6095317722e-94
Suva_3.1891.50ON6335067714e-94
CAGL0B03773g5.158ON6054997696e-94
TPHA0A002405.158ON6035097687e-94
YCL025C (AGP1)1.50ON6335087699e-94
KAFR0C004003.284ON5825367659e-94
Suva_8.4027.44ON6835777739e-94
NCAS0A071105.158ON5925017652e-93
KLTH0F01584g1.50ON5965077652e-93
TBLA0C01240singletonON6295247662e-93
TDEL0A08030singletonON5145147546e-93
NCAS0B085801.50ON6275037611e-92
Kpol_543.791.244ON6054967601e-92
CAGL0L03267g1.244ON5975307591e-92
KNAG0H011503.284ON6175117601e-92
Kpol_1010.325.158ON5995227582e-92
NDAI0A006401.50ON6415657603e-92
Skud_2.1913.284ON6095227564e-92
SAKL0D04664g1.244ON5934967537e-92
NCAS0A089201.368ON5995357548e-92
KAFR0D04120na 3ON6485277579e-92
NDAI0A056203.284ON5715627519e-92
Skud_15.5157.44ON6265597551e-91
Kpol_543.78singletonON6054997531e-91
NDAI0C029505.158ON6095137531e-91
KLTH0C05170g3.284ON5985107512e-91
SAKL0D02948gna 5ON5945197493e-91
KLLA0F23419g7.44ON5735557474e-91
AFR230C1.244ON6045297494e-91
Kwal_23.4026singletonON5344737426e-91
NCAS0A106803.284ON5935087461e-90
Suva_2.2033.284ON6045407461e-90
Kpol_2002.441.50ON6275317481e-90
Kwal_26.9612singletonON5435177392e-90
KLLA0A06886gsingletonON5874937414e-90
Smik_13.1singletonON5235087347e-90
Suva_11.2731.244ON6014967408e-90
KNAG0G009005.158ON6135047373e-89
SAKL0D02970g3.284ON6015177363e-89
NCAS0B079001.244ON6195017364e-89
TBLA0A05190na 3ON6675527405e-89
CAGL0H08393g3.284ON6125227355e-89
AGR040C3.285ON5735067318e-89
YDR046C (BAP3)3.284ON6045407331e-88
KAFR0D041401.50ON6375427351e-88
Ecym_2663na 5ON5894987321e-88
KNAG0J022003.284ON6075517331e-88
ZYRO0F17446g1.50ON6335107351e-88
KLTH0F04048gsingletonON5835377301e-88
ACL135Wna 1ON5885197311e-88
SAKL0C13992gsingletonON5525357272e-88
TBLA0A051801.50ON6765207353e-88
Kpol_534.221.368ON5925207293e-88
AGR039Cna 5ON5865337267e-88
KLTH0F01606gna 3ON6045427277e-88
KLTH0H13398g1.368ON5875217241e-87
AEL030W1.368ON5825267232e-87
Smik_4.2843.284ON6045407242e-87
Smik_11.3021.244ON5534757202e-87
TPHA0A047005.158ON5695307212e-87
NCAS0E022607.44ON5935477232e-87
TBLA0C012101.368ON6005327223e-87
KAFR0C051607.44ON5845517213e-87
AGR038C3.284ON5805117204e-87
YFL055W (AGP3)na 6ON5585397185e-87
YOL020W (TAT2)1.368ON5925207197e-87
Skud_15.1381.368ON5925267199e-87
KLLA0C01606g1.50ON6205417201e-86
Skud_6.2na 6ON5585007151e-86
CAGL0D02178g1.368ON5775267161e-86
Kwal_8.590na 7ON6295547192e-86
SAKL0D02926g3.285ON5835057153e-86
NCAS0A004201.50ON6795107213e-86
KLTH0B00154gna 7ON5565297124e-86
TBLA0B077605.158ON6585057177e-86
ZYRO0G12342g3.284ON6205147131e-85
KLLA0B14685gna 8ON5715587082e-85
KLLA0A06930g1.244ON5874937083e-85
TDEL0E05750singletonON5485507053e-85
Smik_15.1461.368ON5935197083e-85
TPHA0A025001.368ON5905467083e-85
KLLA0A10813g1.368ON5845547074e-85
KNAG0F002701.50ON6345227097e-85
Smik_6.482na 9ON5585547021e-84
Smik_2.2023.285ON6175437052e-84
TDEL0F02830na 10ON5615307002e-84
Suva_15.1481.368ON5925207014e-84
NDAI0A074903.284ON5965057014e-84
Ecym_27161.368ON5925266996e-84
Ecym_26623.284ON5895236997e-84
SAKL0F16544gsingletonON5675576978e-84
TBLA0I020103.285ON6284957001e-83
KNAG0J022103.285ON5815106971e-83
Kwal_23.2817na 8ON5805616971e-83
ZYRO0A00308gsingletonON5644906951e-83
Skud_4.3003.284ON6045096981e-83
KLLA0F27093gsingletonON5634906951e-83
Kwal_27.105383.284ON6025046962e-83
Skud_2.1923.285ON6195026956e-83
NCAS0I015303.284ON5955326901e-82
Suva_4.3083.285ON6185016903e-82
TBLA0G031203.284ON6735266933e-82
Sklu_YGOB_Anc_1.3681.368ON5414286843e-82
TPHA0B047501.50ON6395286905e-82
CAGL0M00154gsingletonON5505496792e-81
Kwal_33.13215na 3ON5985066822e-81
KAFR0D04130na 4ON6445166852e-81
Kwal_34.16254singletonOFF4814286723e-81
CAGL0L07546g3.284ON6345346834e-81
Kwal_YGOB_34.162541.368ON4914286724e-81
NDAI0F043901.50ON6675006846e-81
Suva_13.517singletonON5475506757e-81
ZYRO0C18502g7.44ON5755356717e-80
TDEL0D00200singletonON5675516681e-79
ADL272Wna 11ON5645106681e-79
NCAS0J00140na 6ON5585126662e-79
NCAS0I015203.285ON6145336684e-79
Ecym_8297na 11ON5695456645e-79
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0C02662g
         (548 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...  1025   0.0  
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   912   0.0  
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   773   0.0  
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   743   0.0  
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   737   0.0  
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   734   0.0  
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   727   0.0  
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   726   0.0  
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   723   0.0  
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   721   0.0  
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   720   0.0  
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              718   0.0  
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   718   0.0  
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            703   0.0  
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            702   0.0  
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   699   0.0  
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   699   0.0  
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   699   0.0  
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   700   0.0  
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   694   0.0  
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   692   0.0  
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   692   0.0  
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   690   0.0  
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   686   0.0  
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   686   0.0  
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                685   0.0  
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   684   0.0  
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   681   0.0  
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   683   0.0  
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            682   0.0  
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   682   0.0  
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   682   0.0  
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   679   0.0  
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   680   0.0  
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              679   0.0  
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   679   0.0  
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   676   0.0  
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   676   0.0  
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   677   0.0  
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   672   0.0  
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   672   0.0  
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   672   0.0  
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   666   0.0  
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   665   0.0  
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   665   0.0  
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   657   0.0  
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   648   0.0  
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   649   0.0  
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   607   0.0  
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   362   e-118
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   354   e-114
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   352   e-114
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   350   e-113
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   350   e-113
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     342   e-110
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   340   e-110
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   339   e-109
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   339   e-109
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   338   e-108
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             336   e-108
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   336   e-107
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   334   e-107
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   333   e-106
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   331   e-106
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   331   e-105
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   330   e-105
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   328   e-105
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   328   e-105
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   328   e-104
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   327   e-104
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   325   e-104
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   325   e-104
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              325   e-103
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             326   e-103
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   321   e-102
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   322   e-102
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   322   e-102
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   320   e-101
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   320   e-101
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   319   e-101
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   318   e-101
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   319   e-101
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   315   e-100
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   317   e-100
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   316   e-100
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   315   e-100
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   316   e-100
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   317   e-100
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   317   e-100
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   314   e-100
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   313   7e-99
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    312   8e-99
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   312   8e-99
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      313   9e-99
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   312   1e-98
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   312   1e-98
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   312   2e-98
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   312   2e-98
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   313   2e-98
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     312   2e-98
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   313   3e-98
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   311   4e-98
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   311   4e-98
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   312   5e-98
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   310   9e-98
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   311   1e-97
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   311   2e-97
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   309   2e-97
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   309   2e-97
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   308   4e-97
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      308   5e-97
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   308   6e-97
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   308   6e-97
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   306   7e-97
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   307   9e-97
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   307   1e-96
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   308   2e-96
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   306   5e-96
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   305   5e-96
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   304   6e-96
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   305   6e-96
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   305   6e-96
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   305   6e-96
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   306   7e-96
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   306   9e-96
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   305   1e-95
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   303   3e-95
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   303   7e-95
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   302   9e-95
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   301   1e-94
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   302   2e-94
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   301   2e-94
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   301   2e-94
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   301   4e-94
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   300   6e-94
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   300   7e-94
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   300   9e-94
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                299   9e-94
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   302   9e-94
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   299   2e-93
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   299   2e-93
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   299   2e-93
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            295   6e-93
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   297   1e-92
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   297   1e-92
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   296   1e-92
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              297   1e-92
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   296   2e-92
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   297   3e-92
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   295   4e-92
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   294   7e-92
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   295   8e-92
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   296   9e-92
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            293   9e-92
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   295   1e-91
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   294   1e-91
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    294   1e-91
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   293   2e-91
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   293   3e-91
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   292   4e-91
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   293   4e-91
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   290   6e-91
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   291   1e-90
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   291   1e-90
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   292   1e-90
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   289   2e-90
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   290   4e-90
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    287   7e-90
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   289   8e-90
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   288   3e-89
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   288   3e-89
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   288   4e-89
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   289   5e-89
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   287   5e-89
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   286   8e-89
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   286   1e-88
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              287   1e-88
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   286   1e-88
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   286   1e-88
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   287   1e-88
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   285   1e-88
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   286   1e-88
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   284   2e-88
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   287   3e-88
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   285   3e-88
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   284   7e-88
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   284   7e-88
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   283   1e-87
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   283   2e-87
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   283   2e-87
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   281   2e-87
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   282   2e-87
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     283   2e-87
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   282   3e-87
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   282   3e-87
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   281   4e-87
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   281   5e-87
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   281   7e-87
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   281   9e-87
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   281   1e-86
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      280   1e-86
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   280   1e-86
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   281   2e-86
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   280   3e-86
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   282   3e-86
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   278   4e-86
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   280   7e-86
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   279   1e-85
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   277   2e-85
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   277   3e-85
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            276   3e-85
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   277   3e-85
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   277   3e-85
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   276   4e-85
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   277   7e-85
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   275   1e-84
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   276   2e-84
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   274   2e-84
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   274   4e-84
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   274   4e-84
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   273   6e-84
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   273   7e-84
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   273   8e-84
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   274   1e-83
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   273   1e-83
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   273   1e-83
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   272   1e-83
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   273   1e-83
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   272   1e-83
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   272   2e-83
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   272   6e-83
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              270   1e-82
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   270   3e-82
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              271   3e-82
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   268   3e-82
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   270   5e-82
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   266   2e-81
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   267   2e-81
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              268   2e-81
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   263   3e-81
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   267   4e-81
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   263   4e-81
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   268   6e-81
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   264   7e-81
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   263   7e-80
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                261   1e-79
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   261   1e-79
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      261   2e-79
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              261   4e-79
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   260   5e-79
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   260   9e-79
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   260   1e-78
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   261   1e-78
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              258   3e-78
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              258   5e-78
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   256   1e-77
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              255   2e-77
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   254   9e-77
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   252   1e-76
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   255   1e-76
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   253   2e-76
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   254   2e-76
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   253   4e-76
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   251   6e-76
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   253   8e-76
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              252   9e-76
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   252   9e-76
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   250   2e-75
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   248   3e-74
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      248   4e-74
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   248   2e-73
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   244   2e-73
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   245   6e-73
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   244   7e-73
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   247   4e-72
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   241   9e-72
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   241   1e-71
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   241   1e-71
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   241   3e-71
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   239   3e-71
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   239   6e-71
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   238   1e-70
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   238   1e-70
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   238   2e-70
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                238   2e-70
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   238   2e-70
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   238   2e-70
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   237   3e-70
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   237   4e-70
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    234   4e-69
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   234   5e-69
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   233   8e-69
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   233   1e-68
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   232   3e-68
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                232   3e-68
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   228   8e-68
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   231   1e-67
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   230   1e-67
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   228   4e-67
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   228   9e-67
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   227   2e-66
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   226   3e-66
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   224   8e-66
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   225   1e-65
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   230   1e-65
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   225   2e-65
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   224   2e-65
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   228   3e-65
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   223   4e-65
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   223   5e-65
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   226   1e-64
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   224   9e-64
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   224   1e-63
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   224   1e-63
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   224   2e-63
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   216   3e-62
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   214   6e-62
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   213   1e-61
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   219   1e-61
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   215   2e-60
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   209   1e-59
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   213   2e-59
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   212   3e-59
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   210   2e-58
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   204   5e-58
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   203   2e-57
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   205   1e-56
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   205   1e-56
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   204   3e-56
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   197   1e-55
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   201   2e-55
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   200   5e-55
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   199   1e-54
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   194   2e-54
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   191   3e-52
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     180   3e-51
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     180   4e-51
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)         122   2e-31
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)     122   9e-31
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)    123   3e-30
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         121   5e-30
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   107   1e-25
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    88   1e-19
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      77   1e-16
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      78   2e-16
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    75   9e-15
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          60   6e-10
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              57   1e-08
TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.1...    47   7e-05
NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON} Anc_1...    45   3e-04
SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {...    41   0.008
KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {...    40   0.019
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    39   0.045
ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} simi...    37   0.17 
NDAI0A00890 Chr1 complement(181903..183828) [1926 bp, 641 aa] {O...    37   0.17 
Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {O...    36   0.21 
Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {O...    36   0.21 
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    36   0.27 
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    35   0.38 
KAFR0G00390 Chr7 complement(115188..117011) [1824 bp, 607 aa] {O...    35   0.56 
Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {...    35   0.58 
TBLA0C05740 Chr3 complement(1391698..1393677) [1980 bp, 659 aa] ...    34   0.81 
NDAI0H03440 Chr8 (831155..832888) [1734 bp, 577 aa] {ON} Anc_1.379     33   2.5  
Smik_11.55 Chr11 complement(105857..107716) [1860 bp, 619 aa] {O...    33   2.7  
TBLA0B05530 Chr2 (1315843..1320930) [5088 bp, 1695 aa] {ON} Anc_...    33   3.3  
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    32   4.9  
AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON} S...    32   5.8  
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    32   5.9  
TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {O...    32   6.0  
ZYRO0F00242g Chr6 (26301..27908) [1608 bp, 535 aa] {ON} similar ...    31   7.2  
Skud_10.354 Chr10 (626154..627809) [1656 bp, 551 aa] {ON} YJR131...    31   7.8  

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score = 1025 bits (2649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/548 (93%), Positives = 515/548 (93%)

Query: 1   MSLSKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTI 60
           MSLSKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTI
Sbjct: 1   MSLSKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTI 60

Query: 61  GTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLS 120
           GTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLS
Sbjct: 61  GTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLS 120

Query: 121 PALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKY 180
           PALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKY
Sbjct: 121 PALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKY 180

Query: 181 YGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGR 240
           YGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGR
Sbjct: 181 YGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGR 240

Query: 241 FLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXX 300
           FLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKV                  
Sbjct: 241 FLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLL 300

Query: 301 XXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAY 360
              NDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAY
Sbjct: 301 VPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAY 360

Query: 361 SMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFF 420
           SMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFF
Sbjct: 361 SMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFF 420

Query: 421 TWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF 480
           TWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAA            TAFAPKF
Sbjct: 421 TWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAPKF 480

Query: 481 KVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLW 540
           KVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLW
Sbjct: 481 KVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLW 540

Query: 541 EKFWAAIA 548
           EKFWAAIA
Sbjct: 541 EKFWAAIA 548

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  912 bits (2356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/548 (81%), Positives = 484/548 (88%)

Query: 1   MSLSKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTI 60
           MS  + + + +EK+   L+ + S ++D VS+ESLGSVKETQVKRALKPRHISMIALGGTI
Sbjct: 1   MSAQQHHSSEKEKNSEELVSEFSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTI 60

Query: 61  GTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLS 120
           GTGLFISISTPLSNAGPVGALIAYMFIGTLAY V+QSLGEMATFIPVTSSF VFTQRFLS
Sbjct: 61  GTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLS 120

Query: 121 PALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKY 180
           PALG+ANGY+Y+LSW+ITFALELSVVGQ+IQFWTDAVPLTAWI I WV+L  +NL PVK+
Sbjct: 121 PALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKF 180

Query: 181 YGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGR 240
           YGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGR
Sbjct: 181 YGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGR 240

Query: 241 FLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXX 300
           FLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKV                  
Sbjct: 241 FLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLL 300

Query: 301 XXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAY 360
              NDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNS+VY+ SR+ Y
Sbjct: 301 VPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLY 360

Query: 361 SMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFF 420
           SM +NGLAPKYLTWTTKSGIPYAAVLTTS++GFLAYLESS GAS VF+WLLNITAVAGFF
Sbjct: 361 SMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFF 420

Query: 421 TWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF 480
            W+LIS++HIRFMQALKHQGISRDDLPFKAKFMPWGAYYAA            TAFAPKF
Sbjct: 421 AWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAPKF 480

Query: 481 KVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLW 540
            VSDFFTAY+SV+LFF  WIGFQIWFRGPLF KTEDIDLDTDRREID+ VWEE +P+NLW
Sbjct: 481 NVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDIDLDTDRREIDNDVWEEDEPKNLW 540

Query: 541 EKFWAAIA 548
           EKFW+A+A
Sbjct: 541 EKFWSAVA 548

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  773 bits (1995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/548 (72%), Positives = 442/548 (80%), Gaps = 3/548 (0%)

Query: 4   SKDYEATREKDGSHLIIKP-SIAEDAVSMESL--GSVKETQVKRALKPRHISMIALGGTI 60
            KD ++T EK      + P       VS++ +  G+V++ +VKRALKPRHISMIALGGTI
Sbjct: 41  CKDTKSTDEKTRVVSQVSPMRTGSPNVSIDYMDEGNVQDAEVKRALKPRHISMIALGGTI 100

Query: 61  GTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLS 120
           GTGLFI IS+PL++AGPVGALIAYMF+GT+AY VTQSLGEMATFIPVTSSFTVFTQRFLS
Sbjct: 101 GTGLFIGISSPLADAGPVGALIAYMFMGTIAYFVTQSLGEMATFIPVTSSFTVFTQRFLS 160

Query: 121 PALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKY 180
           PA G ANGYLYW SW ITFALELSVVGQIIQFWT AVPL AWIAIFWVILT SNLFPVKY
Sbjct: 161 PAFGVANGYLYWFSWCITFALELSVVGQIIQFWTFAVPLGAWIAIFWVILTTSNLFPVKY 220

Query: 181 YGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGR 240
           YGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGR
Sbjct: 221 YGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGR 280

Query: 241 FLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXX 300
           FLGWVSSLI+AAFTYQGTELVGITAGE+ NPR+TVPRAINKV                  
Sbjct: 281 FLGWVSSLINAAFTYQGTELVGITAGESKNPRRTVPRAINKVFFRILFFYILSLLFIGLL 340

Query: 301 XXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAY 360
              NDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSN+YVGSR+ Y
Sbjct: 341 VPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVLY 400

Query: 361 SMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFF 420
            +A N LAPK     TK G+PY +VL T+  GFLAYL  S+ A  VF+WLLNITA+AGFF
Sbjct: 401 GLAKNKLAPKVFARATKDGVPYISVLGTAAFGFLAYLNLSNSAQKVFDWLLNITAIAGFF 460

Query: 421 TWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF 480
            W+ IS++HIRFMQ LK + +SR+DLPFKAKFMPWGAYY+A            TAFAPKF
Sbjct: 461 AWLFISLAHIRFMQVLKDRNMSRNDLPFKAKFMPWGAYYSAFFISLIIIIQGFTAFAPKF 520

Query: 481 KVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLW 540
            VS+FF AYISV LF   W+ FQI FR    +   D+D+DTDRR+ID +VWEE+ P+N W
Sbjct: 521 NVSNFFAAYISVFLFLAIWVVFQIRFRTRFILTKNDVDIDTDRRDIDCIVWEEETPKNAW 580

Query: 541 EKFWAAIA 548
           +KFWAA+A
Sbjct: 581 DKFWAAMA 588

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/522 (68%), Positives = 415/522 (79%)

Query: 27  DAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMF 86
           D +  E  G V+  +VKR LK RHI MIALGGTIGTGLFI +S PL+NAGPVGALI+Y+F
Sbjct: 69  DVIRDEDQGEVRNAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLF 128

Query: 87  IGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVV 146
           +G+LAYSVTQSLGEMATFIPVTSSFTVF+QRFLSPA G+ANGY+YW SWAITFALELSVV
Sbjct: 129 MGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVV 188

Query: 147 GQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIM 206
           GQ+I+FWT+ VPL AWI+IFWVI+TI NLFPVKYYGE EFW+A IKVLAI+GF+IY F M
Sbjct: 189 GQVIEFWTNKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCM 248

Query: 207 VCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAG 266
           VCGAG TGPVGFRYWRNPG WGPGIISKD NEGRFLGWVSSLI+AAFT+QGTELVGITAG
Sbjct: 249 VCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAG 308

Query: 267 EAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIEN 326
           EAANPRKTVPRAI KV                     NDPKL +  SY+S SPF+IAIEN
Sbjct: 309 EAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTTATSYVSVSPFIIAIEN 368

Query: 327 SGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVL 386
           SGTKVLPHIFNAVIL+TIISA NSN+YVGSRI + ++ N LAPK+L+ TTK G+PY AV 
Sbjct: 369 SGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVF 428

Query: 387 TTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDL 446
            T+V G LAY+E+S+G   VF WLLNIT VAGFF W+LISISHIRFMQALK++GISRD+L
Sbjct: 429 ITAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDEL 488

Query: 447 PFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWF 506
           PFKAK MP  AY+AA            TAFAPKF   DF  AYIS+ LF   WI F+I F
Sbjct: 489 PFKAKLMPGLAYFAATFMIIIILIQGFTAFAPKFDGIDFLAAYISIFLFLAIWILFEIIF 548

Query: 507 RGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           R     K ED+D+D+DRR+I+ +VWE+ +P+  W+KFW  +A
Sbjct: 549 RCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/523 (68%), Positives = 411/523 (78%)

Query: 26  EDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYM 85
           ED +  E  G V+  +VKR LK RHI MIALGGTIGTGLFI +STPL+NAGPVGALI+Y+
Sbjct: 68  EDGIGDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYL 127

Query: 86  FIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSV 145
           F+G+LAYSVTQSLGEMATFIPVTSSFTVF+QRFLSPA G+ANGY+YW SWAITFALELSV
Sbjct: 128 FMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSV 187

Query: 146 VGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFI 205
           VGQ+IQFWT  VPL AWI+IFWVI+TI NLFPVKYYGE EFW+A IKVLAI+GF+IY F 
Sbjct: 188 VGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFC 247

Query: 206 MVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITA 265
           MVCGAG TGPVGFRYWRNPG WGPGIISKD NEGRFLGWVSSLI+AAFT+QGTELVGITA
Sbjct: 248 MVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITA 307

Query: 266 GEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIE 325
           GEAANPRK+VPRAI KV                     NDPKL    SY+S+SPF+IAIE
Sbjct: 308 GEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIE 367

Query: 326 NSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAV 385
           NSGTKVLPHIFNAVIL+TIISA NSN+YVGSRI + ++ N LAPK+L+ TTK G+PY AV
Sbjct: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAV 427

Query: 386 LTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDD 445
             T+  G LAY+E+S+G   VF WLLNIT VAGFF W+ ISISHIRFMQALK++GISRD+
Sbjct: 428 FVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDE 487

Query: 446 LPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIW 505
           LPFKAK MP  AYYAA            TAFAPKF    F  AYIS+ LF   WI FQ  
Sbjct: 488 LPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCI 547

Query: 506 FRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           FR     K  D+D+D+DRR+I+ +VWE+ +P+  W+KFW  +A
Sbjct: 548 FRCRFIWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/523 (67%), Positives = 414/523 (79%)

Query: 26  EDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYM 85
           E+ +  E  G V+  +VKR LK RHI MIALGGTIGTGLFI +STPL+NAGPVGALIAY+
Sbjct: 68  EENLQDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGALIAYL 127

Query: 86  FIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSV 145
           F+G+LA+SVTQSLGEMATFIPVTSSFTVF+QRFLSPA G+ANGY+YW SWAITFALELSV
Sbjct: 128 FMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSV 187

Query: 146 VGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFI 205
           VGQ+IQFWT  VPL AWI+IFWV++TI NLFPVKYYGE EFW+A IKV+AI+GF+IY F 
Sbjct: 188 VGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFC 247

Query: 206 MVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITA 265
           MVCGAG TGPVGFRYWRNPG WGPGIISK+ NEGRFLGWVSSLI+AAFT+QGTELVGITA
Sbjct: 248 MVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITA 307

Query: 266 GEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIE 325
           GEAANPRKTVPRAI KV                     NDPKL    SY+S+SPF++AI+
Sbjct: 308 GEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQ 367

Query: 326 NSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAV 385
           NSGTKVLPHIFNAVIL+TIISA NSN+YVGSRI + ++ N LAPK+L+ T+K G+PY AV
Sbjct: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAV 427

Query: 386 LTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDD 445
             T+V G LAY+E+S+G   VF WLLNIT VAGFF W+ ISISHIRFMQALK++GISRD+
Sbjct: 428 FATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDE 487

Query: 446 LPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIW 505
           LPFKAK MP  AYY++            TAFAPKF  S F  AYIS+ LF   WI F+  
Sbjct: 488 LPFKAKLMPGLAYYSSFFMIIIIIIQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECI 547

Query: 506 FRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           FR     K ED+D+D+DRR+I+ +VWE+ +P+  W+KFW  +A
Sbjct: 548 FRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/523 (66%), Positives = 411/523 (78%)

Query: 26  EDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYM 85
           E+ +  E  G V+  +VKR LK RHI MIALGGTIGTGLFI +STPL+NAGPVGALI+Y+
Sbjct: 68  EEDIQDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYL 127

Query: 86  FIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSV 145
           F+G+LAYSVTQSLGEMATFIPVTSSFTVF+QRFLSPA G+ANGY+YW SWA+TFALELSV
Sbjct: 128 FMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSV 187

Query: 146 VGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFI 205
           VGQ+IQFWT AVPL AWI+IFWVI+T  N+FPVKYYGE EFW+A IKV+AI+GF+IY F 
Sbjct: 188 VGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFC 247

Query: 206 MVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITA 265
           MVCGAG TGPVGFRYWRNPG WGPGIISK+ NE RFLGWVSSLI+AAFT+QGTELVGITA
Sbjct: 248 MVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITA 307

Query: 266 GEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIE 325
           GEAANPRKTVPRAI KV                     NDPKL S  SY+S+SPF+IAIE
Sbjct: 308 GEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIE 367

Query: 326 NSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAV 385
           NSGTKVLPHIFNAVIL+TIISA NSN+YVGSR+ + ++ + LAPK+ + TTK G+PY AV
Sbjct: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAV 427

Query: 386 LTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDD 445
             TS+ G LAY+E+S+G   VF WLLNIT VAGFF W+ IS+SHIRFMQALK++GISRD+
Sbjct: 428 FATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDE 487

Query: 446 LPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIW 505
           LPFKAK MP  AYYA             T+F P F   +F  AYISV LF   WI F++ 
Sbjct: 488 LPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELI 547

Query: 506 FRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           FR     K ED+D+D+DRR+I+ +VWEE +P+ LW+KFW  + 
Sbjct: 548 FRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/544 (64%), Positives = 418/544 (76%)

Query: 5   KDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGL 64
            DY   R  +  H I      E      + G ++E +VKR LK RHI MIALGGTIGTGL
Sbjct: 22  DDYPLHRRTNSVHSIPSQITIESQEEEIANGQIREAEVKRELKQRHIGMIALGGTIGTGL 81

Query: 65  FISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALG 124
           FI +STPL+NAGPVGALIAY+F+GTL YSVTQSLGEMATFIPVTSSFTVF+QRFLSP+ G
Sbjct: 82  FIGLSTPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMATFIPVTSSFTVFSQRFLSPSFG 141

Query: 125 SANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEV 184
           +ANGY+YW SWAITFALELSVVGQIIQFWT AVP+ AWI+IFWV+L   N+FPV++YGE 
Sbjct: 142 AANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEF 201

Query: 185 EFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGW 244
           EFW+A IKVLAI+GF+IY   MVCGAG TGPVGFRYWRNPGP GPGII+K++NE +FLGW
Sbjct: 202 EFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGW 261

Query: 245 VSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXN 304
           VSSLI+AAFTYQGTELVGITAGEAANPRK+VPRAI KV                     N
Sbjct: 262 VSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYN 321

Query: 305 DPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAM 364
           DPKL S+DSY+++SPF+I+I+NSGT +LPHIFNAVILSTIISA NSNVYVGSRI + ++ 
Sbjct: 322 DPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSK 381

Query: 365 NGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWIL 424
           + LAP+ L+ T K+G+P+ +V+ T + G LAY+E+S+G  A FNWLLNIT VAGFF+W+ 
Sbjct: 382 SKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLF 441

Query: 425 ISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSD 484
           ISISH+RFMQAL+++GISRDDLPFKAKFMP  AYYA             T+F P F   D
Sbjct: 442 ISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGID 501

Query: 485 FFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFW 544
           F  AYIS  LF   WI FQ+WFR  L  K ED+D+DTDRR+I++VVWE+  P   W+KFW
Sbjct: 502 FLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDRRDIEEVVWEDPPPVTFWDKFW 561

Query: 545 AAIA 548
             +A
Sbjct: 562 NVVA 565

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  723 bits (1867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/514 (70%), Positives = 409/514 (79%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           G V E +VKRALK RHI MIALGGTIGTGLFI ISTPLSNAGPVG LIAY+F+ TL YSV
Sbjct: 70  GQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYSV 129

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
            QSLGEMATFIPVTS+FTVF+ RFLSPA G+A+GY+YW SWAITFALELSVVGQII+FWT
Sbjct: 130 VQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWT 189

Query: 155 DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
            AVP+ AWI IFWV+LT+SNLFPVKYYGE EFWIA IKV+A+VGFIIY   MVCGAG TG
Sbjct: 190 TAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITG 249

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
           PVGFRYWRNPG WGPGIISKD NEGRFLGWVSSLI+AAFTYQGTELVGITAGEAANPRK+
Sbjct: 250 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 309

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           VPRAI KV                     NDPKL S DSY+SSSPF+IAIENSGTKVLPH
Sbjct: 310 VPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPH 369

Query: 335 IFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFL 394
           IFNAV+L+TIISAGNSNVYVGSRI Y +A   LAP +   T  +G+PY AV  TS  G L
Sbjct: 370 IFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGAL 429

Query: 395 AYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMP 454
           AY+E S+G ++ FNWLLNIT VAGFFTW+LIS  HIRFMQALK++GISRDDLPFKAKFMP
Sbjct: 430 AYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMP 489

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKT 514
           W AYYA             TAFAP F   DF  AY+SV LF   W+G QIWFR  +F + 
Sbjct: 490 WLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRL 549

Query: 515 EDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           +++D+DTDRR+I+ VVW+++ P+ LW+KFW  +A
Sbjct: 550 DEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/561 (65%), Positives = 426/561 (75%), Gaps = 14/561 (2%)

Query: 2   SLSKDYEATREKDGSHLIIKPSIAEDAVSMESL--------------GSVKETQVKRALK 47
           SLSK     R +  S+  ++ S A+       +              G VKE +VKR LK
Sbjct: 43  SLSKRKRINRSRANSNSDLEGSAADGTARARDIDNADVDDDDYYMDEGVVKEAEVKRQLK 102

Query: 48  PRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPV 107
            RHI MIALGGTIGTGLFI I+TPL NAGPVGALIAY+F+ T+ +SVTQSLGEMATFIPV
Sbjct: 103 QRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFSVTQSLGEMATFIPV 162

Query: 108 TSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFW 167
           TSSFTVF+ RFLSPA+G+ANGY+YW SWA+TFALELSVVGQIIQFWT AVPL+AWI I+W
Sbjct: 163 TSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFWTHAVPLSAWIVIWW 222

Query: 168 VILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPW 227
           VILTI NLFPVK+YGE EFW+A IKVLAI+GF+IY   MVCGAG TGPVGFRYWRNPGPW
Sbjct: 223 VILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVTGPVGFRYWRNPGPW 282

Query: 228 GPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXX 287
           GPGIISKDVNEGRFLGWVSSLI+AAFTYQGTELVGITAGEAANPRKTVPRAI KV     
Sbjct: 283 GPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVTFRIL 342

Query: 288 XXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISA 347
                           +D KL S DSYIS+SPF+IAIENSGTK+LPHIFNAVILSTIISA
Sbjct: 343 IFYILSLFFIGLLVPYDDEKLTSTDSYISASPFIIAIENSGTKILPHIFNAVILSTIISA 402

Query: 348 GNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVF 407
           GNSNVYVGSRI + +A   LAPK+  +T++ G+PY +V  TS  G LA+LE SSG +  F
Sbjct: 403 GNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGALAFLEVSSGGAKAF 462

Query: 408 NWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXX 467
           NWLLNI +VAGFF W+LISI+H+RFMQALKH+GISRDDLPFKA+FMP  AYY+       
Sbjct: 463 NWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKARFMPHLAYYSIFFMTII 522

Query: 468 XXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREID 527
                 TAFAP F  SDF  AYIS+ LFF  W+ FQ++FR  L    E++D+DTDRR++D
Sbjct: 523 IIIQGFTAFAPTFNGSDFVAAYISIFLFFFLWLCFQLYFRSKLLWTVEEVDIDTDRRDVD 582

Query: 528 DVVWEEQKPRNLWEKFWAAIA 548
            ++WE+  P+  W+KFW  +A
Sbjct: 583 AIIWEDSGPKTFWDKFWDVVA 603

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/526 (67%), Positives = 411/526 (78%)

Query: 23  SIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALI 82
           S   + ++ E    ++   VKR+LK RHI MIALGGTIGTGLFI I+TPL+NAGPVGAL+
Sbjct: 47  STQYEDLATEKDELLEHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALV 106

Query: 83  AYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALE 142
           AY+F+GT+ +SVTQSLGEMATFIPVTSSF+VF QRFLSPALG+ANGY+Y+LSW  TFALE
Sbjct: 107 AYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALE 166

Query: 143 LSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIY 202
           LSVVGQIIQFWT  VPL AWI+IFWV+LT  N+FPVK+YGE EFWIA IKVLA++GF+IY
Sbjct: 167 LSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIY 226

Query: 203 AFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVG 262
           +  +VCGAGKTGP+GFRYWRNPG  GPGIIS +  E RFLGWVSSLI+AAFTYQGTELVG
Sbjct: 227 SLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVG 286

Query: 263 ITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVI 322
           ITAGEAANPRK VPRAI KV                     NDPKL S DSY+SSSPF+I
Sbjct: 287 ITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFII 346

Query: 323 AIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPY 382
            I+N+GT+VLPHIFNAVIL+TIISAGNSNVYVGSRI +SMA NGLAPK+L  TT  G+PY
Sbjct: 347 TIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPY 406

Query: 383 AAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGIS 442
            +VL  S  G L+Y+E S+G +  FNWLLNIT VAGFF W+LIS SH+RFMQALKH+GIS
Sbjct: 407 LSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGIS 466

Query: 443 RDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGF 502
           RDDLP+KA +MPW AYYA             T+FAP F   DF  AYISV LF VFW  F
Sbjct: 467 RDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFF 526

Query: 503 QIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           QI+FR  +  K ED+D+DTDRREI+ VVWE+  P+ LW+KFW  +A
Sbjct: 527 QIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/514 (68%), Positives = 405/514 (78%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           G V + +VKR LK RHI MIALG TIGTGLFI +STPL  AGPVGALI+Y+F+GTL YSV
Sbjct: 66  GYVHDAEVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSV 125

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
           TQSLGEMATFIPVTSSFTVF QRFLSP++G+A GY+YW SWA+TFALELSV+GQ+IQ+WT
Sbjct: 126 TQSLGEMATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWT 185

Query: 155 DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
            AVPL AWI+IFWV++T  N+FPVKYYGEVEFWIA IKV+AIVGF++Y   MVCGAG TG
Sbjct: 186 YAVPLAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVTG 245

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
           PVGFRYWRNPGPWGPGIISKD NE RFLGWVSSLI+ AFTYQGTELVGI+AGEAANPRK 
Sbjct: 246 PVGFRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKA 305

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           VPRAI KV                     ND  L + DSY++SSPF+IAI+NSGT VLPH
Sbjct: 306 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDDALNNTDSYVASSPFIIAIKNSGTPVLPH 365

Query: 335 IFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFL 394
           IFNAVI  TI+SAGNSNVYVGSRI + ++ N LAPK L+ TTK G+P+ AVL TSV+G L
Sbjct: 366 IFNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGAL 425

Query: 395 AYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMP 454
           AY+E+S+G    FNWLLNITAVAGFFTW+ IS+SHIRFMQALK++GISRDDLPFKA  MP
Sbjct: 426 AYMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALMP 485

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKT 514
             AYYA+            TAFAPKF  SDF  AYIS+ LF   W  FQI FR     K 
Sbjct: 486 GLAYYASFLMFVIIIIQGFTAFAPKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFIHKV 545

Query: 515 EDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           ED+D+DTDRR+I+ VVWE+ +P+ +W+KFW  IA
Sbjct: 546 EDVDIDTDRRDIEAVVWEDAEPKTVWDKFWNIIA 579

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/551 (66%), Positives = 435/551 (78%), Gaps = 4/551 (0%)

Query: 1   MSLSKDYEATREKDGSHLIIKPSIAEDAVSM-ESLGSVKETQVKRALKPRHISMIALGGT 59
           +S SK  +  R    ++L ++ +I +D+  M +  GS+ + +VKRALKPRH+SMIALGGT
Sbjct: 32  VSNSKIDDPLRFSKDNNLTLE-AIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGT 90

Query: 60  IGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFL 119
           IGTGLFISIS PL NAGPVG+LIA+M IGTLAYSVTQSLGEMATFIPVTSSFTVF+QRF+
Sbjct: 91  IGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFI 150

Query: 120 SPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVK 179
           SPA+G+ANGY+YW SWAITFALELS+VGQIIQ+WTDAVPL AWIAIFWV+L   N+FPVK
Sbjct: 151 SPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVK 210

Query: 180 YYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEG 239
           +YGE EFW+A IKV+AI+GF+IY+  MVCGAG  GP+GFRYWR PGPWG GII+K+VN+ 
Sbjct: 211 WYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKA 270

Query: 240 RFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXX 299
           RFLGWVSSLISAAFTYQGTELVGITAGE  NPRK VPRAINKV                 
Sbjct: 271 RFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGL 330

Query: 300 XXXXNDPKLKSED--SYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSR 357
               NDPKL+  D  SYI+ SPF+IAI N  T VLPHIFNAVIL+TIISAGNSNVYVGSR
Sbjct: 331 LVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSR 390

Query: 358 IAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVA 417
           I + ++ N LAPK+ + TTK G+P+ AVL T+V GFLAYL  S+ A  VF+WLLNITA+A
Sbjct: 391 ILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIA 450

Query: 418 GFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFA 477
           GF TW+LISISHIRFMQ LKH+GISRDDLP+KAKFMP+ AYYAA            TAFA
Sbjct: 451 GFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPYAAYYAAFFITVIIIIQGFTAFA 510

Query: 478 PKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPR 537
           P F VSDFF AYISV LFF+ W  FQ  +R  LF   +++D+D+DRR+ID ++WEE++P+
Sbjct: 511 PHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLDEVDIDSDRRDIDVIIWEEEEPK 570

Query: 538 NLWEKFWAAIA 548
           NLWEKFWA  A
Sbjct: 571 NLWEKFWAVAA 581

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/529 (65%), Positives = 412/529 (77%), Gaps = 7/529 (1%)

Query: 20  IKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVG 79
           +K  I E +V +E+     ET V+R LK RH+ MIALGGTIGTGLFI +STPL NAGPVG
Sbjct: 11  MKEEIREISVEVEA-----ET-VRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVG 64

Query: 80  ALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITF 139
           ALIAY+F+ TLAYSVTQSLGEMATFIPVTSSFTVF+QRF+SPA G+ANGY+YW SW ITF
Sbjct: 65  ALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITF 124

Query: 140 ALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGF 199
           ALELSVVGQ+IQFWT AVPL AWI+IFWV+LT  N+FPVKYYGE EFW+A +KV+AI+GF
Sbjct: 125 ALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGF 184

Query: 200 IIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTE 259
           +IY F MVCGAG TGPVGFRYWR+PG +GPGII+KD N+ RFLGWVSSLI+AAFT+QGTE
Sbjct: 185 LIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTE 244

Query: 260 LVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSP 319
           LVGITAGEAANPRKTVPRAI KV                     +D KL S DSY+S+SP
Sbjct: 245 LVGITAGEAANPRKTVPRAIKKVVFRILFFYILSLFFIGLLVPYDDWKLTSTDSYVSASP 304

Query: 320 FVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSG 379
           F+IAIENSGT VLPHIFNAVI++TIISAGNSN+YVGSRI Y ++ + LAP  L+ TT+ G
Sbjct: 305 FIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHG 364

Query: 380 IPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQ 439
           +P+ AVL TS+ G LAY+E+S+G    FNWLLNIT VAGFFTW+ IS+SHIRFMQAL+ +
Sbjct: 365 VPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMR 424

Query: 440 GISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFW 499
           GISRDDLPFKAK+MP  AYY              T+F P   + DF TAYISV +F   W
Sbjct: 425 GISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWNGI-DFLTAYISVFMFIAIW 483

Query: 500 IGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           I FQ WFR  L  + ED+D+DTDRR +++ VW EQ+PR  W+KFW  +A
Sbjct: 484 IAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/508 (67%), Positives = 402/508 (79%)

Query: 41  QVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGE 100
           +VKR L  RHI+MIALGGTIGTGLF+ I+ PL  +GPVG+LIAY+F+GT+ YSVTQSLGE
Sbjct: 59  EVKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSVTQSLGE 118

Query: 101 MATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLT 160
           MATFIPVT+SFT+F+ RFLSPALG+ANGY+YW SWA+TFALELSVVGQIIQFWT AVPL 
Sbjct: 119 MATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLP 178

Query: 161 AWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRY 220
           AWI+IFWVILTISNLFPV+ YGE+EFWIA +KV AI+GFIIY F +VCGAGKTGPVGFRY
Sbjct: 179 AWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRY 238

Query: 221 WRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAIN 280
           WRNPGPWG GIIS ++ E RFLGW SSLI+AAFT+QGTELVGITAGEAANPR+TVP+AI 
Sbjct: 239 WRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIR 298

Query: 281 KVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVI 340
           KV                     +D KLKSE+SY+SSSPF+IAIENSGTK+LPHIFN VI
Sbjct: 299 KVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVI 358

Query: 341 LSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESS 400
           L TIISAGNSNVY+GSR+ + +A NG  PK    TTKSG+P  AV+ TS+ G LA++E+S
Sbjct: 359 LVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETS 418

Query: 401 SGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYA 460
           +G    F WLLN+  VAGFF+W+LIS +HIRFMQ L+ +GISR+DLPFKAKFMP+ AYYA
Sbjct: 419 TGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYA 478

Query: 461 AXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLD 520
                        TAFAPKF V +FF +YISV LFF+FW  FQ+WF+     K  DID+D
Sbjct: 479 TIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVDIDID 538

Query: 521 TDRREIDDVVWEEQKPRNLWEKFWAAIA 548
            DRREI+D VW++  P NLW KFW  +A
Sbjct: 539 KDRREIEDRVWQDTTPANLWGKFWDFVA 566

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/535 (63%), Positives = 409/535 (76%), Gaps = 9/535 (1%)

Query: 23  SIAEDAVSMES-------LGSVKETQ--VKRALKPRHISMIALGGTIGTGLFISISTPLS 73
           S AE+A+  E+       LGS    +  V+R LKPRH+SMIALGGTIGTGLFI I +PL 
Sbjct: 25  SFAEEALDQEAQSSQDSQLGSSGHGRNAVQRQLKPRHVSMIALGGTIGTGLFIGIESPLR 84

Query: 74  NAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWL 133
           NAGPVGALI+Y+F+G++AY VTQSLGEMATFIPVTSSFTVFT+RFLS  LG+ANGY+Y  
Sbjct: 85  NAGPVGALISYLFMGSIAYCVTQSLGEMATFIPVTSSFTVFTRRFLSLPLGAANGYMYCF 144

Query: 134 SWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKV 193
           SW++T+ALELS+VGQII++WT AVP  AWIAIFWV +T+SNL PVK+YGE +FWIA IKV
Sbjct: 145 SWSVTYALELSIVGQIIEYWTSAVPNAAWIAIFWVPITLSNLVPVKFYGEFQFWIALIKV 204

Query: 194 LAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAF 253
           +AI+GF++Y   MVCGAGKTGPVGFRYWRNPGPWG GIIS D++EGRFLGWVSSL++AAF
Sbjct: 205 VAIIGFLVYCLCMVCGAGKTGPVGFRYWRNPGPWGDGIISHDIHEGRFLGWVSSLVNAAF 264

Query: 254 TYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDS 313
           TYQGTELVGI+AGE+ANPRKTVP+AINKV                     ND KL S DS
Sbjct: 265 TYQGTELVGISAGESANPRKTVPKAINKVFFRILLFYVGSLFFIGLLVPFNDEKLTSSDS 324

Query: 314 YISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLT 373
           Y + SPF+IAI+NSGTK+LP IFNAVIL+TIISA NSNVYVGSR+ Y +A   LAP++  
Sbjct: 325 YSAGSPFIIAIQNSGTKILPDIFNAVILATIISAANSNVYVGSRVLYGLAKERLAPRFFA 384

Query: 374 WTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFM 433
            T + G+P  AVL  +  GFL YL  S+GAS  F+WLLNITA+AGFF+W+ IS+ H+RFM
Sbjct: 385 RTNRHGVPDVAVLFVANFGFLGYLSVSNGASKAFDWLLNITAIAGFFSWLFISLCHVRFM 444

Query: 434 QALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVM 493
           QALK QGISRDDLPFKAK MPWGAYY+A            T+ AP F VS+FF AYISV 
Sbjct: 445 QALKLQGISRDDLPFKAKLMPWGAYYSAFFITLIIIIQGFTSLAPTFNVSNFFAAYISVF 504

Query: 494 LFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           +F V W  FQ W+R  +  + E +D+D+DRRE+D   W+  +P  LW KFWAA+A
Sbjct: 505 MFLVIWAVFQCWYRTRIIHRIEHVDIDSDRREVDAQQWDNTEPTTLWGKFWAAMA 559

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/529 (64%), Positives = 409/529 (77%), Gaps = 3/529 (0%)

Query: 23  SIAEDAVSMES---LGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVG 79
           S+A+  +  +S     S +E  ++RALKPRH+SMIALGGTIGTGLF+ I+ PL +AGPVG
Sbjct: 27  SLADGVLEQQSQIDTASSQERGIQRALKPRHVSMIALGGTIGTGLFVGIANPLRDAGPVG 86

Query: 80  ALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITF 139
           +LI+Y+F+G+LA+ VTQSLGEMATFIPV SSFTVFT+RFLSPALG+ANGY+Y  SW ITF
Sbjct: 87  SLISYLFMGSLAFFVTQSLGEMATFIPVASSFTVFTRRFLSPALGAANGYMYCFSWCITF 146

Query: 140 ALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGF 199
           ALELS+VG+IIQ+WT  VP  AWI IFWV +++SNL  VK+YGE +FWIA IKV+AIVGF
Sbjct: 147 ALELSIVGEIIQYWTLGVPNAAWIIIFWVPISLSNLVSVKFYGEFQFWIALIKVIAIVGF 206

Query: 200 IIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTE 259
           +IY   MVCGAGKTGPVGFRYWRNPGPWG GIISK  +EGRFLGWVSSL++AAFTYQGTE
Sbjct: 207 LIYCLCMVCGAGKTGPVGFRYWRNPGPWGDGIISKSKSEGRFLGWVSSLVNAAFTYQGTE 266

Query: 260 LVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSP 319
           LVG++AGE+ANPRKTVP+AI KV                     NDPKL S  +Y +SSP
Sbjct: 267 LVGVSAGESANPRKTVPKAIRKVFLRILLFYVGSLFFIGLLVPFNDPKLDSTANYSASSP 326

Query: 320 FVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSG 379
           F+IAI+NSGT+ LP IFNAVIL+TIISA NSNVYVGSR+ Y +A  GLAPK +    + G
Sbjct: 327 FIIAIQNSGTRALPDIFNAVILTTIISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHG 386

Query: 380 IPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQ 439
           +PY  V   S+ GFL YL  SSG++  F+WLLNITA+AGFF W+ IS+ HIRFMQALK+Q
Sbjct: 387 VPYICVGIVSLFGFLGYLSVSSGSAKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQ 446

Query: 440 GISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFW 499
           GISRDDLPFKAK MPWGAYYAA            TAFAPKF VS+FF AY+SV LF   W
Sbjct: 447 GISRDDLPFKAKLMPWGAYYAAFFILLIIIIQGFTAFAPKFNVSNFFAAYVSVFLFIAVW 506

Query: 500 IGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           + FQ+ F+  L  K ED+D+D+DRREI+  VWE+ +P NLW KFWAA+A
Sbjct: 507 VIFQVIFKSRLIHKVEDVDIDSDRREIEAEVWEDDEPTNLWGKFWAAMA 555

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/547 (62%), Positives = 429/547 (78%), Gaps = 19/547 (3%)

Query: 21  KPSIA---EDAVSMESL----------------GSVKETQVKRALKPRHISMIALGGTIG 61
           KPS++   ED VS E+L                G  +ET+VKRALKPRHISMIALGGTIG
Sbjct: 16  KPSVSKKLEDYVSSETLPIYSHSGDNAPCEKGEGDCRETEVKRALKPRHISMIALGGTIG 75

Query: 62  TGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSP 121
           TGLF+ I++PLS +GPVGALIAY+FIG++ Y VTQSLGEMATFIPVTSS TVF++RFLSP
Sbjct: 76  TGLFVGIASPLSESGPVGALIAYIFIGSIVYFVTQSLGEMATFIPVTSSITVFSKRFLSP 135

Query: 122 ALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYY 181
           A G ANGY+YW +WAIT+A+E++VVGQ+IQ+WTDAVPL AWIAIFWV++T++N FPVK+Y
Sbjct: 136 AFGVANGYMYWFNWAITYAVEIAVVGQVIQYWTDAVPLAAWIAIFWVLVTLANFFPVKFY 195

Query: 182 GEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRF 241
           GEVEFW+A +KV+AIVG++IYA ++VCG    GP+GFRYWRNPGPWGPGIISKDVNEGRF
Sbjct: 196 GEVEFWVASVKVIAIVGYLIYALVIVCGGSHQGPIGFRYWRNPGPWGPGIISKDVNEGRF 255

Query: 242 LGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXX 301
           LGWVSSLI+AAFTYQGTELVGITAGEAANPRKTVPRAINKV                   
Sbjct: 256 LGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLFFIGLLV 315

Query: 302 XXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYS 361
             +D +L +  + I+SSPFVI+I+N+GTKVLPHIFNA+++ TIISA NSNVYVGSR+ YS
Sbjct: 316 PYDDLRLSNTTAVIASSPFVISIQNAGTKVLPHIFNAIVMITIISAANSNVYVGSRVLYS 375

Query: 362 MAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFT 421
           +A++G APK   + TK G+PY  V+ T++LG LA+L  ++ A+  FNWL+NI+ +AG   
Sbjct: 376 LALSGNAPKQFGYVTKQGVPYLGVIVTALLGLLAFLVVNNNANEAFNWLVNISTLAGLCA 435

Query: 422 WILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFK 481
           W+ IS+SH+RFMQ LKH+GISR+DLPFKAK MPWGAYYAA             AF PKF+
Sbjct: 436 WLFISLSHVRFMQCLKHRGISREDLPFKAKLMPWGAYYAAFFIGVIIIIQGFKAFTPKFR 495

Query: 482 VSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWE 541
           VSDFFT+YIS++L  V ++G Q+++R       +DID+D+DRREID +VWE+ +P+NLWE
Sbjct: 496 VSDFFTSYISLILLAVLFLGCQLFYRCRFIWSLDDIDIDSDRREIDAIVWEDDEPKNLWE 555

Query: 542 KFWAAIA 548
           KFW A+A
Sbjct: 556 KFWVAVA 562

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/522 (63%), Positives = 407/522 (77%), Gaps = 1/522 (0%)

Query: 27  DAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMF 86
           D    E  G V++T+VKRALK RHI MIALGGTIGTGLF+ ISTPL NAGPVGALIAY+F
Sbjct: 79  DLSDTEEAGHVQDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIF 138

Query: 87  IGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVV 146
           +G++ Y +TQSLGEMATFIPVTSS TVF++RFLSPA G  NGY+YW +WAIT+A+E+SVV
Sbjct: 139 MGSIIYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVV 198

Query: 147 GQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIM 206
           GQ+IQ+WTDAVPL AWIAIFWV +T+ N FPVK YGEVEFW+A IKVLAI+G++IYA ++
Sbjct: 199 GQVIQYWTDAVPLAAWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVI 258

Query: 207 VCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAG 266
           VCG    GP+GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLI+AAFTYQGTELVGITAG
Sbjct: 259 VCGGSSQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAG 318

Query: 267 EAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIEN 326
           EAANPRK+VPRAINKV                     ND  L S DSYI+SSPFVI+I+N
Sbjct: 319 EAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYNDHTLSSGDSYIASSPFVISIQN 378

Query: 327 SGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVL 386
           +GT  LP IFNAV++ TIISA NSNVYVGSR+ Y++A  G APK   + TK G+P+  V+
Sbjct: 379 AGTYALPDIFNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVI 438

Query: 387 TTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDL 446
            T+ LG LA+L  ++ A+  FNWL+NI+ +AG   W  I++SHIRFMQALK++GISRDDL
Sbjct: 439 VTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDL 498

Query: 447 PFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWF 506
           PFKAK MPWGAYY+A             AF P +  + FFT+YIS++L  V +IG Q+++
Sbjct: 499 PFKAKLMPWGAYYSAFFVFVIIFIQGFEAFTP-WDTTTFFTSYISLILLVVVFIGCQLYY 557

Query: 507 RGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           R    +K EDID+DTDRREI+ ++WE+ +P+NLWEKFWA +A
Sbjct: 558 RCRFLLKVEDIDIDTDRREIEAIIWEDDEPKNLWEKFWAWVA 599

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/526 (62%), Positives = 407/526 (77%)

Query: 23  SIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALI 82
           S+ +D  S       ++T+VKRALK RHI MIALGGTIGTGLF+ I+TPLSNAGPVG+LI
Sbjct: 85  SLHDDEESDTEEAQYQDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLI 144

Query: 83  AYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALE 142
           AY+F+G++ Y VTQSLGEMATFIPVTSS TVF++RFLSPA G ANGY+YW +WAIT+A+E
Sbjct: 145 AYIFMGSVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVE 204

Query: 143 LSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIY 202
           +SV+GQ+IQ+WT AVPL AWI IFWVI+T+ N FPVK YGE EFWIA IKVLAI+G++IY
Sbjct: 205 ISVIGQVIQYWTKAVPLAAWIGIFWVIVTLMNFFPVKVYGEFEFWIASIKVLAIMGYLIY 264

Query: 203 AFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVG 262
           A I+VCG    GP+GFRYWRNPGPWGPGIIS    E RFLGWVSSLI+AAFTYQGTELVG
Sbjct: 265 ALIIVCGGSHQGPIGFRYWRNPGPWGPGIISDKTGEARFLGWVSSLINAAFTYQGTELVG 324

Query: 263 ITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVI 322
           ITAGEAANPRK+VPRAINKV                     ND +L ++ + I+SSPFVI
Sbjct: 325 ITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPFNDDRLANDSAVIASSPFVI 384

Query: 323 AIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPY 382
           +I+N+GT+ LP IFNAV+L TIISA NSNVYVGSR+ Y++A+ G APK  ++ TK G+PY
Sbjct: 385 SIQNAGTRALPDIFNAVVLLTIISAANSNVYVGSRVLYALALTGNAPKIFSYVTKYGVPY 444

Query: 383 AAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGIS 442
             V+ T+ LG LA+L  ++ A+  FNWL+NI+ +AG   W+ IS+SHIRFMQALK++GIS
Sbjct: 445 MGVICTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKYRGIS 504

Query: 443 RDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGF 502
           RDDLPFKAK MPWGAYYA+             AF PKF VS FFT+YIS++L  V + G 
Sbjct: 505 RDDLPFKAKLMPWGAYYASFFVTVIIFIQGFQAFTPKFDVSTFFTSYISLILLAVLFSGC 564

Query: 503 QIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           Q+++R     K EDID+D+DRREI+ ++WEE +P+NLWEKFWA +A
Sbjct: 565 QLYYRCRFIWKVEDIDIDSDRREIEAIIWEEDEPKNLWEKFWAWVA 610

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/511 (63%), Positives = 406/511 (79%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97
            +TQVKRALK RH+ MIALGGTIGTGLFI I+TPL+N+GPVG+LIAY+F+G++ Y +TQS
Sbjct: 89  HDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQS 148

Query: 98  LGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAV 157
           LGEMATFIPVTSS TVF++RFLSPA G ANGY+YW +WAITFA+E+SVVGQ+I++WTD V
Sbjct: 149 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTDKV 208

Query: 158 PLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
           PL AWIAIFWV++T+ N FPVK YGE+EFWIA IKVLAI+G+++YA I+VCG    GP+G
Sbjct: 209 PLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGSSQGPIG 268

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           FRYWRNPGPWGPGIISKDVN GRFLGWVSSLI+AAFTYQGTELVGITAGEAANPRKTVPR
Sbjct: 269 FRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 328

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           AINKV                     ND +L S  + I+SSPFVI+I+N+GTKVLP IFN
Sbjct: 329 AINKVVFRIALFYIMSLFFIGMLVPYNDERLASTSAVIASSPFVISIQNAGTKVLPDIFN 388

Query: 338 AVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYL 397
           A+++ TIISA NSNVYVGSR+ Y++A++G APK   + T+ G+PY  V+ TS LG LA+L
Sbjct: 389 AIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALGLLAFL 448

Query: 398 ESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
             ++ A+  FNWL+NI+ +AG   W+ ISISHIRFMQALK +GISRDDLPFKAK MP+GA
Sbjct: 449 VVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLMPFGA 508

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDI 517
           YYA              AF+P +  + FFT+YIS+++  V +IG QI++R   F + EDI
Sbjct: 509 YYATFFVTVIIFIQGFQAFSPHWDTTAFFTSYISLIILAVLFIGCQIFYRCRFFWRVEDI 568

Query: 518 DLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           D+D+DRREI+ V+WE+ +P+ LW+KFWAA+A
Sbjct: 569 DIDSDRREIEAVIWEDDEPKTLWDKFWAAVA 599

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/540 (66%), Positives = 420/540 (77%), Gaps = 1/540 (0%)

Query: 9   ATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISI 68
           ++R   GSH     S  ED   ++  G V++ +VKR LK RHI MIALGGTIGTGLFI I
Sbjct: 57  SSRHLHGSHGSHSVSGDEDEPYVDQ-GVVQDAEVKRELKQRHIGMIALGGTIGTGLFIGI 115

Query: 69  STPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANG 128
           STPL NAGPVG+LIAY+F+ T+ +SVTQSLGEMATFIPVTSSFTVF+ RF+SP++G+ANG
Sbjct: 116 STPLKNAGPVGSLIAYLFMATIVFSVTQSLGEMATFIPVTSSFTVFSSRFISPSIGAANG 175

Query: 129 YLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWI 188
           Y+YW SWAITFALELSVVGQIIQFWTDAVPL+AWI I+W ILTI N+FPVK+YGE EFW+
Sbjct: 176 YMYWFSWAITFALELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWV 235

Query: 189 ACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSL 248
           A IKV+AI+GF+IY   MVCGAG TGPVGFRYWRNPGPWGPGIIS  V EGRFLGWVSSL
Sbjct: 236 ASIKVIAIMGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSL 295

Query: 249 ISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL 308
           I+AAFTYQGTELVGITAGEAANPRKTVPRAI KV                     +DPKL
Sbjct: 296 INAAFTYQGTELVGITAGEAANPRKTVPRAIKKVSFRILIFYILSLFFIGLLVPFDDPKL 355

Query: 309 KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLA 368
            S+DSY+SSSPF+IAI+NSGTKVLPHIFNAVILSTIISAGNSN+YVGSR+ + +A   LA
Sbjct: 356 SSDDSYVSSSPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLA 415

Query: 369 PKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISIS 428
           P++   TTK G+PY AVL TS  G LA+LE SSG +  FNWLLNI  VAGFF W+LISI+
Sbjct: 416 PRWFGITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIA 475

Query: 429 HIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTA 488
           H+RF+Q L+H+GISRDDLPFKA  MPW AYYA             TAFAP F  SDF  A
Sbjct: 476 HVRFIQTLEHRGISRDDLPFKAALMPWLAYYAIFFMIIIIIIQGFTAFAPTFNGSDFVAA 535

Query: 489 YISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           YISV LFF  W+ FQ++FR  L+   +++D+DTDRR+ID ++WE+  P+  W++FW  +A
Sbjct: 536 YISVFLFFFLWVSFQLYFRCKLYWSLDEVDIDTDRRDIDAIIWEDSAPKTFWDRFWDVVA 595

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/514 (66%), Positives = 403/514 (78%), Gaps = 3/514 (0%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97
           K+  VKR LK RHISMIALGGTIGTGLF+ I+ PL  AGP+GALIAY+F+GT+ +SVTQS
Sbjct: 31  KQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGALIAYLFMGTVVFSVTQS 90

Query: 98  LGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAV 157
           LGEM TFIPVT+SFTVF QRFLSPA G+ANGY+YW SWA+TFALELSVVGQIIQFWT AV
Sbjct: 91  LGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAV 150

Query: 158 PLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
           PL AWI+I WV+LTISNLFPV+ YGE+EFWIA +KVLAI+GFIIY   ++CGAG TGPVG
Sbjct: 151 PLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAILGFIIYGICIICGAGVTGPVG 210

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           FRYW+NPGPWG GIIS +VNE RF GWVSSLI+AAFT+QGTELVGITAGE   PRKTVP+
Sbjct: 211 FRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPK 270

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           AI KV                     NDPKL+S DSY+SSSPF+I I+N+GTK+LPHIFN
Sbjct: 271 AIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFN 330

Query: 338 AVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYL 397
           AVIL TIISAGNSNVY+GSRI Y +A N  APK+ T T+K+G+PY  VL TS+ G LAY+
Sbjct: 331 AVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYM 390

Query: 398 ESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
           E+++G    F WLLNI  VAGFF W+LIS SHIRFM+ALK +GISR+DLP+KA  MPW A
Sbjct: 391 ETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLA 450

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDI 517
           YYA             T+FAPKFKV++FF AYISV LF +FW+ FQIWF+  L  K +D+
Sbjct: 451 YYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDV 510

Query: 518 DLDTDRREIDDVVWE---EQKPRNLWEKFWAAIA 548
           DLDTDRR+I++ VW    E K +N W++FW  +A
Sbjct: 511 DLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/550 (62%), Positives = 414/550 (75%), Gaps = 7/550 (1%)

Query: 5   KDYEAT-----REKDG-SHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGG 58
           K+Y+ +     +E DG  + +      +D+V  E  G V+ T+VKRALKPRHI MIALGG
Sbjct: 32  KEYDRSISSPPKENDGYGYRVDNEYDVDDSVDGEK-GEVRSTEVKRALKPRHIGMIALGG 90

Query: 59  TIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRF 118
           TIGTGLF+ IS PL NAGPVG LIAY+F+ T+A+SV QSLGEMAT+IPVTS+F+VF+QRF
Sbjct: 91  TIGTGLFVGISEPLQNAGPVGMLIAYLFMATIAFSVMQSLGEMATYIPVTSAFSVFSQRF 150

Query: 119 LSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPV 178
           LSPA G+ANGY+YW SW+ITFALELSV+GQI+Q+WT  VP+ AWI+IFWV++   N  PV
Sbjct: 151 LSPAFGAANGYMYWFSWSITFALELSVIGQIVQYWTFKVPVAAWISIFWVLIAGLNFCPV 210

Query: 179 KYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNE 238
           K+YGE EFWIA IKV+AIVGFIIY FIMVCGAGKTGPVGFRYWR+   +G GIISK+ NE
Sbjct: 211 KFYGEFEFWIAFIKVVAIVGFIIYCFIMVCGAGKTGPVGFRYWRHGYAFGDGIISKNKNE 270

Query: 239 GRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXX 298
            RFLGWVSSLI+AAFTYQGTELVGITAGEAANPRKTVP++I +                 
Sbjct: 271 ARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPKSIKRTLWRILIFYIFSLLFVG 330

Query: 299 XXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRI 358
                ND  L+   SY +SSPF++AI+NSGTK LP IFNAVIL+T+ISA NS+VYVGSR+
Sbjct: 331 LLVPFNDHGLQDSRSYAASSPFILAIKNSGTKALPDIFNAVILTTVISAANSDVYVGSRV 390

Query: 359 AYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAG 418
            YSMA N LAP  L   +K G+PYAAVL TS +G LAYLE+SS  + VFNWL+NIT VAG
Sbjct: 391 MYSMARNRLAPPILAKASKGGVPYAAVLFTSAIGALAYLETSSSGANVFNWLMNITGVAG 450

Query: 419 FFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP 478
           FF+W LIS SH+RFM+ALK +GISR+DLPFKA FMPW A Y+             T F P
Sbjct: 451 FFSWWLISWSHLRFMKALKQRGISRNDLPFKASFMPWIAIYSFFFMTLIILVQGFTCFTP 510

Query: 479 KFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRN 538
            F+ SDF  +YISV LFFV W  FQIWFR PL +   +ID+DTDRR++D  VWE++ P+ 
Sbjct: 511 HFQASDFVASYISVGLFFVIWAVFQIWFRCPLLVPIAEIDIDTDRRDVDAEVWEDEPPKT 570

Query: 539 LWEKFWAAIA 548
           LW+KFW  +A
Sbjct: 571 LWDKFWNIVA 580

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/512 (64%), Positives = 403/512 (78%)

Query: 37  VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQ 96
           V +T+VKRALK RHI MIALGGTIGTGLF+ ISTPLSN+GPVGALIAY+F+GT+ Y VTQ
Sbjct: 86  VHDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQ 145

Query: 97  SLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDA 156
           SLGEMATFIPVTSS TVF++RFLSPA G ANGY+YW +WAIT+A+E+SV+GQ+IQ+WT  
Sbjct: 146 SLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFK 205

Query: 157 VPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPV 216
           VPL AWI IFWV++T+ N FPVK YGE EFW+A IKV+AIVG++IYA I+VCG    GP+
Sbjct: 206 VPLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGSHQGPI 265

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           GFRYWRNPG  G GIIS D+ E RFLGWVSSLI+AAFTYQGTELVGITAGEAANPRK+VP
Sbjct: 266 GFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 325

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIF 336
           RAINKV                     NDP+L +  + I+SSPFVI+I+N+GTKVLP IF
Sbjct: 326 RAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIASSPFVISIQNAGTKVLPDIF 385

Query: 337 NAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAY 396
           NAV+L T+ISA NSNVYVGSR+ Y++A +G APK   + T+ G+PY  V+ T++LG LA+
Sbjct: 386 NAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLLAF 445

Query: 397 LESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWG 456
           L  +  A+  FNWL+NI+ +AG   W+ IS++HIRFMQALK +GISRDDLPFKAKFMPWG
Sbjct: 446 LVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPWG 505

Query: 457 AYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTED 516
           AYYA+             AFAPKF VS+FFTAYIS++L  V + G Q+++R     K ED
Sbjct: 506 AYYASFFVTVIIFIQGFQAFAPKFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLWKLED 565

Query: 517 IDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           ID+D+DRREID +VWE+ +P+NLWEKFWAA+A
Sbjct: 566 IDIDSDRREIDAIVWEDDEPQNLWEKFWAAVA 597

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/544 (61%), Positives = 415/544 (76%), Gaps = 10/544 (1%)

Query: 2   SLSKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIG 61
           SL++    +R  DG         AE   S E    V ET+VKRALK RHI MIALGGTIG
Sbjct: 61  SLTRSRLNSRVDDG---------AESDGSDELEAEVHETKVKRALKQRHIGMIALGGTIG 111

Query: 62  TGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSP 121
           TGLF+ ISTPLS AGPVG+LIAY+F+GT+ Y VTQSLGEMATFIPVTSS TVF++RFLSP
Sbjct: 112 TGLFVGISTPLSVAGPVGSLIAYIFMGTIIYFVTQSLGEMATFIPVTSSITVFSKRFLSP 171

Query: 122 ALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYY 181
           A G ANGY+YW +WAIT+A+E+SV+GQ+IQ+WT AVPL AWIAIFWV++T+ N FPVK Y
Sbjct: 172 AFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIAIFWVLVTLMNFFPVKVY 231

Query: 182 GEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRF 241
           GEVEFWIA +KVLAIVG++IYA ++VCG    GP+GFRYWR+PG +GPGIISK+ N G+F
Sbjct: 232 GEVEFWIAFVKVLAIVGYLIYALVIVCGGSHQGPIGFRYWRHPGAFGPGIISKNKNTGKF 291

Query: 242 LGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXX 301
           LGWV+SLI+AAFTYQGTELVGITAGEAANPRKTVPRAINKV                   
Sbjct: 292 LGWVASLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGMLL 351

Query: 302 XXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYS 361
             ND +L ++D+ I+SSPFVI+I+N+ TKVLP IFNAV++ T++SA NSNVYVGSR+ Y+
Sbjct: 352 PYNDKRLSAQDAVIASSPFVISIKNAHTKVLPDIFNAVVMVTVMSAANSNVYVGSRVLYA 411

Query: 362 MAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFT 421
           +A+ G APK  ++ T+ G+PY  V+ T+ LG LA+L  ++ A+  FNWL+NI+ +AG   
Sbjct: 412 LALTGNAPKQFSYVTRYGVPYLGVVCTASLGLLAFLVVNNNANTAFNWLINISTLAGLCA 471

Query: 422 WILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFK 481
           W+ IS++HIRFMQALK +GISRDDLPFKAK MPWGAYYAA             AF P + 
Sbjct: 472 WLFISLAHIRFMQALKFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGYQAFCP-WD 530

Query: 482 VSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWE 541
           VS FFT+YIS++L  V  +G Q+++RG   +K EDID+DTDRREI+ +VWE+ +P+ LW+
Sbjct: 531 VSTFFTSYISLILLAVLVVGCQLYYRGRFLLKLEDIDIDTDRREIESIVWEDDEPKTLWD 590

Query: 542 KFWA 545
           KFWA
Sbjct: 591 KFWA 594

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/511 (64%), Positives = 407/511 (79%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97
            +T+VKRALK RHI MIALGGTIGTGLF+ I+TPLSNAGPVG+LIAY+F+G++ Y +TQS
Sbjct: 63  HDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFMGSIVYFITQS 122

Query: 98  LGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAV 157
           LGEMATFIPVTSS TVF++RFLSPA G ANGY+YW +WAIT+A+E+SV+GQ+IQFWT AV
Sbjct: 123 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQFWTSAV 182

Query: 158 PLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
           PL AWIAIFWV +++ N FPVK YGE+EFW+A IKV+AIVG++IYA ++VCG    GP+G
Sbjct: 183 PLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLIYALVIVCGGSSQGPIG 242

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           FRYWRNPGPWGPGIIS D NEGRFLGWVSSLI+AAFTYQGTELVGITAGEAANPRK+VPR
Sbjct: 243 FRYWRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 302

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           AINKV                     NDP+L S  + I+SSPFVI+I+N+GT+VLPHIFN
Sbjct: 303 AINKVVFRIVIFYIMSLFFVGMLVPFNDPRLASNVAVIASSPFVISIQNAGTRVLPHIFN 362

Query: 338 AVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYL 397
           AV++ TIISA NSNVYVGSR+ Y+++  G APK   + T+ G+PY  V+ TS+LG LA+L
Sbjct: 363 AVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGVIATSLLGLLAFL 422

Query: 398 ESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
             ++ A+  FNWL+NI+ +AG   W+ IS+SHIRFMQALK +GISRDDLPFKAK MPWGA
Sbjct: 423 VVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLPFKAKLMPWGA 482

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDI 517
           YYAA             AF+PKF VS FFTAYIS+++  V  IG Q+++R     K EDI
Sbjct: 483 YYAAFFVTVIIFIQGFEAFSPKFDVSGFFTAYISLIILVVLLIGCQLYYRCRFLWKLEDI 542

Query: 518 DLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           D+DTDRREI+ ++WEE++P+NLWEKFW+ +A
Sbjct: 543 DIDTDRREIECIIWEEEEPQNLWEKFWSIMA 573

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/514 (62%), Positives = 402/514 (78%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           G ++E QVKRALKPRH+SMIALGGTIGTGLF+ I++PLS+AGPVGALIAY+F+G++ Y V
Sbjct: 47  GDLQEGQVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVYFV 106

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
           TQS+GEMATFIPVTSS TVF+ RFLSPA G ANGY+YW +WAIT+A+E+SV+GQ+IQ+WT
Sbjct: 107 TQSMGEMATFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWT 166

Query: 155 DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
            AVPL AWI IFWV +T++N FPV++YGEVEFW+A IKV+AIVG+++YA I+VCG  K G
Sbjct: 167 KAVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGGSKQG 226

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
           P+GFRYWRNPGPWG GIIS D ++GRFLGWV+SLI+A+FTYQGTELVGITAGEAANPRKT
Sbjct: 227 PIGFRYWRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAANPRKT 286

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           VP+AINKV                     N P L    S I+SSPFVI+I+++GT++LP 
Sbjct: 287 VPKAINKVFFRILFFYILSLFFVGLLVPYNHPGLDKHTSVIASSPFVISIQSAGTRILPD 346

Query: 335 IFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFL 394
           IFNAV+L TIISA NSNVYVGSRI +S+A  G+APK  ++ T  G+PY  V+ T++LG L
Sbjct: 347 IFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVICTALLGLL 406

Query: 395 AYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMP 454
           A+L     A+  FNWL+NI+ +AG   W+ ISISHIRFMQ LK +GISRDDLPFK+K MP
Sbjct: 407 AFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMP 466

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKT 514
           +GAYYAA             AF PKFKV++FFT YIS++L  V +   Q+++R   F + 
Sbjct: 467 YGAYYAAFWVAVIIFVQGFQAFCPKFKVAEFFTGYISLILLAVVFCLAQLYYRCRFFNRL 526

Query: 515 EDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           EDID+D+DRREID ++WEE++P  LW KFW A+A
Sbjct: 527 EDIDIDSDRREIDALIWEEEEPTTLWGKFWVAVA 560

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/559 (59%), Positives = 417/559 (74%), Gaps = 12/559 (2%)

Query: 1   MSLSKDYEATREKDGSHLII--------KPS---IAEDAVSMESLGSVKETQVKRALKPR 49
           M+++ D E   +KD    I          PS   I+ D    +     K+T+VKRALKPR
Sbjct: 51  MTVTYDNEILEKKDSKSDIFTSVNRYASHPSEARISSDEYDHQE-AEFKDTKVKRALKPR 109

Query: 50  HISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTS 109
           HI MIALGGTIGTGLFI IS PL  +GPVG+LIAY+F+GT+ Y VTQ+LGEMATFIPVTS
Sbjct: 110 HIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIAYIFMGTVVYFVTQALGEMATFIPVTS 169

Query: 110 SFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVI 169
           S TVF+ RFLSPA G +NGYLYW +WAIT+A+E+SVVGQ+I+FWT  VPL AWI+IFWV+
Sbjct: 170 SITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEISVVGQVIEFWTTKVPLAAWISIFWVL 229

Query: 170 LTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGP 229
           +T  N FPV  YGE+EFW+A +KVLAIVG++IYA ++VCG  K GP+GFRYWR+    G 
Sbjct: 230 VTALNFFPVSVYGEIEFWVASVKVLAIVGYLIYALVIVCGGSKQGPIGFRYWRHGYAMGG 289

Query: 230 GIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXX 289
           G+ISKD NE RFLGWV+SLI+AAFTYQGTELVGITAGEAANPRK+VPRAINKV       
Sbjct: 290 GMISKDKNEARFLGWVASLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIVIF 349

Query: 290 XXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGN 349
                         NDPKL S  SYI+SSPFVI+IEN+GT+ LPHIFNA+I+ TIISA N
Sbjct: 350 YILSLFFIGLLVPYNDPKLNSATSYIASSPFVISIENAGTRALPHIFNAIIMITIISAAN 409

Query: 350 SNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNW 409
           SNVYV SR+ YS+A++G APK     T  G+P+  V+ T+++G LA+L  ++ A+  FNW
Sbjct: 410 SNVYVSSRVLYSLALSGHAPKIFARVTPQGVPFLGVIVTALMGLLAFLVVNNNANEAFNW 469

Query: 410 LLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXX 469
           L+NI+ +AG   W+ IS+SH+RFM+ALK++GISRDDLPFKA+FMP+G+YYA         
Sbjct: 470 LINISTLAGLCAWLFISMSHLRFMEALKYRGISRDDLPFKARFMPYGSYYACFFITVIIF 529

Query: 470 XXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDV 529
               TAF+PKF V+ FFTAYIS++L  V +IG Q+++R   F K EDID+DTDRREID++
Sbjct: 530 IQGFTAFSPKFDVASFFTAYISLILLAVLFIGCQLYYRCRFFWKVEDIDIDTDRREIDEI 589

Query: 530 VWEEQKPRNLWEKFWAAIA 548
           VWE+ +P+  W+KFWAA+A
Sbjct: 590 VWEDDEPKTAWDKFWAAVA 608

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/537 (62%), Positives = 409/537 (76%), Gaps = 5/537 (0%)

Query: 15  GSHLIIKPSIAEDAVSMESLGS---VKETQVKRALKPRHISMIALGGTIGTGLFISISTP 71
           GS LI  P   + A +  +L +   VK   VKRALKPRHI+MIALGGTIGTGLF+ I+ P
Sbjct: 65  GSELI--PDCLQSATNTGTLCTEEHVKHRSVKRALKPRHIAMIALGGTIGTGLFMGIAKP 122

Query: 72  LSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLY 131
           L NAGPVGALIAY+F+GT+ +SVTQSLGEM TFIPVTSSFTVF+ RFLSPA G+ANGY+Y
Sbjct: 123 LRNAGPVGALIAYIFVGTIIFSVTQSLGEMVTFIPVTSSFTVFSHRFLSPAFGAANGYMY 182

Query: 132 WLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACI 191
           W SWA+TFA+ELSV+G++IQFWT AVPL AWI IFW +LT+SN+FPVKYYGE+EFWIA +
Sbjct: 183 WFSWAMTFAVELSVLGKVIQFWTTAVPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFL 242

Query: 192 KVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISA 251
           KVL++VGF+I+   +  GAG  GP GFRYWR+PG WGPGII++D +E RFLGWVSSLI+A
Sbjct: 243 KVLSLVGFLIFCLCITSGAGPHGPFGFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINA 302

Query: 252 AFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSE 311
           AFTYQGTELVGITAGEAANPRK VP+AI KV                     NDPKL S 
Sbjct: 303 AFTYQGTELVGITAGEAANPRKAVPKAIKKVILRILFFYVGSLFFIGMLVPFNDPKLTSA 362

Query: 312 DSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKY 371
            S++SSSPF+IAI+NSG  +LP IFN VIL TIISAGNSNVYVGSRI + +A + LAP++
Sbjct: 363 TSFVSSSPFIIAIQNSGVSLLPSIFNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQF 422

Query: 372 LTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIR 431
            T TTK+G+P+ AVL TS+ G LA+LE ++    VFNWLL+I A+AGFF W+LIS+SHIR
Sbjct: 423 FTRTTKTGVPFVAVLFTSLFGSLAFLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIR 482

Query: 432 FMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYIS 491
           FM+AL+++GISR+ LPFKA FMPW AYYA             TAFAP+F VSDF  +YIS
Sbjct: 483 FMKALEYRGISRNSLPFKAIFMPWLAYYATAFIILIILIQGFTAFAPRFNVSDFVASYIS 542

Query: 492 VMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           ++LF + W  FQ   +  +F K EDIDLD+DR++I+D+ WE+  P+  W K W  +A
Sbjct: 543 LLLFVIIWGVFQAMKKCRIFWKVEDIDLDSDRKDIEDIRWEDDSPKTFWTKVWQTLA 599

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/539 (61%), Positives = 412/539 (76%), Gaps = 8/539 (1%)

Query: 10  TREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISIS 69
           TR +  SH   +  I ED    E     ++  VKRALK RHI MIALGGTIGTGLF+ IS
Sbjct: 81  TRLQVVSH---ETDINED----EEEAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGIS 133

Query: 70  TPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGY 129
           TPLSNAGPVG+LIAY+F+GT+ Y VTQSLGEMATFIPVTSS TVF++RFLSPA G +NGY
Sbjct: 134 TPLSNAGPVGSLIAYIFMGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGY 193

Query: 130 LYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIA 189
           +YW +WAIT+A+E+SV+GQ+I++WTD VPL AWIAIFWVI+T+ N FPVK YGE EFW+A
Sbjct: 194 MYWFNWAITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVA 253

Query: 190 CIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLI 249
            +KVLAI+G++IYA I+VCG    GP+GFRYWRNPG WGPGIIS D +EGRFLGWVSSLI
Sbjct: 254 SVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSSLI 313

Query: 250 SAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK 309
           +AAFTYQGTELVGITAGEAANPRKTVPRAINKV                     ND +L 
Sbjct: 314 NAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRLS 373

Query: 310 SEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAP 369
           +  + I+SSPFVI+I+N+GT  LP IFNAV+L T++SA NSNVYVGSR+ YS+A  G AP
Sbjct: 374 ASSAVIASSPFVISIQNAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAP 433

Query: 370 KYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISH 429
           K   + T+ G+PY  V+ T+ LG LA+L  ++ A+  FNWL+NI+ +AG   W+ IS++H
Sbjct: 434 KQFGYVTRQGVPYLGVVCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAH 493

Query: 430 IRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAY 489
           IRFMQALKH+GISRDDLPFKAK MP+GAYYAA             AF P FKVS+FFT+Y
Sbjct: 494 IRFMQALKHRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCP-FKVSEFFTSY 552

Query: 490 ISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           IS++L  V +IG QI+++     K EDID+D+DRREI+ ++WE+ +P+NLWEKFWAA+A
Sbjct: 553 ISLILLAVVFIGCQIYYKCRFIWKLEDIDIDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/532 (61%), Positives = 408/532 (76%), Gaps = 8/532 (1%)

Query: 25  AEDAVSMESLGS--------VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAG 76
           ++D  S + LGS        ++E +VKRALKPRH+SMIALGGTIGTGLF+ I++PLS +G
Sbjct: 90  SQDEPSTDPLGSDTESGEGDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSG 149

Query: 77  PVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWA 136
           PVGALIAY+F+GT+ Y VTQS+GEMATFIPVTSS TVF+ RFLSPA G ANGY+YW +WA
Sbjct: 150 PVGALIAYIFMGTVVYFVTQSMGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWA 209

Query: 137 ITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAI 196
           ITFA+ELSV GQ+I++WT+AVP  AWIAIFWV++T++N FPV++YGEVEFW+A IKVLAI
Sbjct: 210 ITFAVELSVTGQVIEYWTEAVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAI 269

Query: 197 VGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQ 256
           VG++IYA ++VCG  K GP+GFRYWRNPGPWG GIISKD +EGRFLGWV+SLI+A+FTYQ
Sbjct: 270 VGYLIYALVIVCGGSKQGPIGFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTYQ 329

Query: 257 GTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYIS 316
           GTELVGITAGEAANPR+TVPRAINKV                     N   L    + I+
Sbjct: 330 GTELVGITAGEAANPRRTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSLDKTTTVIA 389

Query: 317 SSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTT 376
           SSPFVI+I+N+GT+ LP IFNAV+L TIISA NSNVYVGSR+ +S+A  G+APK  +  T
Sbjct: 390 SSPFVISIQNAGTRALPDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVT 449

Query: 377 KSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQAL 436
             G+P+  V+ TS+LG LA+L  +  A+  FNWL+NI+ +AG   W+ ISISHIRFMQ L
Sbjct: 450 PQGVPFMGVIVTSLLGLLAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCL 509

Query: 437 KHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFF 496
           K +GISRDDLPFK+K MP+GAYYAA             AF+P FKV++FFT+YIS+ML  
Sbjct: 510 KQRGISRDDLPFKSKLMPYGAYYAAFWVTVIIFVQGFQAFSPHFKVTEFFTSYISLMLLV 569

Query: 497 VFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           V + G Q+++R   F + EDID+D+DRRE D ++WE+ +P  LW KFW A+A
Sbjct: 570 VVFCGAQLFYRCRFFNRLEDIDIDSDRREADALIWEDDEPTTLWGKFWTAVA 621

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/555 (58%), Positives = 417/555 (75%), Gaps = 9/555 (1%)

Query: 2   SLSKDYEATREK--DGSHLIIKPSIAEDA-----VSMESLGSVKETQVKRALKPRHISMI 54
           +L+++  + + K  +GS + ++ SI  D+        E  G   ET+VKRALK RHISMI
Sbjct: 14  TLTRERYSKKAKGNNGSEIALE-SITPDSGDEFPEEHEQEGDYHETEVKRALKARHISMI 72

Query: 55  ALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVF 114
           ALGGTIGTGLFI I++PL  AGPVG+LIAY+F+GT+ YS+TQSLGEMATFIPVTSS TVF
Sbjct: 73  ALGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMGTVVYSITQSLGEMATFIPVTSSVTVF 132

Query: 115 TQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISN 174
           ++RFLSPA G ANGY+YW +WAITFA+ELSVVGQII +WT  VPL AWI IFW+I+T+ N
Sbjct: 133 SKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIINYWTSVVPLGAWITIFWIIVTLLN 192

Query: 175 LFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISK 234
            FPV++YGE+EFWIA +KV+ IVG++IYAFI+VCG    GP+GFR WRNPGPWG G+IS 
Sbjct: 193 FFPVRFYGEIEFWIASVKVITIVGYLIYAFIVVCGGSSQGPIGFRNWRNPGPWGTGVISS 252

Query: 235 DVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXX 294
           +  E RFLGWVSSLI AAFTYQGTELVGITAGE+ NPRKTVP+AINKV            
Sbjct: 253 NQTEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSL 312

Query: 295 XXXXXXXXXNDPKL-KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVY 353
                    NDP++  + D+ +++SPFVI+I N+GTK+LP IFNAV+L T++SA NSNVY
Sbjct: 313 FFVGLLVPYNDPRMDNTSDTDVNASPFVISIRNAGTKILPDIFNAVVLVTVVSAANSNVY 372

Query: 354 VGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNI 413
           +GSR+ YS+A +G APK   +  + G+P   V+ T+++G +A+L  ++ A A FNWL+NI
Sbjct: 373 IGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMVTALMGLMAFLVVNNNAKAAFNWLVNI 432

Query: 414 TAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXX 473
           + +AG   W+ IS++HIRFMQ LK +GISRD LPFKAKFMPW AYYAA            
Sbjct: 433 STLAGLCAWLFISLAHIRFMQCLKQRGISRDALPFKAKFMPWAAYYAASFVFVIIFIQGY 492

Query: 474 TAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEE 533
           TAF+PKF V+ FFTAYIS+ML  V +IG QI+++     K EDID+DT+RREID +VWE+
Sbjct: 493 TAFSPKFDVTQFFTAYISLMLMLVVFIGCQIYYKCRFLWKLEDIDIDTNRREIDAIVWED 552

Query: 534 QKPRNLWEKFWAAIA 548
            +P+NLW+KFW+ IA
Sbjct: 553 DEPKNLWDKFWSTIA 567

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/508 (63%), Positives = 400/508 (78%), Gaps = 1/508 (0%)

Query: 41  QVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGE 100
            VKRALK RHI MIALGGTIGTGLF+ ISTPLSNAGPVG+LIAY+F+GT+ Y +TQSLGE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 101 MATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLT 160
           MATFIPVTSS TVF++RFLSPA G +NGY+YW +WAIT+A+E+SV+GQ+IQ+WTD VPL 
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPLA 224

Query: 161 AWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRY 220
           AWIAIFWV++T+ N FPVK YGE EFW+A +KVLAIVG++IYA ++VCG    GP+GFRY
Sbjct: 225 AWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGSHQGPIGFRY 284

Query: 221 WRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAIN 280
           WRNPG WGPGIISK+ +EGRFLGWVSSLI+AAFTYQGTELVGITAGEAANPRKTVPRAIN
Sbjct: 285 WRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIN 344

Query: 281 KVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVI 340
           KV                     N+P+L    + I+SSPFVI+I+N+GT  LP IFNAV+
Sbjct: 345 KVVFRIVIFYIMSLFFIGLLVPYNEPRLSPSSAVIASSPFVISIQNAGTYALPDIFNAVV 404

Query: 341 LSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESS 400
           L T+ISA NSNVYVGSR+ YS+A +G APK   + TK G+PY  VL+T+ LG LA+L  +
Sbjct: 405 LITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLAFLVVN 464

Query: 401 SGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYA 460
           + A+  FNWL++I+ +AG   W+ IS++HIRFMQALK +GISRDDLPFKAK MP+GAYYA
Sbjct: 465 NNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPYGAYYA 524

Query: 461 AXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLD 520
           +             AF P F VS+FFT+YIS++L  V +I  Q++++     K EDID+D
Sbjct: 525 SFFVTIIIFIQGFQAFCP-FSVSEFFTSYISLILLAVVFISCQLYYKCRFIWKLEDIDID 583

Query: 521 TDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           +DRREI+ ++WE+ +P+NLWEKFWAA+A
Sbjct: 584 SDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/511 (63%), Positives = 401/511 (78%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97
            +T+VKRALK RHI MIALGGTIGTGLF+ IS PL+N+GPVG+LIAY+F+G++ YS+TQS
Sbjct: 97  HDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQS 156

Query: 98  LGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAV 157
           LGEMATFIPVTSS TVF++RFLSPA G ANGY+YW +WAIT+A+E+SVVGQ+I++WT  V
Sbjct: 157 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTKKV 216

Query: 158 PLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
           PL AWIAIFWV +T+ N FPVK YGE+EFWIA +KVLAI G+++YA I+VCG    GP+G
Sbjct: 217 PLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGSSQGPIG 276

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           FRYWRNPGPWG GIISKD N  RFLGWVSSLI+AAFTYQGTELVGITAGEAANPRK+VPR
Sbjct: 277 FRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 336

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           AINKV                     +DP+L S+ + ++SSPFVI+I+N+GTK+LP IFN
Sbjct: 337 AINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDSAVVASSPFVISIQNAGTKILPDIFN 396

Query: 338 AVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYL 397
           A+++ T+ISA NSNVYVGSR+ Y++A  G APK   + T+ G+PY  VL T+ LG LA+L
Sbjct: 397 AIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGLLAFL 456

Query: 398 ESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
             ++ A+  FNWL+NI+ +AG   W+ ISISHIRFMQALK +GISRDDLPFKAKFMPW A
Sbjct: 457 VVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFMPWAA 516

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDI 517
           YYA              AF+P F V+ FFTAYIS+++  V +IG QI++R   F K EDI
Sbjct: 517 YYATFFVTVIIFIQGFQAFSPHFDVTAFFTAYISLIILAVLFIGCQIYYRCRFFWKLEDI 576

Query: 518 DLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           D+DTDRREI++V+WE+ +P+  W+KFWAA+A
Sbjct: 577 DIDTDRREIEEVIWEDDEPKTYWDKFWAAVA 607

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/511 (63%), Positives = 400/511 (78%), Gaps = 1/511 (0%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97
           ++  VKRALK RHI MIALGGTIGTGLF+ ISTPLS AGPVG+LI+Y+F+GT+ Y +TQS
Sbjct: 103 EDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQS 162

Query: 98  LGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAV 157
           LGEMATFIPVTSS TVF++RFLSPA G ANGY+YW +WAIT+A+E+SV+GQ+IQ+WTD V
Sbjct: 163 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTDKV 222

Query: 158 PLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
           PL  WIAIFWV++T+ N FPVK YGE EFW+A +KVLAI+G++IYA ++VCG    GP+G
Sbjct: 223 PLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSHQGPIG 282

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           FRYWRNPG WGPGIIS D NEGRFLGWVSSLI+AAFTYQGTELVGITAGEAANPRKTVPR
Sbjct: 283 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 342

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           AINKV                     N+P+L +  + I+SSPFVI+I+N+GT  LP IFN
Sbjct: 343 AINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSASSAVIASSPFVISIQNAGTYALPDIFN 402

Query: 338 AVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYL 397
           AV+L T+ISA NSNVYVGSR+ YS+A  G APK   + TK G+PY  VL+T+ LG LA+L
Sbjct: 403 AVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFL 462

Query: 398 ESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
             ++ A+  FNWL+NI+ +AG   W+ IS++HIRFMQAL+ +GISRDDLPFKAK MP+GA
Sbjct: 463 VVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMPYGA 522

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDI 517
           YYAA             AF P FKVSDFFT+YIS++L  V + G Q++++     K EDI
Sbjct: 523 YYAAFFVTVIIFIQGFQAFCP-FKVSDFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDI 581

Query: 518 DLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           D+DTDRREI+ ++WE+ +P+NLWEKFWAA+A
Sbjct: 582 DIDTDRREIEAIIWEDDEPKNLWEKFWAAVA 612

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/548 (60%), Positives = 423/548 (77%), Gaps = 1/548 (0%)

Query: 2   SLSKDYEATREK-DGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTI 60
           +LSK  +A  +  + S + +   + + A S E  G   ET+VKRALKPRH+SMIALGGTI
Sbjct: 32  TLSKRSKAGEDSIELSDVQVSSELYDHAESEEGEGDFHETEVKRALKPRHVSMIALGGTI 91

Query: 61  GTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLS 120
           GTGLF+ I+ PLS +GPVG+LIAY+F+G++ Y VTQSLGEMATFIPVTSS TVF++RFLS
Sbjct: 92  GTGLFVGIAKPLSLSGPVGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSSITVFSKRFLS 151

Query: 121 PALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKY 180
           PA G ANGY+YW +WAIT+A+ELSV+GQII +WTDAVPL AWIAIFWV+LT +N FPVK+
Sbjct: 152 PAFGVANGYMYWFNWAITYAVELSVLGQIINYWTDAVPLAAWIAIFWVLLTAANFFPVKW 211

Query: 181 YGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGR 240
           YGE EF +A IKV+AIVG+++YA I+VCG    GP+GFRYWRNPGPWG G I+K+VN+ R
Sbjct: 212 YGEFEFCVASIKVIAIVGYLLYALIIVCGGSSQGPIGFRYWRNPGPWGTGTIAKNVNKAR 271

Query: 241 FLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXX 300
           FLGWV SL++A+FTYQGTELVGITAGEA+NPRKTVP+AINKV                  
Sbjct: 272 FLGWVGSLVNASFTYQGTELVGITAGEASNPRKTVPKAINKVFFRILVFYIGSLFFVGLL 331

Query: 301 XXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAY 360
              N P+L+S  + I+SSPFVI+I+N+GTKVLP IFNAV+L TI+SAGNSNVYVGSR+ Y
Sbjct: 332 VPYNSPQLESNSAVIASSPFVISIQNAGTKVLPDIFNAVVLVTILSAGNSNVYVGSRVLY 391

Query: 361 SMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFF 420
           S+A++G APK  ++ TK G+PY  V+ T++LG LA+L ++  A+  FNWL+NI+ +AG  
Sbjct: 392 SLALSGNAPKQFSYVTKQGVPYLGVICTALLGLLAFLATNENANTAFNWLINISTLAGLC 451

Query: 421 TWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF 480
            W  IS++HIRFMQ LK +GISRD LPFKAK MPWGAYYAA            TAFAP+F
Sbjct: 452 AWFFISVAHIRFMQCLKLRGISRDSLPFKAKLMPWGAYYAAFFVGLIVFIQGFTAFAPRF 511

Query: 481 KVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLW 540
            VS+FFTAYIS++L  V +I  Q+++R     K EDID+D+DRREID ++WE+ +P+NLW
Sbjct: 512 DVSEFFTAYISLILLVVLFILCQLYYRCRFLTKIEDIDIDSDRREIDAIIWEDDEPKNLW 571

Query: 541 EKFWAAIA 548
           EKFW A+A
Sbjct: 572 EKFWVALA 579

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/525 (61%), Positives = 403/525 (76%), Gaps = 2/525 (0%)

Query: 26  EDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYM 85
           E+   +ESL    +  VKR LKPRH+SMI+LGGTIGTGLF+ I++P+  AGPVG+L+AY+
Sbjct: 46  ENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYL 105

Query: 86  FIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSV 145
           F+GT+A+ VTQSLGEMATFIPVTSSFT++TQRFLSPALG+ANGYLYW SW +TFALELS+
Sbjct: 106 FMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSI 165

Query: 146 VGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFI 205
           +GQ+IQ+WT AVPL+ WI +FW++LT SN+ PV++YGE+EFWIA +KVL+I GF+IYA +
Sbjct: 166 IGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALV 225

Query: 206 MVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITA 265
           MVCG    G +GFRYW+NPGPWG G+IS +  E RFLGWVSSLI AAFTYQGTELVGITA
Sbjct: 226 MVCGGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITA 285

Query: 266 GEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK-SEDSYISSSPFVIAI 324
           GE+ NPRKTVP+AINKV                      DP+L  + DS I++SPFV+AI
Sbjct: 286 GESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAI 345

Query: 325 ENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAA 384
           +NSGTKVLP +FN VIL TI+SAGNSN+Y+GSR+ Y ++ +GLAP     T K G+P+ A
Sbjct: 346 QNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYA 405

Query: 385 VLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRD 444
           VLT+S+ G LAYL  S  A  VF+WLL ITAVAGFF W+LIS+SHIRFMQ LK +GISR+
Sbjct: 406 VLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRN 465

Query: 445 DLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQI 504
           DLPFKAKFMPWGAYYAA             +FAP+F  S+F   YISV LF V W+GFQ+
Sbjct: 466 DLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQV 525

Query: 505 WFRGPLFIKTEDIDLDTDRREIDDVVW-EEQKPRNLWEKFWAAIA 548
            F+  L ++ ED+D+DTDRREID +VW ++ +P+ L +K W + +
Sbjct: 526 LFKTRLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQSFS 570

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/519 (66%), Positives = 401/519 (77%), Gaps = 2/519 (0%)

Query: 30  SMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGT 89
            +++ G V+E QVKR LKPRHI MIALGGTIGTGLFI I+TP+ NAGPVG+LIAY+F+GT
Sbjct: 90  DIDATGVVEEAQVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGT 149

Query: 90  LAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQI 149
           L +SVTQSLGEMATFIPVTSSFTVF  RF+S   G+A GY+YW SWAITFALELSVVGQ+
Sbjct: 150 LVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQV 209

Query: 150 IQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG 209
           I+FWT  VPL AWI+IFWV++ I N FPVK YGE EFW+A IKV+AI+GFIIY   MVCG
Sbjct: 210 IEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG 269

Query: 210 AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAA 269
           AG TGPVGFRYWR+PGPWGPGIISKD NE RFLGWVSSLI+AAFTYQGTELVGITAGEAA
Sbjct: 270 AGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAA 329

Query: 270 NPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGT 329
           NPRK+VPRAI KV                     NDPKL S DSY+S+SPF+IAI+NSGT
Sbjct: 330 NPRKSVPRAIKKVSVRILLFYILSLFFIGLLVPYNDPKLSSTDSYVSASPFIIAIQNSGT 389

Query: 330 KVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTS 389
           KVLPHIFNAVIL+TIISA NSNVYVGSRI Y ++   LAPK+    T++G+P+ AVL T+
Sbjct: 390 KVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQ-KTRNGVPFIAVLFTA 448

Query: 390 VLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFK 449
             G LAY+E+S+G    FNWLLNIT VAGFF W+ ISISHIRFMQ LKH+G+SRDDLP+K
Sbjct: 449 AFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYK 508

Query: 450 AKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGP 509
           A  MP  AYY A            TAFAPKF  + F TAYIS  LF   +I  Q +FR  
Sbjct: 509 AALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTR 568

Query: 510 LFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           L+   +D+D+DTDRR+ID V+WEE  P+  W+KFWA IA
Sbjct: 569 LWRTLDDVDIDTDRRDIDTVIWEE-GPQTFWDKFWAVIA 606

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/532 (64%), Positives = 413/532 (77%), Gaps = 7/532 (1%)

Query: 23  SIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALI 82
           S  ED   + S GSV + +VKR LK RHI MIALGGTIGTGLFI ISTPL ++GPVG+LI
Sbjct: 44  STTEDEEMLNS-GSVHDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLI 102

Query: 83  AYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALE 142
           AY+F+GTL Y+VTQSLGEMATFIPVTSSFTVF  RFLSP++G+A GY+YW SWA+TFALE
Sbjct: 103 AYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALE 162

Query: 143 LSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIY 202
           LSVVGQI+ +WT AVP+ AWI+IFWVILT  N+FPVK+YGE+EFW+A +KV+AIVGF+IY
Sbjct: 163 LSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIY 222

Query: 203 AFIMVCGAGKTGPVGFRYWRNPGPWGPGI------ISKDVNEGRFLGWVSSLISAAFTYQ 256
              MVCGAG TGPVGFRYWRNPGPWG G+      ISK+ N GRFLGW +SLI+AAFTYQ
Sbjct: 223 CLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQ 282

Query: 257 GTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYIS 316
           GTELVGITAGEAANPRKTVPRAI KV                     +DPKL S+DSY+S
Sbjct: 283 GTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLSSDDSYVS 342

Query: 317 SSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTT 376
           SSPF+IAIENSGTK+LP IFNA+IL TIISAGNSN+YVGSRI +S+A  GLAPK L+ TT
Sbjct: 343 SSPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTT 402

Query: 377 KSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQAL 436
           K G+P+ +VL T+V G LAY+E++ G   VF+WL+NITA+AGF+ W+ I ISHIRFMQ L
Sbjct: 403 KKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVL 462

Query: 437 KHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFF 496
           K +GISRDDLPFKA  MP  AYYA             TAF P F VSDFF AYISV+LFF
Sbjct: 463 KFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFF 522

Query: 497 VFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           + W  FQ+WF+     K ED+D+D++RR+++ ++WE+ +P+  W+KFW  +A
Sbjct: 523 LIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/525 (64%), Positives = 408/525 (77%), Gaps = 1/525 (0%)

Query: 21  KPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGA 80
           K SI  D+         K  +VKR LK RHI MIALGGTIGTGL I I  PL++AGPVGA
Sbjct: 45  KSSINNDSAKETETSPRKGGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGA 104

Query: 81  LIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFA 140
           LI+Y+F+GT+ YSVTQSLGEMATFIPVTSSF+VF QRFLSPALG+ NGY+YWLSW  TFA
Sbjct: 105 LISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFA 164

Query: 141 LELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFI 200
           LELSV+GQIIQ+WTDAVPL AWI IFW +LT+ N+FPVKYYGE EF IA IKV+A++GFI
Sbjct: 165 LELSVLGQIIQYWTDAVPLVAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFI 224

Query: 201 IYAFIMVCGAGKTG-PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTE 259
            ++F +VCGAG++G P+GFRYWRNPG WGPGIISK+ NEGRFLGWVSSLI+AAFTYQGTE
Sbjct: 225 FFSFCIVCGAGQSGGPIGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTYQGTE 284

Query: 260 LVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSP 319
           LVGITAGEAANPR+ VPRAI KV                     NDPKL SE +++SSSP
Sbjct: 285 LVGITAGEAANPRRAVPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSEGTFVSSSP 344

Query: 320 FVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSG 379
           F+I+IENSGTKVLP IFNAV+L TI+SAGNSNVY+GSR+ YS++ N LAP++L+  TK G
Sbjct: 345 FMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGG 404

Query: 380 IPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQ 439
           +PY AVL+TS  GFLA+LE+S+G+  VFNWLLNIT VAGFF W+LIS+SHIRFMQA+K +
Sbjct: 405 VPYFAVLSTSAFGFLAFLETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKR 464

Query: 440 GISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFW 499
           GISRDDLP++A+ MP+ AYYA+            TAFAP F+  DF  AYISV LF   W
Sbjct: 465 GISRDDLPYRARMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFIAAYISVFLFIAIW 524

Query: 500 IGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFW 544
           + FQ+WF+     K +D+D+D+DRR+I++ VW E + +  W+  W
Sbjct: 525 LLFQVWFKCRFVWKLQDVDIDSDRRDIEEQVWIEPECKTRWQHVW 569

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/511 (62%), Positives = 400/511 (78%), Gaps = 1/511 (0%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97
           ++  V+RALK RHI MIALGGTIGTGLF+ ISTPLSNAGPVG+LIAY+F+GT+ Y VTQS
Sbjct: 102 EDKHVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQS 161

Query: 98  LGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAV 157
           LGEMATFIPVTSS TVF++RFLSPA G +NGY+YW +WAIT+A+E+SV+GQ+I++WT  V
Sbjct: 162 LGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTKV 221

Query: 158 PLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
           PL  WIAIFWV++T+ N FPVK YGE EFW+A +KVLAI+G++IYA ++VCG  K GP+G
Sbjct: 222 PLGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSKQGPIG 281

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           FRYWRNPG WGPGIIS D NEGRFLGWVSSLI+AAFTYQGTELVGITAGEAANPRKTVPR
Sbjct: 282 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 341

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           AINKV                      DP+L +  + I+SSPFVI+I+N+GT  LP IFN
Sbjct: 342 AINKVVFRIVLFYIMSLFFIGLLVPYTDPRLSASSAVIASSPFVISIQNAGTYALPDIFN 401

Query: 338 AVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYL 397
           A++L T+ISA NSNVYVGSR+ YS+A  G APK   + TK G+PY  VL+T+ LG LA+L
Sbjct: 402 AIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFL 461

Query: 398 ESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
             ++ A+  FNWL+NI+ +AG   W+ IS+SHIRFMQAL  +GISRDDLPFKAKFMP+GA
Sbjct: 462 VVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMPYGA 521

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDI 517
           YYA+             +F P F+V+DFFT+YIS++L  V + G Q++++     K EDI
Sbjct: 522 YYASFFVTVIIFIQGFQSFCP-FRVADFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDI 580

Query: 518 DLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           D+D+DRREI+ ++WE+ +P+NLWEKFWAA+A
Sbjct: 581 DIDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/536 (63%), Positives = 406/536 (75%), Gaps = 2/536 (0%)

Query: 11  REKDGSHLII-KPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISIS 69
            E+D S  I    SI  D             +V+R LK RHI MIALGGTIGTGL I I 
Sbjct: 34  EEQDTSAAIAANSSIENDGAKGTETSPRSRGEVQRKLKERHIGMIALGGTIGTGLIIGIG 93

Query: 70  TPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGY 129
            PL++AGPVGALI+Y+F+GT+ YSVTQSLGEMATFIPVTSSF+VF QRFLSPALG+ NGY
Sbjct: 94  PPLAHAGPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGY 153

Query: 130 LYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIA 189
           +YWLSW  TFALELSV+GQIIQ+WT AVPL AWI IFW +LT+ N+FPVKYYGE EF IA
Sbjct: 154 MYWLSWCFTFALELSVLGQIIQYWTHAVPLAAWIVIFWCLLTLMNMFPVKYYGEFEFCIA 213

Query: 190 CIKVLAIVGFIIYAFIMVCGAGK-TGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSL 248
            IKV+ ++GFII++F +VCGAG+  GP+GFRYWRNPG WGPGIIS + NEGRFLGWVSSL
Sbjct: 214 SIKVITLLGFIIFSFCIVCGAGQPDGPIGFRYWRNPGAWGPGIISSNKNEGRFLGWVSSL 273

Query: 249 ISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL 308
           I+AAFTYQGTELVGITAGEAANPRK VPRAI KV                     NDPKL
Sbjct: 274 INAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVIRILVFYILSLFFIGLLVPYNDPKL 333

Query: 309 KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLA 368
            S+ +++S+SPF+I+IENSGTKVLP IFNAV+L TI SAGNSNVY+GSR+ YS++ N LA
Sbjct: 334 DSDGTFVSASPFMISIENSGTKVLPDIFNAVVLITIFSAGNSNVYIGSRVLYSLSKNSLA 393

Query: 369 PKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISIS 428
           PK L+  T+ G+PY AVL TS+ GFLA+LE+S+G+   FNWLLNIT VAGFF W+LIS S
Sbjct: 394 PKCLSNVTRGGVPYLAVLLTSLFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFS 453

Query: 429 HIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTA 488
           HIRFMQA+K +GISRDDLP+KA+ MP+ AYYA+            TAFAP F+  DF  A
Sbjct: 454 HIRFMQAIKKRGISRDDLPYKARMMPFLAYYASFFIALIVLIQGFTAFAPTFQPVDFVAA 513

Query: 489 YISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFW 544
           YISV LF + W+ FQ+WF+  L  K +DID+D+DRREI++ VW E + +  W++ W
Sbjct: 514 YISVFLFAIIWLSFQLWFKCRLICKLQDIDIDSDRREIEEQVWIEPECKTRWQRVW 569

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/544 (60%), Positives = 413/544 (75%), Gaps = 1/544 (0%)

Query: 6   DYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLF 65
           D + + E     +  +  + +DA         +  +VKR LK RHI MIALGGTIGTGL 
Sbjct: 30  DEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLI 89

Query: 66  ISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGS 125
           I I  PL++AGPVGALI+Y+F+GT+ YSVTQSLGEM TFIPVTSSF+VF QRFLSPALG+
Sbjct: 90  IGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA 149

Query: 126 ANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVE 185
            NGY+YWLSW  TFALELSV+G++IQ+WT+AVPL AWI IFW +LT  N+FPVKYYGE E
Sbjct: 150 TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFE 209

Query: 186 FWIACIKVLAIVGFIIYAFIMVCGAGKT-GPVGFRYWRNPGPWGPGIISKDVNEGRFLGW 244
           F IA IKV+A++GFII++F +VCGAG++ GP+GFRYWRNPG WGPGIIS D NEGRFLGW
Sbjct: 210 FCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGW 269

Query: 245 VSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXN 304
           VSSLI+AAFTYQGTELVGITAGEAANPRK +PRAI KV                     N
Sbjct: 270 VSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN 329

Query: 305 DPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAM 364
           DPKL S+  ++SSSPF+I+IENSGTKVLP IFNAV+L TI+SAGNSNVY+GSR+ YS++ 
Sbjct: 330 DPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSK 389

Query: 365 NGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWIL 424
           N LAP++L+  T+ G+PY +VL+TSV GFLA+LE S+G+   FNWLLNIT VAGFF W+L
Sbjct: 390 NSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL 449

Query: 425 ISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSD 484
           IS SHIRFMQA++ +GISRDDLP+KA+ MP+ AYYA+            TAFAP F+  D
Sbjct: 450 ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPID 509

Query: 485 FFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFW 544
           F  AYIS+ LF   W+ FQ+WF+  L  K +DID+D+DRR+I+++VW E + +  W++ W
Sbjct: 510 FVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRRQIEELVWIEPECKTRWQRVW 569

Query: 545 AAIA 548
             ++
Sbjct: 570 DVLS 573

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/554 (58%), Positives = 411/554 (74%), Gaps = 19/554 (3%)

Query: 2   SLSKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIG 61
           SL+  Y  +R        ++P   EDA   +     ++ QVKR LK RHI MIALGGTIG
Sbjct: 56  SLTHAYSRSR--------VEPEHDEDAEEAD----YEDKQVKRELKQRHIGMIALGGTIG 103

Query: 62  TGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSP 121
           TGLF+ I+TPL++AGPVGALIAY+F+G++ Y VTQ+LGEMATFIPVTSS TVF+QRFLSP
Sbjct: 104 TGLFVGIATPLADAGPVGALIAYIFMGSIVYFVTQALGEMATFIPVTSSITVFSQRFLSP 163

Query: 122 ALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYY 181
           A G ANGY+YW +WAITFA+E+SVVGQ+IQ+WTDAVPL AWIAIFWV++T+ N FPVK Y
Sbjct: 164 AFGVANGYMYWFNWAITFAVEISVVGQVIQYWTDAVPLAAWIAIFWVLVTLMNFFPVKVY 223

Query: 182 GEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISK------ 234
           GEVEFW+A +KV+AIVG+++YA I+VCG + K GP+GFRYWRNPG WG G+ S       
Sbjct: 224 GEVEFWVAFMKVIAIVGYLLYALIIVCGGSKKQGPIGFRYWRNPGAWGNGLTSDGEPIYS 283

Query: 235 DVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXX 294
              EGRFLGWV+SLI+AAFTYQGTELVGITAGEAANPRKTVPRAINKV            
Sbjct: 284 SKYEGRFLGWVASLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSL 343

Query: 295 XXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYV 354
                     D +L  + + I+SSPFVI+IEN+GTK+LP IFNA+++ T++SA NSNVYV
Sbjct: 344 FFIGLLVPFTDSRLSDDTTVIASSPFVISIENAGTKILPDIFNAIVMVTVLSAANSNVYV 403

Query: 355 GSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNIT 414
           GSR+ YS+A   +APK     T+ G+P+  V+ TS+LG LA+L   + A+  FNWL++I+
Sbjct: 404 GSRVLYSLAHTKVAPKIFARVTRQGVPFMGVICTSLLGLLAFLVVDNNANTAFNWLVDIS 463

Query: 415 AVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXT 474
            +AG   W+ IS++H+RFMQ LK +GISRDDLPFKAKFMPWG+YYAA             
Sbjct: 464 TLAGLCAWLFISLAHVRFMQVLKQRGISRDDLPFKAKFMPWGSYYAAFWVFVIIFVQGFQ 523

Query: 475 AFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQ 534
           AF+P F V+ FFT YIS++L  V +IG Q+++R     K ED+D+D+DRREI+D +WE+ 
Sbjct: 524 AFSPHFDVTTFFTDYISLILLAVVFIGAQLYYRCRFLWKLEDVDIDSDRREIEDAIWEDD 583

Query: 535 KPRNLWEKFWAAIA 548
           +P+ +W+KFWAAIA
Sbjct: 584 EPKTIWDKFWAAIA 597

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  657 bits (1696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/479 (65%), Positives = 379/479 (79%), Gaps = 1/479 (0%)

Query: 71  PLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYL 130
           PL++AGPVGALI+Y+F+GT+ YSVTQSLGEMATFIPVTSSF+VF QRFLSPALG+ NGY+
Sbjct: 19  PLAHAGPVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYM 78

Query: 131 YWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIAC 190
           YWLSW  TFALELSV+GQIIQ+WTDAVPL+AWI IFW +LT+ N+FPVKYYGE EF IA 
Sbjct: 79  YWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIAS 138

Query: 191 IKVLAIVGFIIYAFIMVCGAGK-TGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLI 249
           IKV+A++GFIIY+F MVCGAG+  GP+GFRYWRNPG WGPGIIS D NEGRFLGWVSSLI
Sbjct: 139 IKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 198

Query: 250 SAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK 309
           +AAFTYQGTELVGITAGEAANPRK VPRAI KV                     NDPKL 
Sbjct: 199 NAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKLD 258

Query: 310 SEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAP 369
           S+ S++S+SPF+I+IENSGTKVLP IFNAV+L TI+SAGNSNVY+GSR+ YS++ N LAP
Sbjct: 259 SDGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLAP 318

Query: 370 KYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISH 429
           ++L+  TK G+PY AVL TSV GFLA+LE+S+G+   FNWLLNIT VAGFF W+LIS SH
Sbjct: 319 RFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSH 378

Query: 430 IRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAY 489
           IRFMQA+  +GISR+DLP+KA+ MP+ AYYA+            TAFAP F+  DF  AY
Sbjct: 379 IRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAPSFQPVDFVAAY 438

Query: 490 ISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           ISV LF   W  FQ+WF+ P+ +K +D+D+D+DRREI++ VW E   +  W+  W  +A
Sbjct: 439 ISVFLFVAIWFSFQLWFKCPIILKLQDVDIDSDRREIEEQVWIEPLRKTKWQCVWDVLA 497

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/541 (58%), Positives = 398/541 (73%), Gaps = 2/541 (0%)

Query: 10  TREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISIS 69
           T E D     + P+  E        G  +ET+VKRALK RHISMIALGGTIGTGLFI I+
Sbjct: 23  TLENDIELQSVTPATGEFPEDHTEEGDYQETEVKRALKARHISMIALGGTIGTGLFIVIA 82

Query: 70  TPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGY 129
           +PL  AGPVG+L+AY+FIGT+ YS+TQSLGEMATFIPVTSS TVF++RFLSPA G ANGY
Sbjct: 83  SPLRTAGPVGSLLAYIFIGTVVYSITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGY 142

Query: 130 LYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIA 189
           +YW +WAITFA+ELSVVGQIIQ+WTD VP+ AWI IFWV++T+ N FPV++YGE+EFWIA
Sbjct: 143 MYWFNWAITFAVELSVVGQIIQYWTDRVPIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIA 202

Query: 190 CIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGR-FLGWVSSL 248
            +KVL IVG++IYAFI+VCG  K GP+G          G    S+   +   FLGWVSSL
Sbjct: 203 SVKVLTIVGYLIYAFIIVCGGSKQGPIGLPATGGIPARGARASSRTTRKRHGFLGWVSSL 262

Query: 249 ISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL 308
           I AAFTYQGTELVGITAGE+ NPRK VP+AINKV                     +DP+L
Sbjct: 263 IKAAFTYQGTELVGITAGESTNPRKNVPKAINKVFFRILFFYIGSLLFVGLLVPYDDPRL 322

Query: 309 KSEDSY-ISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGL 367
            SE S  +++SPFVI+I+N+GTK+LP IFNAV+L T+ISA NSNVY+GSR+AYS+A+ G 
Sbjct: 323 NSESSTDVNASPFVISIKNAGTKILPDIFNAVVLITVISAANSNVYIGSRVAYSLALAGN 382

Query: 368 APKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISI 427
           APK L + TK G+PY  VL TS++G +++L  +  AS  F+WL+NI+ +AG   W+ IS+
Sbjct: 383 APKQLAFVTKQGVPYFGVLITSLMGLMSFLVLNHNASTAFDWLVNISTLAGLCAWLFISL 442

Query: 428 SHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFT 487
           +HIRFMQ LKH+GISRDDLPFKAKFMPW AYYA             TAF PKF V+ FFT
Sbjct: 443 AHIRFMQCLKHRGISRDDLPFKAKFMPWAAYYATFFVTVIIFIQGYTAFTPKFDVTTFFT 502

Query: 488 AYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAI 547
           +YIS+ L  + +IG QI+++       EDID+D+DRREID +VWEE +P+N+W+KFW+A+
Sbjct: 503 SYISLFLMLLVFIGCQIYYKCRFLWAVEDIDIDSDRREIDAIVWEEDEPKNIWDKFWSAV 562

Query: 548 A 548
           A
Sbjct: 563 A 563

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/522 (60%), Positives = 391/522 (74%), Gaps = 1/522 (0%)

Query: 27  DAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMF 86
           D   + + G   +TQVKRALKPRH+ MIALGGTIGTGLF+ IS PLS +GPVG+LIAY+F
Sbjct: 87  DESGLPAKGKFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIF 146

Query: 87  IGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVV 146
           +G++ Y VTQSLGEMATFIPVTSS TVFT+RFLSPALG +NGY+YW +WAITFA ELSV 
Sbjct: 147 MGSVVYFVTQSLGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVT 206

Query: 147 GQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIM 206
           GQIIQ+WT  VPL AWI IFWVI+ + N FPVK YGE+EFW++ +KVLAIVG++IYA ++
Sbjct: 207 GQIIQYWTYKVPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVI 266

Query: 207 VCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAG 266
           VCG  + GP+GFRYWR+   +G G ISK+ +E RFLGWVSSLI+AAFTYQGTELVGI+AG
Sbjct: 267 VCGGSRQGPIGFRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAG 326

Query: 267 EAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIEN 326
           EAANPRKTVPRAINKV                     ND +L    + I+SSPFVI++ N
Sbjct: 327 EAANPRKTVPRAINKVIFRIALFYILSLFFIGLLVPYNDKRLSDGSAIIASSPFVISMLN 386

Query: 327 SGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVL 386
           +GT  LP IFNAVIL T++SA NS+VY+ SR+ Y++A  G APK  T+  + G+PY  V 
Sbjct: 387 AGTSALPDIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVF 446

Query: 387 TTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDL 446
            T ++G+LA+L  S+ A+  FNWL+NI+ +AG   W  I  +HIRFMQALKH+GISRDDL
Sbjct: 447 VTCLVGWLAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDL 506

Query: 447 PFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWF 506
           PFKA+FMPWGAYYAA             AF P +    FFT+YIS++LF V ++G  I++
Sbjct: 507 PFKARFMPWGAYYAAFFVGLIIFIQGYDAFTP-WDTKSFFTSYISLILFGVLYLGCLIYY 565

Query: 507 RGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
           RG L IK EDID+DTDR+E++  VWEE  PRN WEKFWAA+A
Sbjct: 566 RGRLLIKIEDIDIDTDRKEVEAYVWEEDAPRNWWEKFWAAVA 607

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/509 (60%), Positives = 387/509 (76%), Gaps = 3/509 (0%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97
            ++ VKR LKPRH++MI+LGGTIGTGLFI I++P+ NAGPVG+L+AY+F+ T+AY VTQS
Sbjct: 45  NQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVTQS 104

Query: 98  LGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAV 157
           LGEMATFIPVTSSFTVF  RF+SPALG+ANGYLYWLSW ITFALE+SV+G++I +W+DAV
Sbjct: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164

Query: 158 PLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
           P+TAW+AIFWV+LT  NL PVK+YGE EFWIA +KV+AI+ F+ Y  ++VCG  K G +G
Sbjct: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           FRYW++PGPWG GI+S++++  +FLGWVSSLI AAFT+QGTELVG+TAGE  NPR+TVP+
Sbjct: 225 FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSPFVIAIENSGTKVLPHI 335
           AIN V                     +DP+L  + S    ++SPFV+AI  +GTKVLP I
Sbjct: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344

Query: 336 FNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLA 395
            N VI+ TIISAGNSN+YVGSR+ Y +  +GLAP +++ TT  G+PY AVL TS+ G L 
Sbjct: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404

Query: 396 YLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPW 455
           YL  SS + +VF+WLL+ITAV+GFFTW+LIS+SHIRFMQ LK +GISRDDLPFKAKFMP+
Sbjct: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464

Query: 456 GAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTE 515
           GAYYAA            TAF P F   DF   YIS  +F V W+ FQ  F+G  F   +
Sbjct: 465 GAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVD 523

Query: 516 DIDLDTDRREIDDVVWEEQKPRNLWEKFW 544
           +ID+DTDRR+ID ++W++ KP  LW K W
Sbjct: 524 EIDIDTDRRDIDAIIWDDDKPTTLWGKIW 552

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  362 bits (928), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 197/525 (37%), Positives = 292/525 (55%), Gaps = 13/525 (2%)

Query: 26  EDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYM 85
           ED  +  S G     ++K+ LK RHISMIA+GG++GTGL I   T L   GP   LIAY 
Sbjct: 34  EDDSNKISDGKEDGVRLKKELKARHISMIAIGGSLGTGLLIGTGTALRTGGPASILIAYS 93

Query: 86  FIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSV 145
           F+G L + V   LGEMAT+IP+   FT +  R+  PALG A GY Y   + I    +L+ 
Sbjct: 94  FVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTA 152

Query: 146 VGQIIQFWTD--AVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYA 203
              +IQ+W D   V    WI IF V++ I N   V+Y+GE EFW++  K++ + G I++ 
Sbjct: 153 GALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFL 212

Query: 204 FIMVCGAG-KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVG 262
           FI++ G G     +GFRYW+NPG + P   S   ++G+F+ +V+  + A F Y G EL G
Sbjct: 213 FIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTG 272

Query: 263 ITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL---KSEDSYISSSP 319
           I A EA NPR+ +PRAI                        NDP+L       +  ++SP
Sbjct: 273 IVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLAAAHASTSAAASP 332

Query: 320 FVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSG 379
           FV+AI+NSG + LPHIFN  +L  + SA NS++YVG+R  YS+A++G APK    T + G
Sbjct: 333 FVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWG 392

Query: 380 IPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQ 439
           +PY A+    +   LAY+  SSG++ +FN+ +N+ ++ G  +WI I I++I F +A   Q
Sbjct: 393 VPYNALFGCFLFCLLAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQ 452

Query: 440 GISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFW 499
            + R+   ++A F P+GAY               T F  +F    F T YI + L+ +F+
Sbjct: 453 NVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFY 512

Query: 500 IGFQIWFRGPLFIKTEDIDLDT-----DRREIDDVVWEEQKPRNL 539
            G++I ++  L +K E+ DL +     DR E +  + E +    L
Sbjct: 513 FGYKIIYKTKL-VKAEEADLYSFKEAIDREEAEGKIKEAEAKERL 556

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  354 bits (908), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 196/513 (38%), Positives = 299/513 (58%), Gaps = 14/513 (2%)

Query: 42  VKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEM 101
           +K+ L+ RH+SMIA+GG++GTGL I   T LS AGP    IAY F+G L +    ++GEM
Sbjct: 99  LKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMAAIGEM 158

Query: 102 ATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFW--TDAVPL 159
           A++IP+   FT +  R++ PALG A GY Y   + I    +L+    +IQ+W   D V  
Sbjct: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217

Query: 160 TAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KTGPVGF 218
             WI IF V++ I N+  VK++GE EFW++  KVL ++G I+  FI++ G G     +GF
Sbjct: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDHDRLGF 277

Query: 219 RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRA 278
           RYW++PG + P   + D + G+F+ +VS  + A F Y G EL GI A EA NPRK+VPRA
Sbjct: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337

Query: 279 INKVXXXXXXXXXXXXXXXXXXXXXNDPKL---KSEDSYISSSPFVIAIENSGTKVLPHI 335
           +                        NDP+L   K   +  ++SPFV+AI+NSG +VLPHI
Sbjct: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIRVLPHI 397

Query: 336 FNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLA 395
           FNA +L  + SA NS++YVGSR  YS+A++G AP     TT  G+P+ ++    +   LA
Sbjct: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457

Query: 396 YLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPW 455
           Y+  SSG++ VFN+ +N+ ++ G  +WI I I++I FM+A+K QG+ R    + A F P+
Sbjct: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517

Query: 456 GAYYAAXXXXXXXXXXXXTAF-APKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKT 514
           G Y++             T F    F   +F T YI + +F +F+ G++ + +    +K+
Sbjct: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYK-FIKKTKIVKS 576

Query: 515 EDIDLDT-----DRREIDDVVWEEQKPRNLWEK 542
            ++DL T     D++EI+  + +++K   L E 
Sbjct: 577 HEVDLFTGKEVFDQQEIEGKILDQEKQIRLREN 609

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  352 bits (903), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 195/532 (36%), Positives = 300/532 (56%), Gaps = 14/532 (2%)

Query: 13  KDGSHLIIKPSIAEDAVSMESL---GSVKETQVKRALKPRHISMIALGGTIGTGLFISIS 69
            D  +L    S  ED+   +     G  + T++++ LK RHISMIA+GG+IGTGL I   
Sbjct: 54  NDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGTG 113

Query: 70  TPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGY 129
             L  AGP+   IAY F+G L +    +LGEMA++IP+   FT +  R+  PALG A GY
Sbjct: 114 NSLYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGY 172

Query: 130 LYWLSWAITFALELSVVGQIIQFWTDAVPLT--AWIAIFWVILTISNLFPVKYYGEVEFW 187
            Y   + I    +L+    +IQ+W D   +    WI IF VI+   N   VK++GE EFW
Sbjct: 173 AYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFW 232

Query: 188 IACIKVLAIVGFIIYAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVS 246
           ++  KV+ ++G II  F+++ G G T   +GFR++ +PG + P   S D ++G+F+ +V+
Sbjct: 233 LSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVA 292

Query: 247 SLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDP 306
            L+ A F Y G EL GI A EAANPRK++P+AI                        +DP
Sbjct: 293 VLVYALFAYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDP 352

Query: 307 ---KLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMA 363
              K K+  +  ++SP+V+AI NSG K LPHIFNA +L  + SA NS++YV SR  Y +A
Sbjct: 353 LLKKAKTSGTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLA 412

Query: 364 MNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWI 423
           ++  APK    T + G+PY ++L +S    LAY+  SSG++ +FN+ +N+ ++ G  +WI
Sbjct: 413 IDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWI 472

Query: 424 LISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFKV 482
            I I+++ F +A+K Q + R    ++A F P+G+Y+              T F    F  
Sbjct: 473 SILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDY 532

Query: 483 SDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQ 534
            +F T YI + +F + + G++   +  ++ K E++DL T +  ID+   EEQ
Sbjct: 533 KNFITGYIGIPVFVISYFGYKFVKKTKIW-KPEEVDLYTFKAAIDE--EEEQ 581

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  350 bits (899), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 208/557 (37%), Positives = 309/557 (55%), Gaps = 25/557 (4%)

Query: 2   SLSKDYEA------TREKDGSHLIIKPSIAEDAVSMESL----GSVKETQVKRALKPRHI 51
           S  KD E       T  KD  +L +  S  +D  S ES     G     ++K+ L+ RH+
Sbjct: 7   SYRKDLEKIVSNSNTTSKDVENLDL--SNQDDISSQESHLNIDGKHDGIRLKKELEARHV 64

Query: 52  SMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSF 111
           SMIA+GG++GTGL I   T LS AGPV  LIAY F+G L Y V   LGEMAT+IP+   F
Sbjct: 65  SMIAIGGSLGTGLLIGTGTSLSLAGPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-DGF 123

Query: 112 TVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT--DAVPLTAWIAIFWVI 169
           T +  R+  PALG A GY Y   + I    +L+    ++Q+W   + V    WI IF VI
Sbjct: 124 TSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVI 183

Query: 170 LTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGP-VGFRYWRNPGPWG 228
           +   N+  VK++GE EFW++  KVL ++  I+  F+++ G G +   +GFR++++PG + 
Sbjct: 184 IVTINVVGVKFFGEFEFWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFR 243

Query: 229 PGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXX 288
           P   +   ++G+F+ +V+  + A F Y GTEL GI A E  NPR+ VPRAI         
Sbjct: 244 PYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVV 303

Query: 289 XXXXXXXXXXXXXXXNDPKL---KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTII 345
                          NDP L   K + +  ++SPFV+AI+N+G  VLPHIFNA +L  + 
Sbjct: 304 FYLVTIFLLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKNAGIPVLPHIFNACVLMFVF 363

Query: 346 SAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASA 405
           SA NS++YV SR  Y +A++  APK    T K G+PY +++   +   LAY+  SSG++ 
Sbjct: 364 SACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQ 423

Query: 406 VFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXX 465
           VFN+ +N+ ++ G  +WI I I++I F +AL+ QG+ +  L + A     GAY+A     
Sbjct: 424 VFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCC 483

Query: 466 XXXXXXXXTAF-APKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRR 524
                   T F   KF   +F T YI + +F + + G++ + RG  F+K E+ DL T + 
Sbjct: 484 LIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYK-YIRGTKFVKPEEADLYTFKE 542

Query: 525 EIDDVVWEEQKPRNLWE 541
            ID     E++   LW+
Sbjct: 543 LID----LEEEEGKLWD 555

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  350 bits (897), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 204/575 (35%), Positives = 314/575 (54%), Gaps = 33/575 (5%)

Query: 2   SLSKDYEATR-EKDGSHLIIKPSIAEDAVSMESL-------------GSVKETQVKRALK 47
           S +  +E T  +K    + I   + ++++S+ S              G  +  ++K+ LK
Sbjct: 10  SNNSKFEMTDLQKQSDQVTISSDLEQNSISIASSRNSSIGDRDIFDDGKTEGFRLKKNLK 69

Query: 48  PRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPV 107
            RH+SMIA+GG++GTGL I   T L+ AGP    I Y F+G L +     LGEMA FIP+
Sbjct: 70  ARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFFTMSCLGEMAAFIPL 129

Query: 108 TSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLT--AWIAI 165
              FT +  R++ PALG A GY Y   + I  A +L+    ++Q+W D   L    +I I
Sbjct: 130 -DGFTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQYWVDRDTLNPGVFITI 188

Query: 166 FWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KTGPVGFRYWRNP 224
           F +++   N+F VK +GE EFW++  KVL ++G I+  FI++ G G     +GFRYWR+P
Sbjct: 189 FLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGGGPNHDRLGFRYWRDP 248

Query: 225 G---PWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINK 281
           G   P+   IIS   + G+F+ + S  + A F Y G EL GI A EA NPRK +P+AI  
Sbjct: 249 GSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAAEAQNPRKNIPKAIKL 308

Query: 282 VXXXXXXXXXXXXXXXXXXXXXNDP---KLKSEDSYISSSPFVIAIENSGTKVLPHIFNA 338
                                 NDP   K   + +  ++SPFV+AIENSG  +LPHIFN 
Sbjct: 309 TMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVAIENSGINILPHIFNV 368

Query: 339 VILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLE 398
            +L+ ++SA NS++YV SR  YS+A++  APK+   T K GIPY ++  ++    LAY+ 
Sbjct: 369 CVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYWSLAFSTAFSCLAYMN 428

Query: 399 SSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAY 458
            SS AS VFN+ +N  ++ G  +WI I +++I F +A K QG+ + +  + A + P+GAY
Sbjct: 429 VSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKSNFTYVAPWQPYGAY 488

Query: 459 YAAXXXXXXXXXXXXTAF-APKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDI 517
           +A             T F   +F   +F T YI + +FF+ ++G++I ++     + E++
Sbjct: 489 FALFFCCVLALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGYKIVYKTKTH-RPEEV 547

Query: 518 DLDT-----DRREIDDVVWEEQKPRNL--WEKFWA 545
           DL T     D+ E D  + + ++   L    K WA
Sbjct: 548 DLVTLKALIDQEEEDGKIEDAEREERLKNGNKDWA 582

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  342 bits (878), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 188/520 (36%), Positives = 292/520 (56%), Gaps = 17/520 (3%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           G    T++K+ LK RHISMIA+GG++GTGL I   T L  AGP   LIAY F+GTL +  
Sbjct: 75  GKDDGTRLKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFFT 134

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
             +LGEMA +IP+   FT +  R+  PALG A GY Y   + I    +L+    +IQ+W 
Sbjct: 135 MAALGEMAAYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYWV 193

Query: 155 D--AVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG- 211
           D   V    WI IF V++   N   VKY+GE EFW++  K++ ++G +I+ F+++ G G 
Sbjct: 194 DRDTVNPGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGGP 253

Query: 212 KTGPVGFRYWRNPG---PWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEA 268
               +GFRYW+ PG   P+   +++ + + G+F+ +V+  + A F Y G EL GI A EA
Sbjct: 254 NHDRLGFRYWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAEA 313

Query: 269 ANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL---KSEDSYISSSPFVIAIE 325
            NPR+ +PRAI                        +DP L    +  +  ++SPFV+AI+
Sbjct: 314 ENPRRNIPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAIQ 373

Query: 326 NSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAV 385
           NSG  VLPHIFN  +L  + SA NS++YVG+R  YS+A++G APK    T + G+PY A+
Sbjct: 374 NSGVDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNAM 433

Query: 386 LTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDD 445
               +   LAY+  SSG++ +FN+ +N+ ++ G  +W  I I+ I F +A++ QGI R  
Sbjct: 434 GGCVLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRST 493

Query: 446 LPFKAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFKVSDFFTAYISVMLFFVFWIGFQI 504
             + A F P+G+Y+A             + F   +F    F T YI + ++   +IG+++
Sbjct: 494 FAYVAPFQPYGSYFALFFCVLLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIGYKL 553

Query: 505 WFRGPLFIKTEDIDLDT-----DRREIDDVVWEEQKPRNL 539
           +++    +K  + DL++     DR E +  + E ++   L
Sbjct: 554 YYKTKT-VKPHEADLNSYKAAVDREEEEGKIKEAERKERL 592

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  340 bits (873), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 193/520 (37%), Positives = 289/520 (55%), Gaps = 21/520 (4%)

Query: 42  VKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEM 101
           +K+ L+ RHI +IALGG IGTGLF+  S+ LS  GP G L +Y+ I  + Y V  +LGEM
Sbjct: 49  LKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNALGEM 108

Query: 102 ATFIPVTS-----SFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDA 156
             ++P +      S +    R+  P+LG A G+ Y+  + I  A E +    ++ +WT  
Sbjct: 109 VCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTV 168

Query: 157 VPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGP- 215
           VP  AWI IF  ++T+ N  PVK+YGE EFW A +K+L IVG +  +FI+  G G +   
Sbjct: 169 VPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFILFWGGGPSHDR 228

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVGITAGEAANPRKT 274
           +GFRYW+ PG +   I +   N GRFL   + +I   F +  G ELV +T+ EA + R+ 
Sbjct: 229 LGFRYWQKPGAFAYHITTG--NTGRFLDVWTGVIKGGFAFILGPELVAVTSSEAMDQRRN 286

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK----SEDSYISSSPFVIAIENSGTK 330
           + +A  +                      NDP L+    S  +  +SSPFVIAI+N+  K
Sbjct: 287 IEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPFVIAIQNAHIK 346

Query: 331 VLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSV 390
           +LPHI NA ILS+  S+GNS ++  SR   SMA +G+APK      ++G+PY AV  ++ 
Sbjct: 347 ILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVPYNAVAVSAA 406

Query: 391 LGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKA 450
              LAYL  SSG++  F W  NI+ ++GF  WI I ++++RF +A+  +G+  D +PFK+
Sbjct: 407 FSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRGL-YDRVPFKS 465

Query: 451 KFMPWGAYYAAXXXXXXXXXXXXTAFAPKF-KVSDFFTAYISVMLFFVFWIGFQIWFR-- 507
            F P+G Y+                F P+F K +DF  AYI++ +F V W+G +I+ R  
Sbjct: 466 PFQPYGTYFFIIVVSIICLTNGYATFIPRFWKGADFVAAYITLPVFVVLWVGHKIYTRTL 525

Query: 508 GPLFIKTEDIDLDTDRREIDDVVWE----EQKPRNLWEKF 543
               I   ++D+ T   EI+++  E       P + WEKF
Sbjct: 526 STWVIPVAEVDVTTGLAEIEELTKELDALRVPPNSAWEKF 565

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  339 bits (870), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 197/537 (36%), Positives = 302/537 (56%), Gaps = 20/537 (3%)

Query: 9   ATREKDGSHLIIKPSIAEDAVSMESLGSVKET-----------QVKRALKPRHISMIALG 57
           +  +K+   L    ++ E  V++ES G V+             ++K+ L+ RH+SMIA+G
Sbjct: 6   SMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMIAIG 65

Query: 58  GTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQR 117
           G++GTGL I   + L++AGPV  LI+Y F+G L Y+V   LGEMA FIP+   FT +  R
Sbjct: 66  GSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASR 124

Query: 118 FLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT--DAVPLTAWIAIFWVILTISNL 175
           ++ PA+G A GY Y   + I    +L+    ++QFW   D V    WI IF  ++ + N 
Sbjct: 125 YVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINT 184

Query: 176 FPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KTGPVGFRYWRNPGPWGPGIISK 234
             V+++GE EFW++ +KVL ++G I+  FI++ G G      GFR+WR+PG + P   + 
Sbjct: 185 VGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRFWRDPGAFKPYSEAI 244

Query: 235 DVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXX 294
             ++G+F+ + S    A F Y GTEL GI A EA NPR++VPRAI               
Sbjct: 245 SGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITI 304

Query: 295 XXXXXXXXXNDPKL---KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSN 351
                    NDP+L   K   +  ++SPFV+AIEN+   VLPHIFN  +L  + SA NS+
Sbjct: 305 LLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENASIPVLPHIFNVCVLVFVFSACNSD 364

Query: 352 VYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLL 411
           +YV SR  Y +A++G AP+    T K G+PY ++  + +   LAY+  SSG++ VFN+ +
Sbjct: 365 LYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFV 424

Query: 412 NITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXX 471
           N+ ++ G  +WI I I++IRF +A++ Q   +  L + A F PW  Y A           
Sbjct: 425 NVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIK 484

Query: 472 XXTAF-APKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREID 527
             T F   KF    F + YI + ++ + ++G+++ +R  L IK ED+DL T +  ID
Sbjct: 485 NYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKL-IKPEDVDLYTFKDAID 540

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  339 bits (870), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/535 (37%), Positives = 300/535 (56%), Gaps = 24/535 (4%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           G  + T++K+ LK RHISMIA+GG++GTGL I   T L   GPV  LIAY F+G L +  
Sbjct: 73  GKDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFFT 132

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFW- 153
              LGEMA++IP+   FT +  R++ PALG A GY Y   + I    +L+    +IQ+W 
Sbjct: 133 MACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191

Query: 154 -TDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG- 211
             D V    WI IF V++   N+  VK++GE EFW++  KV+ ++G I+  FI++ G G 
Sbjct: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 251

Query: 212 KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271
               +GFRYWR+PG +     +   + G+F  +V+  + + F+Y G EL GI   EA NP
Sbjct: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311

Query: 272 RKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL---KSEDSYISSSPFVIAIENSG 328
           RK+VP+AI                        NDP+L   K +    ++SPFV+AI+NSG
Sbjct: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371

Query: 329 TKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTT 388
            KVLPHIFNA +L  + SA NS++YV SR  Y++A++G APK    T+K G+PY A++ +
Sbjct: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431

Query: 389 SVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPF 448
            +   LAY+  SSG++ +FN+ +N+ ++ G  +WI I I +I F +A + QGI +    +
Sbjct: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFKVSDFFTAYISVMLFFVFWIGFQIWFR 507
            A    +GAY+A             T F   KF    F T YI + ++ + W G+++ ++
Sbjct: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYK 551

Query: 508 GPLFIKTEDIDLDT-----DRRE----IDDVVWEEQKPRN------LWEKFWAAI 547
             + IK+ D+DL T     DR E    I D   EE+  RN       +EKF   I
Sbjct: 552 TKV-IKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFLGRI 605

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  338 bits (867), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 206/564 (36%), Positives = 312/564 (55%), Gaps = 25/564 (4%)

Query: 6   DYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLF 65
           D E       S     PS  +D+ ++   G  + T++++ LK RHISMIA+GG++GTGL 
Sbjct: 46  DLEENNVSSRSSTFTSPSARDDSFAVPD-GKDETTRLRKDLKARHISMIAIGGSLGTGLL 104

Query: 66  ISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGS 125
           I   T L   GPV  LIAY F+G L +     LGEMA++IP+   FT +  R++ PALG 
Sbjct: 105 IGTGTALMTGGPVAMLIAYAFVGLLVFFTMACLGEMASYIPL-DGFTSYASRYVDPALGF 163

Query: 126 ANGYLYWLSWAITFALELSVVGQIIQFWT--DAVPLTAWIAIFWVILTISNLFPVKYYGE 183
           A GY Y   + I    +L+    +IQ+W   D V    WI IF V++   N+  VK++GE
Sbjct: 164 AIGYTYLFKYFILPPNQLTAAALVIQYWVSRDRVNPGVWITIFMVVIVAINVIGVKFFGE 223

Query: 184 VEFWIACIKVLAIVGFIIYAFIMVCGAG-KTGPVGFRYWRNPGPWGPGIISKDVNEGRFL 242
            EFW++  KVL ++G I+  FI++ G G     +GFRYWR+PG +     +    +G+F+
Sbjct: 224 FEFWLSSFKVLVMLGLILLLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSAAIGGGKGKFV 283

Query: 243 GWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXX 302
            +++  + + F+Y G EL GI   EA NPRK+VP+AI                       
Sbjct: 284 SFLAVFVYSLFSYTGIELTGIVCSEAQNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVA 343

Query: 303 XNDPKL---KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIA 359
            NDP+L   K +    ++SPFV+AI+NSG KVLPHIFNA +L  + SA NS++YV SR  
Sbjct: 344 YNDPRLISTKGKALSAAASPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNL 403

Query: 360 YSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGF 419
           Y++A++G APK  + T K G+PY A++ + +   LAY+  S+G++ +FN+ +N+ ++ G 
Sbjct: 404 YALAIDGKAPKIFSKTNKWGVPYNALIFSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGI 463

Query: 420 FTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAF-AP 478
            +WI I I +I F +A + QGI +    + A    +GAY+A             T F   
Sbjct: 464 LSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALVFCIFIALIKNFTVFLGH 523

Query: 479 KFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDT-----DRRE----IDDV 529
           KF    F T YI + ++   W+G+++ ++  + IK+ D+DL T     DR E    I+D 
Sbjct: 524 KFDYKTFITGYIGLPVYVFSWVGYKLIYKTKV-IKSTDVDLYTFKEIYDREEEQGKIEDQ 582

Query: 530 VWEEQKPRN------LWEKFWAAI 547
             EE+  +N       +EKF   I
Sbjct: 583 EKEERLKKNGKNMEWFYEKFLGHI 606

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  336 bits (861), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 195/522 (37%), Positives = 294/522 (56%), Gaps = 12/522 (2%)

Query: 23  SIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALI 82
           S+A D  + +  G   + ++K+ LK RH+SMIA+GG++GTGL I     L+ AGPV  LI
Sbjct: 43  SVALDDTNEQFDGKCSDQRLKKDLKARHVSMIAIGGSLGTGLLIGTGNSLAVAGPVSMLI 102

Query: 83  AYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALE 142
           +Y F+G L + V   +GEMA +IP+   FT +  R+  PALG A GY Y + + I    +
Sbjct: 103 SYSFVGVLVFFVMSCIGEMAAYIPL-DGFTSYASRYCDPALGFAVGYAYLVKYFILPPNQ 161

Query: 143 LSVVGQIIQFW--TDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFI 200
           L+    +IQ+W   + V    WI I  V++ + N F VK++GE EFW++  KV+ ++G I
Sbjct: 162 LTAAALVIQYWIPREKVNPGVWITIVLVVIVVINTFGVKFFGEFEFWLSSFKVIVMLGLI 221

Query: 201 IYAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTE 259
           I  FI++ G   T   +GFRYW++PG +     S   + GRF+ +VS  +   F Y G E
Sbjct: 222 ILMFIIMLGGTPTHDRLGFRYWKHPGAFKEYSKSIHGDIGRFVSFVSCFVYGLFCYLGIE 281

Query: 260 LVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL---KSEDSYIS 316
           L GI A EA NPRK +P+AI                        NDP L   K++ +  +
Sbjct: 282 LTGIVAAEAENPRKNIPKAIKLTMWRIIIFYIITIFLLGMCVSSNDPLLLEAKTKSTSAA 341

Query: 317 SSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTT 376
           +SPFV+AI NSG + LPHIFNA +L  + SA NS++YV SR  YS+A++  APK    T 
Sbjct: 342 ASPFVVAIVNSGIEALPHIFNACVLMFVFSACNSDLYVASRNLYSLAIDNKAPKIFAKTN 401

Query: 377 KSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQAL 436
           + GIPY ++    +   LAY+  SSG++ +FN+ +N+ ++ G  TWI I I++I F +A+
Sbjct: 402 RFGIPYNSLGVAVLFCLLAYMSVSSGSAKIFNYFVNVVSITGVLTWISILITYICFDRAV 461

Query: 437 KHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFKVSDFFTAYISVMLF 495
           + QGI +    + A   P+GAY++             T F   KF   +F T YI + LF
Sbjct: 462 RAQGIDKSTFAYVAPLQPYGAYFSLFFCCLLALIKNFTVFLNHKFDYRNFITGYIGLPLF 521

Query: 496 FVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPR 537
           F+ + G++ + +     K E++DL + +  ID    EE+  R
Sbjct: 522 FICYFGYK-FVKKTKIRKPEEVDLFSFKAAIDQ---EEEDGR 559

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  336 bits (861), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 194/539 (35%), Positives = 295/539 (54%), Gaps = 25/539 (4%)

Query: 27  DAVSMESL-GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYM 85
           D+ S++ L G  KE  +K+++KPRH+ MI+LG  IGTGL +  +  L++AGP G  I Y 
Sbjct: 109 DSGSVDELEGKTKEEHLKKSIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYA 168

Query: 86  FIGTLAYSVTQSLGEMA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELS 144
            +G+  Y + Q+ GEMA T+  +   F  +    +SP LG A  ++YWL WA    LEL 
Sbjct: 169 IMGSCIYCIIQAAGEMAVTYSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELV 228

Query: 145 VVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAF 204
                I++WT  V    ++ IF+ ++ + N+F  + Y E EF+  C KVL I GF I   
Sbjct: 229 TASMTIKYWTTKVNPDVFVVIFYFLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGI 288

Query: 205 IMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGI 263
           I+ CG AG  G +G +YW +PG +       D    RF G  ++L++AAF + G+E + +
Sbjct: 289 IINCGGAGNDGYIGGKYWHDPGAF-----RGDKAIDRFKGVAATLVTAAFAFGGSEFIAL 343

Query: 264 TAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVI 322
           TA E +NPRK +P A  K+                     N D  + S+ S   +SP+VI
Sbjct: 344 TASEQSNPRKAIPAAAKKILYRIIIIFLGSIIMVGFLVPWNSDQLMGSDSSKTKASPYVI 403

Query: 323 AIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPY 382
           AI + G +V+PH  NAVIL +++S GNS  Y  SRI  S++  G APK+  +  + G P 
Sbjct: 404 AISSHGVRVVPHFVNAVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPA 463

Query: 383 AAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGIS 442
            A++  ++   +A+  +SS    VF WLL I+ ++  FTW  I +SHIRF +A+  QG S
Sbjct: 464 RAMVIGALFAVIAFCAASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRS 523

Query: 443 RDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVF 498
             ++ FK++   WG+YYAA               AP    K     FF +Y+++++   F
Sbjct: 524 LGEIGFKSELGVWGSYYAAGMMFLVLIAQFWVGLAPIGMNKLDAQSFFESYLAMLMLIAF 583

Query: 499 WIGFQIWFRG-PLFIKTEDIDLDTDRREID-DVVWEE-----QKPRN--LWEK---FWA 545
           ++G+  W +   LFI+ +DIDLD  R+  D DV+ +E     +K RN  LW++   FW 
Sbjct: 584 YVGYMFWKKDWTLFIRAKDIDLDHHRQIFDEDVLRQEDEETKEKLRNGPLWKRILNFWC 642

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  334 bits (856), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 196/535 (36%), Positives = 301/535 (56%), Gaps = 24/535 (4%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           G  + T++++ LK RHISMIA+GG++GTGL I   T L   GPV  LIAY F+G L +  
Sbjct: 75  GKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFYT 134

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFW- 153
              LGEMA++IP+   FT +  R++ PALG A GY Y   + I    +L+    +IQ+W 
Sbjct: 135 MACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193

Query: 154 -TDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG- 211
             D V    WI IF V++   N+  VK++GE EFW++  KV+ ++G I+  FI++ G G 
Sbjct: 194 SRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 253

Query: 212 KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271
               +GFRYWR+PG +     +    +G+F+ +V+  + + F+Y G EL GI   EA NP
Sbjct: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313

Query: 272 RKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL---KSEDSYISSSPFVIAIENSG 328
           RK+VP+AI                        NDP+L   K +    ++SPFV+AI+NSG
Sbjct: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373

Query: 329 TKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTT 388
            +VLPHIFNA +L  + SA NS++YV SR  Y++A++G APK    T++ G+PY A++ +
Sbjct: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433

Query: 389 SVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPF 448
            +   LAY+  SSG++ +FN+ +N+ ++ G  +WI I I +I F +A + QGI +    +
Sbjct: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFKVSDFFTAYISVMLFFVFWIGFQIWFR 507
            A    +GAY+A             T F   KF    F T YI + ++ + W G+++ ++
Sbjct: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYK 553

Query: 508 GPLFIKTEDIDLDT-----DRREIDDVVWEEQKPRNL----------WEKFWAAI 547
             + IK+ D+DL T     DR E +  + +++K   L          +EKF   I
Sbjct: 554 TKV-IKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFLGNI 607

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  333 bits (854), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 201/566 (35%), Positives = 302/566 (53%), Gaps = 27/566 (4%)

Query: 1   MSLSKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTI 60
           M+L    +    K  S L    +++ D  S  SL       +K+ LK RH+ +IALGG I
Sbjct: 35  MNLDDSLDDRFNKKDSGLNKVLTVSSD-TSTNSLEEDYTNTLKQGLKSRHVQLIALGGCI 93

Query: 61  GTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIP-----VTSSFTVFT 115
           GTGLF+  S+ L   GP G  IAY  I ++ Y +  ++GEM  ++P        S T   
Sbjct: 94  GTGLFVGTSSTLHTCGPAGLFIAYCIISSVIYPIMNAVGEMVCYLPGDGHDSAGSVTHLV 153

Query: 116 QRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNL 175
           +R++  +L  A G+ Y+  + I  A E +    ++++WT AVP  AWI IF  I+ + N+
Sbjct: 154 KRYVDESLAFATGWNYFYCYVILVAAECTAAAGVVEYWTLAVPKAAWITIFLAIIFLLNM 213

Query: 176 FPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISK 234
             VKY+GE EFW A IK+L I+G II +FI+  G G +   +GFRYW+NPG +   +   
Sbjct: 214 SSVKYFGETEFWFASIKILCIMGLIILSFILFWGGGPSHDRLGFRYWKNPGAFAHHV--T 271

Query: 235 DVNEGRFLGWVSSLISAAFTY-QGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXX 293
           D + G FL   S +I  AF +  G ELV +T+ E ++ R+ + +A  +            
Sbjct: 272 DGSLGNFLDIYSGIIKGAFAFILGPELVALTSSECSDQRRNIAKASKRFIYRLMFFYILG 331

Query: 294 XXXXXXXXXXNDPKLKSEDSYIS----SSPFVIAIENSGTKVLPHIFNAVILSTIISAGN 349
                     NDP L S  S  +    SSPFVI I+N+G +VLPHI NA IL++  S+GN
Sbjct: 332 TLAIGVIVAWNDPVLASALSNNTPGAGSSPFVIGIQNAGIEVLPHIINACILTSAWSSGN 391

Query: 350 SNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNW 409
           + ++  SR  ++MA NG APK      K G+PY AV+ ++++  LAYL +SS A+ VF W
Sbjct: 392 AFMFASSRSLFTMAQNGTAPKIFGRINKYGVPYMAVILSTLISCLAYLNASSSAARVFTW 451

Query: 410 LLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXX 469
           L NI+ ++GF  WI   I+++RF +A+ +  +  D +PFK    P+   ++         
Sbjct: 452 LSNISTISGFLGWICACIAYLRFRKAIFYNNL-YDRMPFKTWGQPYLILWSLTVVSIITI 510

Query: 470 XXXXTAFAPKF-KVSDFFTAYISVMLFFVFWIGFQIW--FRG-----PLFIKTEDIDLDT 521
                 F PKF  VSDF  AYI++ +F   ++G +++  F+       L    EDID+ T
Sbjct: 511 TNGYQTFIPKFWNVSDFIAAYITLPIFLALYVGHKVYNHFKNDYPLMKLAYSVEDIDVIT 570

Query: 522 DRREIDDVVWEEQK----PRNLWEKF 543
              EI+    E  +    P N WE+F
Sbjct: 571 GLDEIETKTCELDENRILPTNRWERF 596

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  331 bits (849), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/556 (34%), Positives = 300/556 (53%), Gaps = 18/556 (3%)

Query: 3   LSKDYEATREKDGSHLIIKPSIAEDAVSMESLGS------VKETQVKRALKPRHISMIAL 56
           ++ D +A  EKD S   +K      + ++  L S        E  +++ L  RHI +IAL
Sbjct: 1   MTSDLKANLEKDTSFYDVKSQGETYSGTLNQLESQLEGTKCDENNLEKGLSSRHIQLIAL 60

Query: 57  GGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQ 116
           GG IGTGLF+  S+ L N GP+   ++++ I  + Y V  +L EM  ++P   +    T 
Sbjct: 61  GGCIGTGLFVGTSSTLHNCGPLPLFLSFVIISFIVYPVMNTLAEMICYLPQQGTVPELTS 120

Query: 117 RFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLF 176
           R++ P+LG A G+ Y  S++I  A ELS    ++Q+WTD V +  WI IF VI+   N  
Sbjct: 121 RYVDPSLGFAAGWNYAYSYSILVATELSAAAGVVQYWTDKVHVAVWITIFLVIVVGLNFA 180

Query: 177 PVKYYGEVEFWIACIKVLAIVGFIIYAF-IMVCGAGKTGPVGFRYWRNPGPWGPGIISKD 235
           PVK+YGE EFW A +K++ I+G +I +  I   GA     +GFRYW NPGP+   I    
Sbjct: 181 PVKFYGESEFWFASLKIICILGLLIVSIVIFFGGAPSHDRLGFRYWNNPGPFAYHITGG- 239

Query: 236 VNEGRFLGWVSSLISAAFTY-QGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXX 294
            N GRFL   +++I + F +    EL+G+   EA + R+ + +A  +             
Sbjct: 240 -NTGRFLDIWTAIIKSGFAFILSPELIGLACVEAKDTRRNIEKASRRFIWRIIFFYITST 298

Query: 295 XXXXXXXXXNDPK----LKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNS 350
                    +DPK    L S+    +SSPFV  I N+G  VL HI NAVILS+  S+ NS
Sbjct: 299 LCIGFILSRDDPKLIQALTSDAPGAASSPFVQGISNAGIPVLNHIINAVILSSAWSSANS 358

Query: 351 NVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWL 410
            +Y  SR   ++A  G APK  T   + G+PY AV  ++ +  L YL +SS ++ VF WL
Sbjct: 359 FMYASSRSILALAKQGDAPKVFTRINRLGVPYNAVALSTAVSCLTYLNASSSSAQVFTWL 418

Query: 411 LNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXX 470
            NI  ++GF  W LI I+++RF +A+ +  +  + +PFK+   P+  Y+           
Sbjct: 419 SNICTISGFIGWALIGITYLRFRKAIFYNNL-YERVPFKSALQPYFTYFFVVFVVLLCLT 477

Query: 471 XXXTAFAPKF-KVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDD- 528
                F PK+   SDF  AYI++ +FF+ ++G +IWF+   +I   +ID+ T   + ++ 
Sbjct: 478 NGYATFIPKYWNASDFVAAYITLPIFFLLYLGHKIWFKTRWYIPFREIDVITGLADAEEE 537

Query: 529 -VVWEEQKPRNLWEKF 543
             + + + P+N+WEKF
Sbjct: 538 AKMTQPRTPKNMWEKF 553

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  331 bits (848), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/521 (36%), Positives = 290/521 (55%), Gaps = 12/521 (2%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           G     ++K+AL+ RH+SMIA+GG++GTGL I   + L+ AGP   LIAY F+G L + V
Sbjct: 72  GKHDGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFFV 131

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
              LGEMA +IP+   FT ++ R+  PALG A GY Y   + I    +L+    +IQ+W 
Sbjct: 132 MSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWV 190

Query: 155 D--AVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGK 212
           D   V    WI I  V +   N   V+++GE+E++I+ +K+  ++G II   ++ CG G 
Sbjct: 191 DRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGGP 250

Query: 213 TGPV-GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271
              V GF+YW+NPG +     +    +GRF+ + S  + A F Y GTEL GI   E  NP
Sbjct: 251 NHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNP 310

Query: 272 RKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL---KSEDSYISSSPFVIAIENSG 328
           RK VP+AI                        NDP L   KS  +  S+SPFV+AI N+G
Sbjct: 311 RKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNAG 370

Query: 329 TKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTT 388
             VLPHI NA IL  + SA NS++YV SR  Y +A++  AP+    T K G+PY ++L  
Sbjct: 371 IPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVG 430

Query: 389 SVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPF 448
            +   LAY+  SSG+S VF + +N  ++ G  +WI I I++IRF +A + QGI +  L +
Sbjct: 431 VLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAY 490

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFKVSDFFTAYISVMLFFVFWIGFQIWFR 507
           ++   P+GA+++              AF    F    F T YI +  + + +IG+++W++
Sbjct: 491 QSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFITGYIGIPTYIISYIGYKLWYK 550

Query: 508 GPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548
             + I +E++DL + +  +D    EE++ + L E+  A +A
Sbjct: 551 TKI-IPSEEVDLVSFKEAVD---LEEEEGKMLDEERAAHLA 587

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  330 bits (847), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 192/519 (36%), Positives = 288/519 (55%), Gaps = 21/519 (4%)

Query: 42  VKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEM 101
           +K+ L+ RHI +IALGG IGTGLF+  S+ LS  GP G L +Y+ I  + Y V  SLGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 102 ATFIPVTS-----SFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDA 156
             F+P ++     S +    R+  P+LG A G+ Y+  + I  A E +    ++ +WT A
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTA 224

Query: 157 VPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGP- 215
           VP  AWIAIF  ++T+ N  PVK YGE EFW A +K+L IVG +  +FI+  G G T   
Sbjct: 225 VPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTHDR 284

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVGITAGEAANPRKT 274
           +GFRYW++PG +   I +   N GRFL   + +I   F +  G ELV IT+ EA + R+ 
Sbjct: 285 LGFRYWQHPGAFAYHITTG--NTGRFLDIWTGVIKGGFAFILGPELVAITSSEALDARRN 342

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSE----DSYISSSPFVIAIENSGTK 330
           + +A  +                       DP LK+      +   SSPFVIAI+N+  K
Sbjct: 343 IEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAHIK 402

Query: 331 VLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSV 390
           VLPHI NA ILS+  S+GNS ++  SR   SMA +G AP+ L    + G+PY AV  ++ 
Sbjct: 403 VLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALSAA 462

Query: 391 LGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKA 450
              LA+L  SSG++  F W  NI+ ++GF  WI I +++++F +A+  +G+  + +PFK+
Sbjct: 463 FSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGL-YERVPFKS 521

Query: 451 KFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFR--G 508
              P+G Y+               +F   +  SDF  AYI++ +F V W+G +I+ R   
Sbjct: 522 PLQPYGTYFFIVVVSLICLTNGYASFV-NWNASDFVAAYITLPIFVVLWVGHKIYTRTWS 580

Query: 509 PLFIKTEDIDLDTDRREIDD--VVWEEQK--PRNLWEKF 543
              +   ++D+ T   EI++   + + Q+  P N W+KF
Sbjct: 581 TWLLPVAEVDVTTGLAEIEEETKILDAQRIPPANAWQKF 619

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  328 bits (842), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 186/521 (35%), Positives = 277/521 (53%), Gaps = 13/521 (2%)

Query: 22  PSIAEDAVSMESLG-SVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGA 80
           P +  +    E +  +   + ++  LK RH+ MI++GG IGTGLF+   T L  AGP G 
Sbjct: 63  PELDPNLTEAEKIAIATARSPLQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGI 122

Query: 81  LIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFA 140
           LI ++  G++ Y +  S+ E+A   PV   FT +  RF+  + G AN + Y L W +T  
Sbjct: 123 LIGWIIAGSMIYCMVMSVAELAIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLP 182

Query: 141 LELSVVGQIIQFW-TDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGF 199
           LE+      + +W TD      ++A+FWV++ I N+F V+ YGE EF  +  K+L IVGF
Sbjct: 183 LEIVAASITVNYWHTDKKYRDGFVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGF 242

Query: 200 IIYAFIMVCGAGKTGPVGF-RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGT 258
           II A I++CG G        RYW +PG +     + D +  +F G+ S  ++AAF++ G+
Sbjct: 243 IILAIILICGGGPGTGYIGARYWYHPGAF-----AGDTSGRKFKGFCSVFVTAAFSFAGS 297

Query: 259 ELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISS 317
           ELVG+ A EA+NPRK VP A  +V                      DP+L    S   ++
Sbjct: 298 ELVGLAAAEASNPRKDVPGAAKQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAA 357

Query: 318 SPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTK 377
           SPFVIAI+N G   LP + N VIL  ++S GNS VY  SR   ++A  G  PK  ++  +
Sbjct: 358 SPFVIAIKNQGISGLPTLVNVVILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDR 417

Query: 378 SGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALK 437
            G P   +  TS  G +A++  S     VF+WL+ ++ ++  FTW  I + HIRF +AL 
Sbjct: 418 MGRPMVGIAVTSAFGLIAFVAQSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALA 477

Query: 438 HQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP---KFKVSDFFTAYISVML 494
            QG S ++L F +    WGA +               A  P       +DFF  Y+S+ +
Sbjct: 478 AQGRSTNELAFASPAGVWGAAWGLFLCIIMLAAQFYVALFPLGAPPSANDFFQGYLSLPI 537

Query: 495 FFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQ 534
               W+G +IW +   LFIK ED+D+DT RRE+D  +  +Q
Sbjct: 538 VLAMWLGHKIWKKNWKLFIKAEDMDIDTGRRELDLDLLRQQ 578

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  328 bits (842), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 177/509 (34%), Positives = 282/509 (55%), Gaps = 14/509 (2%)

Query: 36  SVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVT 95
           +  ++++ + L  RH+  +A+GG IGTGLF++    L+  GP   ++A++ + T  +++ 
Sbjct: 82  TANDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAWVIVSTCLFTIV 141

Query: 96  QSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTD 155
            +LGE+A   PV   F V+  RF+ P+ G A    Y   WA+   LEL      I++W +
Sbjct: 142 NALGELAAVFPVVGGFNVYITRFVEPSFGFAVNINYLAQWAVLLPLELVAASITIRYWNN 201

Query: 156 AVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGP 215
            +   AW+AIF+  + ++N+  VK +GE EF ++ IK+LAI+GF I   ++ CG G +G 
Sbjct: 202 TINSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPSGE 261

Query: 216 -VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
            +G RYW +PG +       D    RF G  +  ++AAF+Y GTELV ++A E+ NPR T
Sbjct: 262 YIGGRYWNDPGAF-----VGDTPGRRFKGVCAVFVTAAFSYSGTELVAVSAAESHNPRVT 316

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSPFVIAIENSGTKVL 332
           +P+A  +                      ND +L + +S +  ++SP VIAIEN G K L
Sbjct: 317 LPKASKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSVDAAASPLVIAIENGGIKGL 376

Query: 333 PHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLG 392
           P + NA+IL  I+S  NS VY  SR   +MA  G  PK L +  K G P  A+  T + G
Sbjct: 377 PSLMNAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNYIDKRGRPLYAIFATLIFG 436

Query: 393 FLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKF 452
            L+++ +S     VF WL  ++ ++  F W  I++SHIRF QA+K Q  S ++LPF +  
Sbjct: 437 LLSFIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQAMKAQDRSLNELPFVSIT 496

Query: 453 MPWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG 508
             +G++Y              T+  P          FF  Y+S+ +F V ++G +++ + 
Sbjct: 497 GVYGSWYGCIVIFLVLIASFWTSLFPVGSDGADAESFFEGYLSLPIFIVCYLGHKVYKKD 556

Query: 509 -PLFIKTEDIDLDTDRREID-DVVWEEQK 535
             L++KT+D+DLDT RREID D++ +E +
Sbjct: 557 WRLYVKTKDMDLDTGRREIDLDILKQEIR 585

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  328 bits (840), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 195/535 (36%), Positives = 297/535 (55%), Gaps = 24/535 (4%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           G  + T++++ LK RHISMIA+GG++GTGL I   T L   GPV  LIAY F+G L +  
Sbjct: 73  GKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFFT 132

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
              LGEMA++IP+   FT +  R++ PALG A GY Y   + I    +L+    +IQ+W 
Sbjct: 133 MACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWV 191

Query: 155 --DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG- 211
             D V    WI IF V++   N+  V+++GE EFW++  KV+ ++G I+  FI++ G G 
Sbjct: 192 SRDRVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 251

Query: 212 KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271
               +GFRYWR+PG +     +   ++G+F+ + S  + + F+Y G EL GI   EA NP
Sbjct: 252 DHDRLGFRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGIVCSEAKNP 311

Query: 272 RKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL---KSEDSYISSSPFVIAIENSG 328
           RK+VP+AI                        NDP+L   K +    ++SPFV+AI+NSG
Sbjct: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQNSG 371

Query: 329 TKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTT 388
            KVLPHIFN  +L  + SA NS++YV SR  Y++A++G APK    T+K G+PY A++ +
Sbjct: 372 IKVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYALMVS 431

Query: 389 SVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPF 448
            +   LAY+  S+G++ +FN+ +N+ ++ G  +WI I I +I F +A + QG+ +    +
Sbjct: 432 VLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDKSKFAY 491

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFKVSDFFTAYISVMLFFVFWIGFQIWFR 507
            A    +GAY+A             T F    F    F T YI + ++   W+G+++ ++
Sbjct: 492 VAPGQRYGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLPIYVFSWVGYKLIYK 551

Query: 508 GPLFIKTEDIDLDT-----DRRE----IDDVVWEEQKPRN------LWEKFWAAI 547
             + +K  D DL T     DR E    + D   EE+  RN       +EKF   I
Sbjct: 552 TKV-VKPADADLYTLKEIYDREEEQGKLQDQEKEERLQRNGKNLEWFYEKFLGNI 605

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  327 bits (839), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 183/523 (34%), Positives = 279/523 (53%), Gaps = 17/523 (3%)

Query: 13  KDGSHLIIKPSIAE-DAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTP 71
           K    + + P++ E + +++++     ++ +K  LK RH+ MIA+GG IGTGLF+   T 
Sbjct: 53  KRAEEMELDPNLTEAERIAIKT----AQSPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTA 108

Query: 72  LSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLY 131
           L  AGP G LI +   GT+ YS+  ++GE+A   PV   FT +  RF+  + G A  ++Y
Sbjct: 109 LRTAGPAGILIGWGLTGTMIYSMVMAVGELAVVFPVAGGFTTYATRFVDESFGFAANFIY 168

Query: 132 WLSWAITFALELSVVGQIIQFW-TDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIAC 190
            L W +   LE+      + +W TD      ++A+F+V++ I N+F VK YGE EF  + 
Sbjct: 169 MLQWLVVLPLEIVAASITVNYWGTDPKYRDGFVALFYVVIVIINMFGVKGYGEAEFIFSF 228

Query: 191 IKVLAIVGFIIYAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLI 249
           IKV+ ++GFII A +++CG GK    +G +YW NPG +       D    +F G+ +  +
Sbjct: 229 IKVITVIGFIIMAIVLICGGGKDHKYIGAQYWYNPGAF-----VGDTAGQQFQGFCTVFV 283

Query: 250 SAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK 309
           +AAF++ G+ELVG+   EA  PRK+VP A  +V                     + P+L 
Sbjct: 284 TAAFSFAGSELVGLAGSEAEEPRKSVPGAAKQVFWRITLFYILCLLLIGMLVPSDSPRLI 343

Query: 310 SEDSY-ISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLA 368
              S   ++SPFVIAI N G K LP + N VIL  ++S GNS +Y  SR   ++A  G  
Sbjct: 344 GASSVDAAASPFVIAIVNHGIKGLPSVVNVVILIAVLSVGNSAIYSCSRTLAALADQGFL 403

Query: 369 PKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISIS 428
           P    +  + G P   +  ++  G +A++  S     VFNWL+ ++ ++  FTW  I + 
Sbjct: 404 PSICGYIDRGGRPLVGIAISAFFGLIAFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLC 463

Query: 429 HIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP---KFKVSDF 485
           HIR+  AL  QG S D+LPF+A    WG+Y+                  P   K    DF
Sbjct: 464 HIRYRGALAAQGRSTDELPFQAPAGVWGSYWGFFMCILMFIAQFYVGLFPPGTKPNAYDF 523

Query: 486 FTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREID 527
           F AY+S  +F   +   +IW R   LFI  +D+D+DT RRE+D
Sbjct: 524 FLAYLSFCIFIALYAFHKIWKRNWKLFIPLKDLDIDTGRREVD 566

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  325 bits (833), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 194/529 (36%), Positives = 289/529 (54%), Gaps = 25/529 (4%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSL 98
           E ++++ L  RHI +IALGG IGTGLF+  S+ L   GP G  I+Y+ I T+ Y +  + 
Sbjct: 53  EGKLQQGLSARHIQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYVIISTVLYPIMNAF 112

Query: 99  GEMATFIP-----VTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFW 153
           GEM  ++P        S +    R++ P+L  A G+ Y+  + I  A E +    ++++W
Sbjct: 113 GEMVCYLPGNGDDSAGSVSHLVDRYVDPSLSFATGWNYFYCYVILVAAECTAASGVVKYW 172

Query: 154 TDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-K 212
           TDAVP  AWI IF  I+ + NL  VKYYGE EFW A IKVL IVG II +FI+  G G  
Sbjct: 173 TDAVPTAAWITIFLSIVVLLNLCAVKYYGETEFWFASIKVLCIVGLIILSFILFWGGGPN 232

Query: 213 TGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVGITAGEAANP 271
              +GFRYW+NPG +   I     N G FL   S +I  AF +  G EL+ + + E  + 
Sbjct: 233 HDRLGFRYWKNPGGFAHHITGG--NLGNFLDVYSGIIKGAFAFILGPELIALASSECKDQ 290

Query: 272 RKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY----ISSSPFVIAIENS 327
           R+ + +A  +                      NDP L S  +       SSPFVI I+N+
Sbjct: 291 RRNIMKASKRFVWRLMFFYILGALSISVIVASNDPALTSALASGKPGAGSSPFVIGIQNA 350

Query: 328 GTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLT 387
           G K+LPHI NA IL++  SAGN+ ++  SR   +MA NG APK      + G+P+ AV  
Sbjct: 351 GIKILPHIINACILTSAWSAGNAFMFASSRSLLTMASNGQAPKIFGKINRFGVPWVAVTF 410

Query: 388 TSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLP 447
           ++++  LAYL  SS  + VF W  NI+ ++GF  W    ++++RF +A+K+ G+  + LP
Sbjct: 411 SALISCLAYLNVSSSTADVFAWFTNISTISGFIGWDCGLVAYLRFRKAIKYNGL-ENRLP 469

Query: 448 FKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF-KVSDFFTAYISVMLFFVFWIGFQIWF 506
           +  +F  +  +++               F P+F  VSDF  AYI++ LF V WIG +I+ 
Sbjct: 470 YAPRFQQYMVWWSILVVTLVIFTNGYQVFIPRFWNVSDFIAAYITLPLFVVLWIGHKIYT 529

Query: 507 RGPLFIK----TEDIDLDTDRREIDD---VVWEEQ-KPRNLWEKFWAAI 547
           R   F K     E+ID+ T   EI++   ++ EE+ +P+  + KF  A+
Sbjct: 530 RD--FKKWWYPVEEIDVVTGLTEIEERTRILDEERVEPKGAFPKFMDAL 576

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  325 bits (832), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 189/513 (36%), Positives = 274/513 (53%), Gaps = 17/513 (3%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSL 98
           +  +K+ LK RHI +IALGG IGTGLF+  S+ L   GP G   +Y  I  + Y V  +L
Sbjct: 48  DHTLKKGLKSRHIQLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMNAL 107

Query: 99  GEMATFIPVTSSFTV-----FTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFW 153
           GEM  ++P   S +         R++ P+LG A G+ Y+  + I  A E +    ++Q+W
Sbjct: 108 GEMVCYLPGDGSSSGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQYW 167

Query: 154 TDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-K 212
           T AVP  AWI IF  ++ + N   VK+YGE EFW A +K+L I+G +  +FI+  G G  
Sbjct: 168 TTAVPKGAWITIFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGGPH 227

Query: 213 TGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVGITAGEAANP 271
              +GFRYW+ PG +   I S   N GRFL   + +I   F +  G ELV +T+ EA + 
Sbjct: 228 HDRLGFRYWQKPGAFAYHITSG--NTGRFLDIWTGVIKGGFAFILGPELVALTSAEAQDA 285

Query: 272 RKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY----ISSSPFVIAIENS 327
           R+ + +A  +                      ND  L +          SSPFVI I+N+
Sbjct: 286 RRNIQKASRRFVYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQNA 345

Query: 328 GTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLT 387
           G KVLPHI N  ILS+  S+GNS ++  SR   SM+  G APK L    + G+PYAAV  
Sbjct: 346 GIKVLPHIINVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAVAL 405

Query: 388 TSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLP 447
           TS+L  +AYL  SS  + VF W  NI+ ++GF  WI I I+++RF +A+  Q +  + +P
Sbjct: 406 TSLLSCIAYLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQNL-YERVP 464

Query: 448 FKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-KFKVSDFFTAYISVMLFFVFWIGFQIWF 506
           FK  F P+G ++                F P  + VSDF  AY+++ +F V WIG ++W 
Sbjct: 465 FKTPFQPYGTWFFIIAVSVICLTNGYAIFIPANWNVSDFIAAYVTLPIFLVLWIGHKLWT 524

Query: 507 R--GPLFIKTEDIDLDTDRREIDDVVWEEQKPR 537
           R      I   +ID+ T  +EI++   E  + R
Sbjct: 525 RTWKTWAIPVPEIDVTTGLKEIEEESKECDEKR 557

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  325 bits (833), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 196/544 (36%), Positives = 306/544 (56%), Gaps = 24/544 (4%)

Query: 10  TREKDGSHLIIKPSI-----AEDAVSMESL-GSVKETQVKRALKPRHISMIALGGTIGTG 63
           T+E++  H  ++ +I     AED     ++ G  + T++K+ L+ R +SM+A+GG++GTG
Sbjct: 33  TQERELLHDDLENNISLSTSAEDQNDSYNVDGKTEGTRLKKVLEGRVVSMVAIGGSLGTG 92

Query: 64  LFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPAL 123
           L I     L+ AGPV  LIAY F+G L +    SLGEMA++IP+   FT +  R+  PAL
Sbjct: 93  LLIGTGNSLATAGPVSMLIAYAFVGLLVFFTMASLGEMASYIPL-DGFTSYATRYADPAL 151

Query: 124 GSANGYLYWLSWAITFALELSVVGQIIQFW--TDAVPLTAWIAIFWVILTISNLFPVKYY 181
           G A GY Y   + I    +L+    +IQ+W   + V    WI IF V++   N   V+++
Sbjct: 152 GFAVGYCYLFKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIFLVVIVAINTLGVQFF 211

Query: 182 GEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KTGPVGFRYWRNPGP---WGPGIISKDVN 237
           GE EFW++  KVL +   II  FI++ G G     +GFR+W++PG    + P I     +
Sbjct: 212 GEFEFWLSSFKVLVMFALIILLFILMLGGGPNHDRLGFRHWKHPGAFNNYSPAITG---D 268

Query: 238 EGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXX 297
            G+F+ +VS  + A F Y GTELVGI  GEA NPRK+VP+AI                  
Sbjct: 269 TGKFVAFVSVFVYATFAYLGTELVGIVVGEARNPRKSVPKAIKLTMYRIIIFYLISILLL 328

Query: 298 XXXXXXNDPKL---KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYV 354
                 +DP L   K++ +  ++SPFV+AI NSG KVLPHIFNA +L  + SA NS++YV
Sbjct: 329 GMCVGYDDPLLLEAKTKSTSAAASPFVVAIVNSGIKVLPHIFNACVLVFVFSACNSDLYV 388

Query: 355 GSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNIT 414
            SR  YS+A++  APK    T + GIPY ++  + +   LAY+  SSG++ +FN+ +N+ 
Sbjct: 389 ASRSLYSLAIDNKAPKIFARTNRWGIPYYSLGLSVLFCLLAYMSVSSGSAKIFNYFVNVV 448

Query: 415 AVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXT 474
           ++ G  +WI I ++++ F +A++ QGI +    + A    +GAY+A             T
Sbjct: 449 SIFGLLSWICILVTYLAFDRAVRAQGIDKSTFSYVAPGQRYGAYFALFFCSLIALIKNFT 508

Query: 475 AF-APKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEE 533
            F   +F    F T YI + +FF+ + G+++ ++  + I   ++DL T +  ID    EE
Sbjct: 509 VFLGHQFDYKTFITGYIGIPVFFISYFGYKLIYKTKI-IDPLEVDLYTFKAAIDQ---EE 564

Query: 534 QKPR 537
           +  +
Sbjct: 565 EDGK 568

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  326 bits (836), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 190/525 (36%), Positives = 294/525 (56%), Gaps = 15/525 (2%)

Query: 25  AEDAVSME-SLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIA 83
           A D ++ E   G  +  ++K+ LK RHISMIA+GG++GTGL I+    L  AGPV  LIA
Sbjct: 47  ASDVLASEIGDGKYEGIRLKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIA 106

Query: 84  YMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALEL 143
           Y F+G + +     LGEMATFIP+   FT +  R+  PALG A GY Y + + I    +L
Sbjct: 107 YTFVGIMVFFTMACLGEMATFIPL-DGFTSYASRYCDPALGFAVGYAYLIKYFILPPNQL 165

Query: 144 SVVGQIIQFWT--DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFII 201
           +    ++Q+W   D V    W+ + + ++T+ N+F V+++GE EFW++ +KVL ++G II
Sbjct: 166 TAAAMVMQYWVPRDTVNPGIWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLII 225

Query: 202 YAF-IMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNE--GRFLGWVSSLISAAFTYQGT 258
             F IM+ GAG    +GFRYW++PG +     S D++   G+F+ +V+ L+   F Y G 
Sbjct: 226 LLFVIMLGGAGSHDRLGFRYWKHPGAFND--YSDDISGSLGKFVSFVAVLVLGVFAYLGI 283

Query: 259 ELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISS 317
           EL GI A EA+NPR++VP+AI                        ND KL  + ++ +++
Sbjct: 284 ELTGIVAAEASNPRRSVPKAIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTA 343

Query: 318 SPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTK 377
           SPF IAI N+G  VLP IFN  +L  + SA NS++YV SR  YS+A++  APK    T +
Sbjct: 344 SPFSIAILNAGITVLPDIFNGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNR 403

Query: 378 SGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALK 437
            GIPY ++  + +   LAY+  SS ++ VF + +N+ ++AG  TWI I I++I F +A++
Sbjct: 404 WGIPYNSLFVSCLFCLLAYMTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVR 463

Query: 438 HQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFV 497
            Q + +    + A F P+GAY +             T F   F    F T YI + +F +
Sbjct: 464 AQHVDKSTFAYVAPFQPYGAYVSLFFCCLIAIIKNFTVFLGHFDYKTFITGYIGLPIFVL 523

Query: 498 FWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEK 542
            + G++I  +  +      +DL + +  +D     EQ    L E+
Sbjct: 524 CYFGYKITCKSEI-RSARYVDLVSQKSLVD----REQVEYELIEQ 563

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  321 bits (823), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 185/500 (37%), Positives = 284/500 (56%), Gaps = 9/500 (1%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           G  +  ++K+AL+ RH+SMIA+GG++GTGL I   + L++AGP   LI+Y F+G L Y+V
Sbjct: 44  GKHEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYTV 103

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
              LGEMA FIP+   FT +  R++ PALG A GY Y   + I    +L+    ++Q+W 
Sbjct: 104 MACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162

Query: 155 --DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG- 211
             + V    WI IF V++ + N   V+++GE EFW++ +KVL ++G I+  FI++ G G 
Sbjct: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGP 222

Query: 212 KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271
                GFRYWR+PG + P   +   ++G+F+ + S    A F Y GTEL GI A EA NP
Sbjct: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNP 282

Query: 272 RKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDP---KLKSEDSYISSSPFVIAIENSG 328
           R++VPRAI                        NDP   K K   +  ++SPFV+AI+N+G
Sbjct: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAG 342

Query: 329 TKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTT 388
             VLPHIFNA +L  + SA NS++YV SR  Y +A++  APK    T   G+PY ++  +
Sbjct: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402

Query: 389 SVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPF 448
            +   LAY+  SSG++ +FN+ +N+ ++ G  +WI I I+++RF +A+  Q   +    +
Sbjct: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFKVSDFFTAYISVMLFFVFWIGFQIWFR 507
            A F PW  + +             T F    F    F + YI + ++ + ++G+++  R
Sbjct: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522

Query: 508 GPLFIKTEDIDLDTDRREID 527
             L IK ED+DL T +  ID
Sbjct: 523 SKL-IKPEDVDLYTFKAAID 541

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  322 bits (824), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 186/520 (35%), Positives = 282/520 (54%), Gaps = 19/520 (3%)

Query: 41  QVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGE 100
           ++K+ LK RH+ +IALGG IGTGLF+  S+ L   GP G  I+Y  I ++ Y + Q +GE
Sbjct: 74  ELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIMQGIGE 133

Query: 101 MATFIPVTSS----FTVF-TQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTD 155
           M  ++P + S    F  +   +++  +LG A+ + Y+  + I  A E +    ++++WT 
Sbjct: 134 MVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAASGVVEYWTT 193

Query: 156 AVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KTG 214
           +VP  AWI IF   + I N   VK+YGE EFW A IK+L IVG II +FI+  G G    
Sbjct: 194 SVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSFILFWGGGPNHD 253

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVGITAGEAANPRK 273
            +GFRYW+NPG +   I  +  + G FL   + +I   F +  G E++ +T+ E  + R+
Sbjct: 254 RLGFRYWQNPGGFAHHI--RGGSFGSFLDIYTGIIKGGFAFILGPEMIAMTSSEVEDQRR 311

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKS----EDSYISSSPFVIAIENSGT 329
            + +A  +                      NDP L++          SSPFVI I+N+G 
Sbjct: 312 NIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPFVIGIQNAGI 371

Query: 330 KVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTS 389
           KVLPHI NA ILS+  SAGN+ ++  SR   +MA NG AP+      + G+PY AV  +S
Sbjct: 372 KVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPYYAVGLSS 431

Query: 390 VLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFK 449
            +  LAYL  SS  + VFNW  NI+ ++GF  WI + I++IRF +A+   G+ +  LP+ 
Sbjct: 432 AISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFHGM-QSRLPYT 490

Query: 450 AKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF-KVSDFFTAYISVMLFFVFWIGFQIWFRG 508
           A+ MP+  Y+                F P+F    +F  AYI++ +F+V WIG +++ R 
Sbjct: 491 ARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAKNFVAAYITLPVFWVLWIGHRVYRRK 550

Query: 509 PLFIK----TEDIDLDTDRREIDDVVWEEQKPRNLWEKFW 544
              +K     E+ID+ T   EI++   E    R L  K+W
Sbjct: 551 IFTLKWWKSIEEIDVVTGVEEIEEKTRECDASRVLPTKWW 590

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  322 bits (825), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 181/516 (35%), Positives = 277/516 (53%), Gaps = 13/516 (2%)

Query: 27  DAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMF 86
           D       G   + ++K+ +K RH+ MI+LG  IGTG+ +     L N GP G +I Y  
Sbjct: 81  DKEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAI 140

Query: 87  IGTLAYSVTQSLGEMA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSV 145
           +G+  Y + Q+ GE+A  +  ++  F  +    + PALG +  ++Y L W     LEL  
Sbjct: 141 MGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVT 200

Query: 146 VGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFI 205
               I++WT +V    ++AIF+V++   N+F  + Y E EF+    KVL I GF+I   I
Sbjct: 201 ASITIKYWTTSVNPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGFLILGII 260

Query: 206 MVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGIT 264
           + CG AG  G +G +YW +PG +     S D     F G VS+L++AAF +  TE + +T
Sbjct: 261 VNCGGAGNDGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEFIALT 315

Query: 265 AGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIA 323
           A E ANPRK++P A  K+                     N  +L  S  S   +SP+VIA
Sbjct: 316 AAEQANPRKSIPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSATHASPYVIA 375

Query: 324 IENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYA 383
           I + G KV+PH+ NAVIL ++IS GNS  Y  SR+  ++A  G AP +L +  + G P  
Sbjct: 376 IASHGVKVVPHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREGRPTL 435

Query: 384 AVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISR 443
           A++ +SV G ++++ +S     VF WLL I+ ++  FTW  I +SHIRF +A+K QG S 
Sbjct: 436 AMVISSVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSL 495

Query: 444 DDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFW 499
            +L FK++   WG+YYA             TA AP    K     FF  Y+++ +    +
Sbjct: 496 GELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALY 555

Query: 500 IGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQ 534
            G+++W R   L+I    IDL ++RR  D+ V +++
Sbjct: 556 FGYKVWKRDWTLYIPASKIDLISNRRIFDEDVLKQE 591

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  320 bits (820), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 192/529 (36%), Positives = 280/529 (52%), Gaps = 22/529 (4%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97
            E  +++ LK RHI MIALGG IGTGLF+  S+ L+  GP G  I+Y+ I ++ Y +   
Sbjct: 73  NEGSLQQGLKSRHIQMIALGGAIGTGLFVGTSSTLALCGPAGLFISYIIISSVVYPIMCG 132

Query: 98  LGEMATFIP-----VTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQF 152
            GEM  ++P      + S      R++  +LG A  + Y+  + I  A E +    ++++
Sbjct: 133 FGEMVCYLPGNGNDASGSAAHLVARYVDKSLGFATAWNYYYCYIILVAAECTAASGVVEY 192

Query: 153 WTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG- 211
           WT AVP   WI IF  I+ I N  PVKYYGE EFW A IK+L IVG II +FI+  G G 
Sbjct: 193 WTVAVPKGVWILIFLGIVVILNFGPVKYYGEAEFWFASIKILCIVGLIILSFILFWGGGP 252

Query: 212 KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVGITAGEAAN 270
               +GFRYW+ PG +   I+      GRFL   S +I   F +  G ELV +T+ E  +
Sbjct: 253 NHDRLGFRYWQRPGAFTEHIMKGGF--GRFLDIYSGVIKGGFAFILGPELVCLTSAECED 310

Query: 271 PRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL----KSEDSYISSSPFVIAIEN 326
            R+ + +A  +                      NDP L     S      SSPFVI I+N
Sbjct: 311 QRRNIAKAARRFIWRLMFFYVLGTLAISVIVAYNDPSLVSALASGKPGAGSSPFVIGIQN 370

Query: 327 SGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVL 386
           +G +VLPHI NA ILS+  SAGN+ ++  +R   +MA NG AP+      + G+PY A+ 
Sbjct: 371 AGIRVLPHIINACILSSAWSAGNAFMFASTRSLLTMARNGDAPRVFGKINRFGVPYVAIS 430

Query: 387 TTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDL 446
            +  L  LA+L  SS  + VFNW  NI+ ++GF  WI   +++IRF +A+   G+  D L
Sbjct: 431 LSGGLSCLAFLNVSSSTADVFNWFSNISTISGFIGWICGCVAYIRFRKAIFFNGM-YDRL 489

Query: 447 PFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPK-FKVSDFFTAYISVMLFFVFWIGFQIW 505
           PFK    P+  YY+               F PK +K SDF  AYI++ +F V W+G ++W
Sbjct: 490 PFKTWGQPYAVYYSLFVISLITLTNGYATFIPKNWKGSDFVAAYITLPIFVVLWVGHKLW 549

Query: 506 ---FRGPLFIKTEDIDLDTDRREIDD--VVWEEQK--PRNLWEKFWAAI 547
              F    + + + ID+ T   +I++   + +E +  P   W+KF  A+
Sbjct: 550 TRTFTKRWWRRVDQIDVTTGLVDIEERTKILDETRVEPSTRWQKFMDAV 598

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  320 bits (820), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 188/510 (36%), Positives = 289/510 (56%), Gaps = 12/510 (2%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           G  + T++K+ALK RH+SMIA+GG++GTGL I   T L+ AGPV  LIAY F+G L +  
Sbjct: 61  GKTEGTRLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIAYAFVGLLVFFT 120

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
              LGEMAT+IP+   FT +  R+  PALG A GY Y   + I    +L+    +IQ+W 
Sbjct: 121 MACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWV 179

Query: 155 DAVPLT--AWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG- 211
           D   +    W+ IF V++   N+F V+++GE EFW++  KVL ++G ++  FI++ G G 
Sbjct: 180 DKEKVNPGVWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLGLMLLLFILMLGGGP 239

Query: 212 KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271
               +GFRYWR+PG +     +   + GRF+ +VS  + A + Y G EL GI A EA NP
Sbjct: 240 DHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNP 299

Query: 272 RKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDP---KLKSEDSYISSSPFVIAIENSG 328
           RK++P+AI                        +DP   K K+  +  ++SPFV+AI NSG
Sbjct: 300 RKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAASPFVVAIINSG 359

Query: 329 TKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTT 388
              LPHI NA +L  + SA NS++YV SR  YS+A++  APK    T + GIPY A+  +
Sbjct: 360 INALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVS 419

Query: 389 SVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPF 448
            +   LAY+  SS ++ +FN+ +N+ ++ G  +WI I I++I F +A++ QG+ +    +
Sbjct: 420 VLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAY 479

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFKVSDFFTAYISVMLFFVFWIGFQIWFR 507
            A F P+GA+++             T F   +F   +F T YI + +FF  + G++  ++
Sbjct: 480 VAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYK 539

Query: 508 GPLFIKTEDIDLDTDRREIDDVVWEEQKPR 537
             + I    +DL T +  ID    EE+  +
Sbjct: 540 TKV-IDPLKVDLYTFKAAIDQ---EEEDGK 565

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  319 bits (817), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 178/501 (35%), Positives = 274/501 (54%), Gaps = 19/501 (3%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97
           +   + R L  RH+  +A+GG IGTGLF++  + L+  GP   +IA+  I T  +++  +
Sbjct: 67  RSLNLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIGGPASLVIAWTIISTCLFTIVNA 126

Query: 98  LGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAV 157
           LGE+A   PV   F V+  R + P+LG A    Y   WA+   LEL      I++W ++V
Sbjct: 127 LGELAAVFPVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLELVAASITIRYWNNSV 186

Query: 158 PLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KTGPV 216
              AW+A+F+V + +++L  VK +GE EF ++ +K+LAI GF I   +++CG G K G +
Sbjct: 187 NSDAWVAVFYVCIFLASLLDVKSFGETEFILSMVKILAIGGFTILGIVLICGGGPKNGYI 246

Query: 217 GFRYWRNPGPW---GPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
           G +YW +PG +    PG         +F G  S  ++AAF+Y GTELVG++A E+ANPR 
Sbjct: 247 GAKYWNDPGSFVGASPG--------SQFKGLCSVFVTAAFSYSGTELVGVSAAESANPRY 298

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY--ISSSPFVIAIENSGTKV 331
           T+P+A  +                      +DPKL S  S   +++SP VIAIEN G + 
Sbjct: 299 TLPKASKRTFWLITLSYLLVLTIIGCLVRHDDPKLLSASSSVDVAASPLVIAIENGGIQG 358

Query: 332 LPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVL 391
           LP + NA+IL  IIS  NS+VY  SR   SMA  G  P+  T+    G P  A++ T V 
Sbjct: 359 LPSLMNAIILIAIISVANSSVYACSRCMVSMAEIGNLPRIFTYIDNRGRPIVAIIFTLVF 418

Query: 392 GFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAK 451
           G L+++ +S+    +F WL  ++ ++  F W+ I+ISHIRF +AL  QG S D+LP+ + 
Sbjct: 419 GLLSFIAASNKQEEIFVWLSALSGLSTLFCWLAINISHIRFRRALNTQGYSLDELPYLSM 478

Query: 452 FMPWGAYYAAXXXXXXXXXXXXTAFAPKFKV----SDFFTAYISVMLFFVFWIGFQIWFR 507
               G++Y              T+  P          FF  Y+S+ +F   ++G +++ R
Sbjct: 479 TGVIGSWYGCVVIILVLIASFWTSLFPAGSSGADWESFFKGYLSLPIFLFCFVGHKLYKR 538

Query: 508 G-PLFIKTEDIDLDTDRREID 527
                I++  ID++T RR ID
Sbjct: 539 NWSWMIRSNKIDVNTGRRMID 559

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  318 bits (816), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 182/528 (34%), Positives = 280/528 (53%), Gaps = 15/528 (2%)

Query: 21  KPSIAEDAVSMESLGS-VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVG 79
           +P + +D+   E   + V +TQ+K+ +K RH+ M++LG  IGTGL ++ +  L  AGP  
Sbjct: 53  QPPLKQDSDLEEDTDTIVTDTQLKKTMKSRHVVMMSLGTGIGTGLLVANAQGLHKAGPAP 112

Query: 80  ALIAYMFIGTLAYSVTQSLGEMATFIP-VTSSFTVFTQRFLSPALGSANGYLYWLSWAIT 138
            +IAY  +  + Y + Q+ GEMA   P +  +F  +   F+S   G A  +L+++ W   
Sbjct: 113 LVIAYGMVSFVTYFMIQAAGEMAVVYPTLPGNFNAYISTFISKPFGFATVWLFFIQWLTV 172

Query: 139 FALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVG 198
             LEL      +Q+W D++    ++ IF+V L   + F VK YGE EF     K+L + G
Sbjct: 173 LPLELITAAMTVQYWNDSINADVYVVIFYVFLLFIHFFGVKAYGETEFIFNLCKILFVGG 232

Query: 199 FIIYAFIM-VCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQG 257
           FII++ ++ V GAG +G +G +YW +PG +     + D N GRF G    L++A F+Y G
Sbjct: 233 FIIFSIVVNVGGAGNSGYIGAKYWHDPGAF-----TSDTNAGRFKGVCYVLVTAYFSYGG 287

Query: 258 TELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK-SEDSYIS 316
            EL  ++  E  NPR++ P A  +                      N  +L  S  S   
Sbjct: 288 MELFALSVNEQENPRRSTPTAAKQSIYRIVVIYLLTMILVGFNVPSNSNELMGSGGSVTH 347

Query: 317 SSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTT 376
           +SP+V+A    G KV+PHI NAVIL ++IS GNS +Y   R+  ++A  G APK++ +  
Sbjct: 348 ASPYVLAASIHGVKVVPHIVNAVILISLISVGNSALYAAPRLMCALAQQGFAPKFMDYVD 407

Query: 377 KSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQAL 436
           + G P  A++  SV G + ++  SS    VFNWL  I  +A  FTW  I ISHIRF QA+
Sbjct: 408 REGRPLFALIVCSVFGVIGFVACSSKEEQVFNWLAAIAGLAELFTWSGIMISHIRFRQAM 467

Query: 437 KHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISV 492
           K Q  S D++ +K+ F  +G+Y+               A AP    +     FF +Y++ 
Sbjct: 468 KLQNKSLDEVGYKSPFGVYGSYFGVFFNLLVFVAQFWVALAPPMYTEMSADTFFESYLAF 527

Query: 493 MLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREID-DVVWEEQKPRN 538
            +FF F+ G+ IW R   LF   E +DLD  RR  D ++V +E + + 
Sbjct: 528 PIFFAFYFGYMIWKRDFTLFSDLESVDLDYHRRIYDPELVKQEDEEKK 575

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  319 bits (818), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 175/531 (32%), Positives = 282/531 (53%), Gaps = 15/531 (2%)

Query: 12  EKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTP 71
           +KDG   +    + E+ V  E   + K  ++K+ +KPRH+ +I+LG  IGTGL +  +  
Sbjct: 78  DKDGKE-VADLEVQENQVLTEK-SNQKNKELKQTIKPRHVILISLGTGIGTGLLVGNAKA 135

Query: 72  LSNAGPVGALIAYMFIGTLAYSVTQSLGEMA-TFIPVTSSFTVFTQRFLSPALGSANGYL 130
           L NAGP G LI Y  +GT  Y + Q+ GE+A ++  ++  F V+    + PA G +  ++
Sbjct: 136 LHNAGPAGLLIGYSIMGTCLYCIIQAAGELAVSYSSLSGGFNVYPSFLVDPAFGFSVAWV 195

Query: 131 YWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIAC 190
           Y + W     LEL      I++WT  V    ++ IF+V++ + N F  + Y E EF+  C
Sbjct: 196 YCIQWLCVCPLELVTASMTIKYWTTTVNADIFVGIFYVLIIVINTFGARGYAEAEFFFNC 255

Query: 191 IKVLAIVGFIIYAFIM-VCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLI 249
            K+L ++GF I   ++   GAG  G +G RYW  PG +     + D     F G +++++
Sbjct: 256 CKILMMIGFFILGIVINTGGAGNDGYIGDRYWHTPGAF-----AGDRPIDHFKGIMATMV 310

Query: 250 SAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKL 308
           +AAF +  TE + +TA E +NPRK +P A  KV                     + D  +
Sbjct: 311 TAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRILFIFLGSITLVGFLVPYDSDQLM 370

Query: 309 KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLA 368
            S  S   +SP+V+A+   G KV+PH  NAVIL +++S GNS  Y  SR+ YS+A  G A
Sbjct: 371 GSGGSATKASPYVLAVSTHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLYSLAQQGNA 430

Query: 369 PKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISIS 428
           PK+  +  + G P+ A++   V   +++  +S     VF WLL I+ ++  FTW  I +S
Sbjct: 431 PKFFDYVDREGRPFRAMVCAGVFAIISFCAASPKEEQVFTWLLAISGLSQVFTWFAICLS 490

Query: 429 HIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSD 484
           HIRF +A+  Q  S  ++ FKA+   WG+YY               A AP    K     
Sbjct: 491 HIRFRKAMFVQKRSLGEIGFKAQTGVWGSYYVCFMLVMILIAQFWVAIAPIGEGKLDAQG 550

Query: 485 FFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQ 534
           FF  Y+++ +  +F++G++IW +   LFI+  +IDLD  R+  D+ + +++
Sbjct: 551 FFENYLAMPILILFYVGYKIWKKDWSLFIRANNIDLDKHRQIFDEELLKQE 601

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  315 bits (806), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 175/516 (33%), Positives = 276/516 (53%), Gaps = 7/516 (1%)

Query: 12  EKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTP 71
           EK G+ ++ +P+  ED    E +   K   + R LKPR +S++ LG  +GTGL I   + 
Sbjct: 3   EKKGTVVLERPASGEDECESEEIDE-KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSA 61

Query: 72  LSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLY 131
           L+  GP+   IAY+F G+L   V  SL EMA+F P+   F+ +  R++ PA G A G+ Y
Sbjct: 62  LAKGGPISLFIAYLFTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNY 121

Query: 132 WLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACI 191
           +L +AI  +  L+  G +I +W   V +  W+ + +V +   N   VKY+GE+E  +   
Sbjct: 122 FLKYAIVLSANLTAFGLVIGYWRPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVF 181

Query: 192 KVLAIVGFIIYAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLIS 250
           K+L +V   I   I+ CG A      GFRYWR  G   P ++      G+FLGW + ++ 
Sbjct: 182 KLLVLVIVYITCLIITCGGAPNHTTTGFRYWRESGAL-PYLVGG--GTGKFLGWWACVVQ 238

Query: 251 AAFTYQGTELVGITAGEAANPRKTVPRA-INKVXXXXXXXXXXXXXXXXXXXXXNDPKLK 309
           + F + G+E++GI  GE ANP+KT+P++ +N                       N   + 
Sbjct: 239 SIFGFMGSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVH 298

Query: 310 SEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAP 369
           +  +  ++SPFVIAI +SG KVLP+  NA +L  IIS+ N+++Y+ SR  Y +A +G AP
Sbjct: 299 AHSTDANASPFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAP 358

Query: 370 KYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISH 429
           K      +  +P    +T S+LGFLAY+ +   A+ VF+++ +  +V G   W  I I++
Sbjct: 359 KIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAY 418

Query: 430 IRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAY 489
           I + +A+K +GIS DD+PF+  F P+ AY                AF  KF    F T+Y
Sbjct: 419 INYDRAIKAKGISIDDIPFRMWFQPYAAYVTLFFVTIITFFNGYNAFIIKFHYKTFITSY 478

Query: 490 ISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRRE 525
           I V    +  IG++++F+   F+K  +I   T    
Sbjct: 479 IGVFANILMVIGYKLYFKTK-FVKPSEISFRTRNEH 513

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  317 bits (811), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 174/518 (33%), Positives = 278/518 (53%), Gaps = 13/518 (2%)

Query: 26  EDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYM 85
           E+  S       ++++  + L  RH+  +A+GG IGTGLF++  + L+  GP   +I ++
Sbjct: 54  ENVESTSGTSDAEDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWV 113

Query: 86  FIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSV 145
            I T  +++  +LGE+++  PV   F V+  RF+ P+ G A    Y   WA+   LEL  
Sbjct: 114 IISTCLFTIVNALGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVA 173

Query: 146 VGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFI 205
               I++W   +   AW+AIF+ I+ ++NL  VK +GE EF ++ +K+LAI+GF I   +
Sbjct: 174 ASLTIRYWNSTINSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIV 233

Query: 206 MVC-GAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGIT 264
           + C G  + G +G +YW NPG +       + +  RF G  S  ++AAF+Y GTEL+ ++
Sbjct: 234 LTCGGGPEGGYIGGKYWSNPGAF-----VGNTSSQRFHGLCSVFVTAAFSYSGTELIAVS 288

Query: 265 AGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL--KSEDSYISSSPFVI 322
           A E+ NPR T+P+A  +                      +DP+L   S    +++SP VI
Sbjct: 289 AAESVNPRITLPKACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLVI 348

Query: 323 AIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPY 382
           AIEN G K LP + NA+IL  ++S  NS VY  SR   SMA  G  PK  ++  + G P 
Sbjct: 349 AIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPL 408

Query: 383 AAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGIS 442
            A+L T + G L+++ +S+    VF WL  ++ ++  F W  I++SHIRF   +K +G S
Sbjct: 409 YAILATLIFGLLSFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRS 468

Query: 443 RDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFK----VSDFFTAYISVMLFFVF 498
            D+LPF +    WG+YY              TA  P  +       FF  Y+S  +  V 
Sbjct: 469 LDELPFVSMTGVWGSYYGCVIIFVVLVVCFWTALFPSTEGVASAESFFETYLSFPILLVC 528

Query: 499 WIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQK 535
           +IG +++ +   L   T +ID+D+ RR +D  V +++K
Sbjct: 529 YIGHKLYTKSWRLLTPTTEIDIDSGRRAVDIEVLKDEK 566

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  316 bits (810), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/530 (35%), Positives = 274/530 (51%), Gaps = 13/530 (2%)

Query: 13  KDGSHLIIKPSIAEDAVSMESLGSVK-ETQVKRALKPRHISMIALGGTIGTGLFISISTP 71
           KDG   +    +  +    E +  +  ++ ++R LK RH+ MIA+GG IGTGLF+     
Sbjct: 47  KDGFKRVELEELDPNLTEAEKIAIITAQSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGKA 106

Query: 72  LSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLY 131
           L   GP G LI +  IG + Y V  S+GE+A   PV+  FT +  RF+  + G A  Y Y
Sbjct: 107 LRTGGPAGVLIGWGLIGLMIYCVVMSMGELAVTFPVSGGFTTYATRFVDESFGFAINYNY 166

Query: 132 WLSWAITFALELSVVGQIIQFW-TDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIAC 190
            L W +   LE+      + FW T       ++A+F++++ I N F V+ YGE EF  + 
Sbjct: 167 MLQWLVVLPLEIVAASITVNFWGTPPKYRDGFVALFYIVIVIINFFGVRGYGEAEFVFSF 226

Query: 191 IKVLAIVGFIIYAFIMVCGAGKTGPVGF-RYWRNPGPWGPGIISKDVNEGRFLGWVSSLI 249
           IKV+ ++GFII   ++VCG G  G     +YW NPG +     S D    RF G  S  +
Sbjct: 227 IKVITVIGFIILGIVLVCGGGPVGGYIGGKYWHNPGAF-----SGDDAGSRFKGVCSVFV 281

Query: 250 SAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK 309
           +AAF++ GTELVG+ + E ANPRK +PRA  +V                        +L 
Sbjct: 282 TAAFSFAGTELVGLASAETANPRKALPRAAKQVFWRILLFYIISLCLIGLLVPHTSERLI 341

Query: 310 SEDSY-ISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLA 368
              S   ++SPFV+AI+  G K LP + N VIL +++S GNS VY  SR   ++A  G  
Sbjct: 342 GTSSVDAAASPFVLAIQTHGIKGLPSVINVVILISVLSVGNSAVYACSRSMVALAEQGSL 401

Query: 369 PKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISIS 428
           P    +  + G P  A++TT V G L+++  S     VFNWLL ++ ++  F+W  I I 
Sbjct: 402 PHIFAYIDRKGRPLVAIITTCVFGLLSFIAQSEKEGDVFNWLLALSGLSTLFSWGAICIC 461

Query: 429 HIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP---KFKVSDF 485
           HIRF +AL  QG S D+L F +     G+Y+               A  P        DF
Sbjct: 462 HIRFRRALSAQGRSTDELAFVSYAGIAGSYFGVILVLLVLIAQFWVAVWPIGGSPNAEDF 521

Query: 486 FTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQ 534
           F+AY+S  +   F+I  +IW R   LF + +DID+DT RRE+D     ++
Sbjct: 522 FSAYLSFPVLLAFYIFHKIWKRNWKLFTRAKDIDIDTGRREMDTEALRQE 571

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  315 bits (808), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 178/542 (32%), Positives = 291/542 (53%), Gaps = 13/542 (2%)

Query: 2   SLSKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIG 61
           S +K+   + EK    L  +   A+     +++ + K++++ + L  RH+  +A+GG IG
Sbjct: 24  SFAKEETWSVEKQLKPLAEEKDYADMNDVEKAIYNTKDSKLNKDLSIRHLLTLAVGGAIG 83

Query: 62  TGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSP 121
           TGLF++    LS  GP   +IA+  I T  +++  SLGE++   PV   F V+  RF+ P
Sbjct: 84  TGLFVNSGDSLSTGGPASLVIAWTIISTCLFTIVNSLGELSATFPVVGGFNVYVTRFVEP 143

Query: 122 ALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYY 181
           + G A  + Y   WAI   LEL      I++W  ++   AW++IF+V +  +N+  VK +
Sbjct: 144 SFGFAVNFNYLAQWAILLPLELCAASITIRYWNKSINPDAWVSIFYVAIAFANMLDVKSF 203

Query: 182 GEVEFWIACIKVLAIVGFIIYAFIMVC-GAGKTGPVGFRYWRNPGPWGPGIISKDVNEGR 240
           GE EF ++ +K+LAI+GF I   +++C G    G +G +YW +PG +       D    R
Sbjct: 204 GETEFVLSMVKILAIIGFTILGIVLICGGGPSGGFIGGKYWNDPGAF-----VGDTPAQR 258

Query: 241 FLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXX 300
           F G  +  I+AAF+Y G ELVG++A E+ NPR T+P+A  +                   
Sbjct: 259 FKGLSAVFITAAFSYSGLELVGVSAAESRNPRVTLPKAAKRTFWLITMSYLVILTLIGCL 318

Query: 301 XXXNDPKLKSEDSYI--SSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRI 358
              NDP L +  S +  ++SP VIAI+N G K LP + NA+IL  ++S  NS VY  SR 
Sbjct: 319 VPSNDPLLLNGTSSVDAAASPLVIAIQNGGIKGLPSLMNAIILIALLSVANSAVYACSRC 378

Query: 359 AYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAG 418
             SMA  G  P+ L    K G P  A+  T ++G L+++ +S+    VF WL  ++ ++ 
Sbjct: 379 IISMAEIGNLPRSLAHVDKKGRPLYAIAITLLVGLLSFIAASNKRDEVFTWLSALSGLST 438

Query: 419 FFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP 478
            F W  I+++H+RF  A+KHQ  S ++LP+ +    WG++Y              T+  P
Sbjct: 439 LFCWFAINLAHLRFRHAMKHQNRSLEELPYVSMTGEWGSWYGCIVIGLVLIASFWTSLFP 498

Query: 479 K----FKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEE 533
                   + FF +Y+S+ +F   ++G +IW R   L+IK  ++D+D+ R + D    ++
Sbjct: 499 AGGNGADATSFFESYLSLPIFIACYLGHKIWKRNLRLYIKLSEVDVDSGRTDTDAATLKQ 558

Query: 534 QK 535
           +K
Sbjct: 559 EK 560

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  316 bits (809), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/523 (35%), Positives = 278/523 (53%), Gaps = 29/523 (5%)

Query: 42  VKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEM 101
           +KR LK RH+ MIA+GG+IGTGLF+     L   GP   +IA++  G++ YSV Q+LGE+
Sbjct: 89  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQALGEL 148

Query: 102 ATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFW-TDAVPLT 160
           A  +PV+ S+  +  RF+ P+ G A  Y Y +   IT  LEL      + +W  D+    
Sbjct: 149 AVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYWDVDSKYAD 208

Query: 161 AWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKT--GPVGF 218
           A++A+F++++   NLF VK YGE EF  + IKV AIVGFII   ++VCG G +  G +G 
Sbjct: 209 AFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGYIGA 268

Query: 219 RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRA 278
           RYW NPG +  G          F G+ +  +++AF++ G+E+  + A E  NPRK +PRA
Sbjct: 269 RYWYNPGGFAHG----------FKGFAAIFVTSAFSFAGSEMFALAAAETENPRKDLPRA 318

Query: 279 INKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIAIENSGTKVLPHIFN 337
             +V                      D  L  +     S+SPFVIAI  +G K LP + N
Sbjct: 319 AKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASASPFVIAIARAGIKGLPSVVN 378

Query: 338 AVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYL 397
            VIL  ++S GN  VY  SR   S+A  G  P+   +  + G P   +L  ++ G L++L
Sbjct: 379 VVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGLLSFL 438

Query: 398 ESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
            +SS    VF+W+L I+ +  FF W  I + H+RF +AL  QG S D+L +KA+   WG+
Sbjct: 439 SASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQTGIWGS 498

Query: 458 YYAAXXXXXXXXXXXXTAFAP---KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIK 513
            Y               A  P       + FF+AY+S+ +   F+   +++ R     IK
Sbjct: 499 LYGIGLIFIVLCFQFWVALFPIGGSPNANHFFSAYLSLPVVIFFYTCHKLYTRSWTFLIK 558

Query: 514 TEDIDLDTDRREID-----DVVWEEQ---KPRNLW---EKFWA 545
           + DID+DT RRE+D       + EEQ   + + +W    +FW 
Sbjct: 559 SSDIDIDTGRREMDLELLKQEIQEEQQYIRSKPIWYRIYRFWC 601

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  317 bits (811), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/556 (33%), Positives = 288/556 (51%), Gaps = 22/556 (3%)

Query: 3   LSKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKE---------TQVKRALKPRHISM 53
           L  D++   E + +  +    +  D    + +  V+          +Q+ + L  RH+  
Sbjct: 61  LLNDFKRADEGETTRSVADSDMEVDGKRYKEMTDVERAVCDAARNSSQLSKNLSIRHLLT 120

Query: 54  IALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTV 113
           +A+GG IGTGLF++    L+  GP   LIA+  I T  +++  SLGE+A+  PV   F V
Sbjct: 121 LAVGGAIGTGLFVNSGASLNTGGPGSILIAWTLISTCLFTIVNSLGELASAFPVVGGFNV 180

Query: 114 FTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTIS 173
           +  RF+ P+ G A    Y   WA+   LEL+     I++W + +   AW+AIF+V + ++
Sbjct: 181 YITRFVEPSFGFAVNISYLAQWAVLLPLELAAASITIKYWNNKINSDAWVAIFYVCIALA 240

Query: 174 NLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGF-RYWRNPGPWGPGII 232
           N+  VK +GE EF ++ +K+LAI GF I   +++CG G  G     +YW +PG +     
Sbjct: 241 NMLDVKSFGETEFVLSMVKILAIFGFAILGTVLICGGGPVGGFIGAKYWHDPGAF----- 295

Query: 233 SKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXX 292
             D    +F G  S  ++AAF+Y GTELVG++A E+ NPR T+PRA  +           
Sbjct: 296 VGDTPGAQFKGLCSVFVTAAFSYSGTELVGVSAAESINPRYTIPRASKRSFWLITSSYLL 355

Query: 293 XXXXXXXXXXXNDPKLKSEDSY--ISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNS 350
                      NDP+L +  S   +++SP VIAIEN G + +P + NA+IL  IIS  NS
Sbjct: 356 VLTIAGCLVPSNDPRLLNGMSSVDVAASPLVIAIENGGIRGVPSLMNAIILIAIISVANS 415

Query: 351 NVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWL 410
           +VY  SR   SMA  G  PK   +  + G P  A+L T V G L+++ +S    A+F WL
Sbjct: 416 SVYACSRCMVSMAQVGNLPKVFNYIDRKGRPLVAILATLVFGLLSFVAASDKQEAIFTWL 475

Query: 411 LNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXX 470
             ++ ++  F W  I+ISHIRF +A+  Q  S D+LP+ +     G++Y A         
Sbjct: 476 SALSGLSTLFCWFAINISHIRFRRAMCAQQRSLDELPYLSLTGVLGSWYGAAVLLFVLVL 535

Query: 471 XXXTAFAPKF----KVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRRE 525
              T+  P          FF  Y+S  +F + +I  +++ R   LFI    ID+D+ RR 
Sbjct: 536 SFWTSLFPPGSSGPSAESFFEGYLSFPIFLICYISHKLYKRDWRLFIPAGQIDVDSGRRA 595

Query: 526 IDDVVWEEQKPRNLWE 541
           +D    +EQK R   E
Sbjct: 596 LDIEELKEQKLREQAE 611

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  317 bits (812), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 182/524 (34%), Positives = 282/524 (53%), Gaps = 21/524 (4%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97
           K   +K+ +KPRH+ MI+LG  IGTGL +     LS AGP   +I Y  +GT  Y + Q+
Sbjct: 116 KSEDLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGTCLYCIIQA 175

Query: 98  LGEMAT-FIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDA 156
            GE+A  +  +   F  +    + PALG +  ++Y L W     LEL      I++WT  
Sbjct: 176 AGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTTK 235

Query: 157 VPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGP 215
           V    ++ IF+V++   N F  + Y E EF+  C KVL + GF I   I+  G AG  G 
Sbjct: 236 VDPDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCKVLMMTGFFILGIIITAGGAGNDGY 295

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G +YW +PG +     + D +  RF G + + ++AAF +  TE + +TA E +NPRK +
Sbjct: 296 LGAKYWHDPGAF-----NGDKSIDRFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAI 350

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           P A  KV                     N D  L S  S I +SP+VIA+ + G +V+PH
Sbjct: 351 PSAAKKVLYRIVCIFLASITLIGFLVPYNSDQLLGSGGSGIKASPYVIAVSSHGVRVVPH 410

Query: 335 IFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFL 394
             NAVIL +++S GNS  Y  SR+  S+A  G APK+  +  + G P+ A+L +++ G +
Sbjct: 411 FINAVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAMLMSALFGVI 470

Query: 395 AYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMP 454
           A+  +S   + VF+WLL I+ ++  FTWI I +SHIRF +A++ QG S  ++ + ++   
Sbjct: 471 AFCATSPKETEVFSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEVGYLSQSGV 530

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-P 509
           +G+ YAA             A AP    K    +FF  Y+++ +   F+ G+++W R   
Sbjct: 531 YGSAYAAIMLFLALIAQFWVAIAPIGEGKLDAENFFQNYLAMPILIAFYFGYRVWKRDWK 590

Query: 510 LFIKTEDIDLDTDRREIDDVVWEE------QKPRN--LWEKFWA 545
           LFI+ +DIDLDT R+  D+ +  +      +K RN  +W +F A
Sbjct: 591 LFIRAKDIDLDTHRQIFDENILRQEDEEYKEKLRNGPMWRRFLA 634

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  314 bits (805), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 186/534 (34%), Positives = 281/534 (52%), Gaps = 29/534 (5%)

Query: 27  DAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMF 86
           + +  +S GS   T + + L+ RHI +IALGG IGTGLF+  S  L N G    L++++ 
Sbjct: 32  EELETQSAGSEYNT-LHKGLQSRHIQLIALGGCIGTGLFVGTSWTLHNCGAAPLLLSFIL 90

Query: 87  IGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVV 146
           I T+ Y +  SL EM  ++P   S      R++ P+LG A G+ Y  ++AI  A ELS  
Sbjct: 91  ISTIVYPIMCSLAEMICYLPQQGSVPELVSRYVDPSLGFATGWNYAYAYAILVAAELSAA 150

Query: 147 GQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYA-FI 205
             ++ +W + VP+ AWI IF V++   N   VKYYGE EFW A IK++ I+G ++ +  I
Sbjct: 151 ASVVSYWDNPVPMAAWITIFLVVVVGLNFTAVKYYGEAEFWFASIKLICILGLLVVSVVI 210

Query: 206 MVCGAGKTGPVGFRYWRNPGPW----GPGIISKDVNEGRFLGWVSSLISAAFTY-QGTEL 260
              GA      GFRYW+NPGP+     PG      + GRFL    ++I +AF +    EL
Sbjct: 211 FFGGAPNHDRTGFRYWKNPGPFAMSLAPG------STGRFLDVWRAVIKSAFAFILSPEL 264

Query: 261 VGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPK----LKSEDSYIS 316
           +GI   EA + R+   +A  +                       DPK    L++     +
Sbjct: 265 IGIACVEAQDTRRNTEKASRRFIYRIIFFYVSCALMIGVILSRTDPKLIEALETGAPGAA 324

Query: 317 SSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTT 376
           SSPFV  I N+G  VL H+ N  ILS+  SAGNS +Y  +R+  ++A  G APK+LT   
Sbjct: 325 SSPFVQGIANAGIPVLDHVINVAILSSAWSAGNSFMYASTRMVLALAREGNAPKFLTKIN 384

Query: 377 KSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQAL 436
           + G+PY AV+  +++  LAYL   + ++ VF WL NI  ++GF  W  + I+ IRF + +
Sbjct: 385 RYGVPYNAVIVCTLVACLAYLNVKTTSANVFQWLSNICTISGFIGWFAMGIAFIRFRRGI 444

Query: 437 KHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-KFKVSDFFTAYISVMLF 495
               + +  +P++    P+ AYY                F   ++ V DF  AY+++ ++
Sbjct: 445 VFNNL-QSRIPYQGPLQPYIAYYFTFMTVVVCLTNGFHVFLKGRWNVVDFVAAYVTLPIY 503

Query: 496 FVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQK------PRNLWEKF 543
            V ++G ++WFR   +I  E ID+ T   E +    EE K      P+NLWEKF
Sbjct: 504 LVLYLGHKLWFRTRWYIPVEQIDVITGLVEAE----EESKMTPPRIPKNLWEKF 553

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  313 bits (801), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 178/509 (34%), Positives = 273/509 (53%), Gaps = 19/509 (3%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSL 98
            + +KR LK RH+ MIA+GG+IGTGLF+     L   GP   ++A++  G++ YSV Q++
Sbjct: 81  RSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAI 140

Query: 99  GEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT-DAV 157
           GE+   +PV+ S+  +  RF+ P+ G A  Y Y +   +T  LE+      + +W  D  
Sbjct: 141 GELCVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHK 200

Query: 158 PLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG--KTGP 215
               ++A+F+V + + N   VK YGE EF  + IKVLAIVGFII   ++VCG G   TG 
Sbjct: 201 YADGFVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGY 260

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G +YW NPG +  G          F G+ +  +++AF++ G+E+  + A E+ NPR+ +
Sbjct: 261 IGTKYWHNPGGFAHG----------FKGFAAIFVTSAFSFSGSEMFALGAAESKNPRRDL 310

Query: 276 PRAINKVX-XXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           P+A  +V                      N     S     S+SPFVIAI+ +G   LP 
Sbjct: 311 PKAAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASASPFVIAIKEAGISGLPS 370

Query: 335 IFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFL 394
           + N VIL  ++S GN+ V+  SR   S+A  G  PK   +  + G P A ++ + V G L
Sbjct: 371 VINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLL 430

Query: 395 AYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMP 454
           ++L SS     VF W+L ++ +  FFTW  I + H+RF Q L+ QG S D+L FKA+   
Sbjct: 431 SFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQTGI 490

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAPKFK---VSDFFTAYISVMLFFVFWIGFQIWFRG-PL 510
           WG+ Y               A  P  K      FF  Y+S+ +  VF++G +++ R   L
Sbjct: 491 WGSIYGITLISVVLCFQFWVALFPLSKSPSAYHFFEQYLSLPVVIVFYMGHKVYSRNWRL 550

Query: 511 FIKTEDIDLDTDRREID-DVVWEEQKPRN 538
            I  +++DLDT RRE+D +++ +E K  N
Sbjct: 551 VIPAKELDLDTGRREVDLELLKQEIKEEN 579

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  312 bits (800), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 174/519 (33%), Positives = 276/519 (53%), Gaps = 13/519 (2%)

Query: 24  IAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIA 83
           +  DA S  S  SV    + + L  RH+  +A+GG IG GLF++    L++ GP   +I 
Sbjct: 52  VVNDATSTVSNASVTNVNLNKNLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVID 111

Query: 84  YMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALEL 143
           ++ I T  ++V  +LGEMA   PV   F V+  RF+ P++G A    Y   W +   LEL
Sbjct: 112 WVIISTCLFTVINALGEMAAAFPVVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLEL 171

Query: 144 SVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYA 203
                 I++W D +   AW+AIF+ ++  +N+  VK +GE EF ++ +K+LAI+GF I  
Sbjct: 172 VAASMTIKYWNDTINSDAWVAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILG 231

Query: 204 FIMVC-GAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVG 262
            ++ C G  + G +G +YW NPG +         +  +F G  S  ++AAF+Y G E+  
Sbjct: 232 IVLSCGGGPQGGYLGGKYWHNPGSF-----VGHTSGTKFKGLCSVFVTAAFSYSGIEMTA 286

Query: 263 ITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSPF 320
           ++A E+ +PR+T+P+A  +                      ++P+L S  S +  +SSP 
Sbjct: 287 VSAAESKDPRRTIPKAAKRTFWLITASYITILTLIGCLVPYDEPRLLSGSSSVDAASSPL 346

Query: 321 VIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGI 380
           VIAIEN G K LP + NA+IL +IIS  NS VY  SR   +MA  G  P+ L    K G 
Sbjct: 347 VIAIENGGIKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGR 406

Query: 381 PYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQG 440
           P  A+L T   G L+++ +S   + VF WL  ++ ++  F W+ I+ISHIRF QA+K Q 
Sbjct: 407 PVNAILFTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQR 466

Query: 441 ISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFF 496
            S D+LP+ ++   WG++Y              T+  P          FF  Y+S  +  
Sbjct: 467 KSLDELPYLSQTGVWGSWYGVIVLFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILI 526

Query: 497 VFWIGFQIWFRGP-LFIKTEDIDLDTDRREIDDVVWEEQ 534
             ++G ++ +R   + +  ED+D+DT RR++D  +  ++
Sbjct: 527 ACYVGHKLVYRKKQIVVALEDMDIDTGRRQVDLTIRRQE 565

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  312 bits (800), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 182/532 (34%), Positives = 293/532 (55%), Gaps = 20/532 (3%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           G  K  ++K+ L+ RH+SMIA+GG++GTGL I   + LS AGP+  LIAY  +G + ++V
Sbjct: 51  GKHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFTV 110

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
              LGEMA +IP+   FT +  R+  PALG A GY Y   + +    +L+    ++Q+W 
Sbjct: 111 MSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169

Query: 155 D--AVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGK 212
               V    WI +F  ++   N+  VK++GE EFW++  KVL ++  +    ++V G G 
Sbjct: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGGP 229

Query: 213 T-GPVGFRYWRNPGPWGP--GIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAA 269
           +   +GFRYW++PG + P  G +S    +G+F+ + S  + A F Y GTEL GI A E  
Sbjct: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECK 289

Query: 270 NPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL---KSEDSYISSSPFVIAIEN 326
           NPR+ VPRAI                        NDP L   K   +  ++SP+V+AI+N
Sbjct: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIKN 349

Query: 327 SGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVL 386
           +G  VLPHIFNA +L+ + SA NS++YVGSR  Y +A++  APK    T   G+PY ++ 
Sbjct: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409

Query: 387 TTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDL 446
             ++   LAY+  SS A  +F++ +N+T++ G  +WI I I++I F +A + QGI ++ L
Sbjct: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469

Query: 447 PFKAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFKVSDFFTAYISVMLFFVFWIGFQI- 504
            ++A F P  A+ A             T F    F    F T YI + ++ + ++ ++I 
Sbjct: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529

Query: 505 ----WFRGP---LFIKTEDIDLDTDRREIDDVVWEEQKPRN--LWEKFWAAI 547
               W +     LF     IDL+ +  +++ +  +E++ ++   W++F+  I
Sbjct: 530 HKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYI 581

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  313 bits (802), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 186/537 (34%), Positives = 287/537 (53%), Gaps = 25/537 (4%)

Query: 29  VSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIG 88
           V + ++ +    ++K+ ++PRH+ MI LG  +GTGL +   T LS+AGP G +I Y  + 
Sbjct: 86  VEISAVDNQINEKLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMS 145

Query: 89  TLAYSVTQSLGEMA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVG 147
           T  Y V Q++GEMA  ++ +   F+ +    + P L  A  ++Y + W     LEL    
Sbjct: 146 TCIYCVMQAVGEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTAS 205

Query: 148 QIIQFWTDAVPLTAWIAIFWVILTISNLFP-VKYYGEVEFWIACIKVLAIVGFIIYAFIM 206
             IQ+WT  V    ++ IF++++   N+F   + Y E EF+    K+L + GF I   I+
Sbjct: 206 MTIQYWTTKVNADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGIIL 265

Query: 207 VCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITA 265
           +CG AG +G +G RYW +PG +       D    RF G VS+L++AAF + GTE + ITA
Sbjct: 266 ICGGAGNSGFIGARYWHSPGAF-----RGDNGINRFKGIVSTLVTAAFAFGGTEFLAITA 320

Query: 266 GEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIAI 324
            E ANPRK +P A  KV                     N  +L  S      +SP+VIA+
Sbjct: 321 SEQANPRKAIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSSGPATKASPYVIAV 380

Query: 325 ENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAA 384
            + G +V+PH  NAVIL ++ S  +S  Y  SR+  ++A  G APK  T+  K G P   
Sbjct: 381 ASHGIRVVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLG 440

Query: 385 VLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRD 444
            +  +++  +++   SS  + VFNWLL+I+ ++  FTW +IS+SHIRF +A+K QG S D
Sbjct: 441 FVVGAIIAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLD 500

Query: 445 DLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVS----DFFTAYISVMLFFVFWI 500
           ++ FK++   WG+ YA                 P  + S     FF AY+++ +F V + 
Sbjct: 501 EIGFKSQAGVWGSVYAFVMMILVLIGQFWVGIVPVGEDSADAVSFFQAYLAMPVFIVLYF 560

Query: 501 GFQIWFRG-PLFIKTEDIDLDTDRREID-DVVWEEQKP-----RN--LWEK---FWA 545
           G++IW R   LFI+ ++IDL   R   D +++ +E+K      RN  LW K   FW 
Sbjct: 561 GYKIWNRDWRLFIRAKNIDLIAHRHIYDPELLRQERKEMRERARNAPLWRKIYNFWC 617

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  312 bits (800), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 184/542 (33%), Positives = 286/542 (52%), Gaps = 19/542 (3%)

Query: 13  KDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPL 72
           K  ++ I     + D   +E +  +  T + + L  RH+  +A+GG IGTGL+++  T L
Sbjct: 58  KQTTNDITSSERSRDNDDVEQV-DINNTNLNKDLSVRHLLTLAVGGAIGTGLYVNTGTAL 116

Query: 73  SNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYW 132
           S  GP   +I ++ IGT  ++V  SLGE++   PV   F V+  RF+ P+   A    Y 
Sbjct: 117 STGGPASLVIDWVIIGTCLFTVINSLGELSAAFPVVGGFNVYGMRFVEPSFAFAVNLNYL 176

Query: 133 LSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIK 192
             W +   LEL      I++W D +   AW+AIF+  + ++N+  VK +GE EF ++ IK
Sbjct: 177 AQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIK 236

Query: 193 VLAIVGFIIYAFIMVC-GAGKTGPVGFRYWRNPGPWGPGIISKDVNEG-RFLGWVSSLIS 250
           +L+I+GF I   ++ C G    G +G +YWRNPG +         N G +F G  S  ++
Sbjct: 237 ILSIIGFSILGIVLSCGGGPHGGYIGGKYWRNPGAF------VGHNSGTKFKGLCSVFVT 290

Query: 251 AAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKS 310
           AAF+Y G E+  ++A E+ NPR+T+P+A  +                      NDP+L +
Sbjct: 291 AAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLN 350

Query: 311 EDSYI--SSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLA 368
             S +  +SSP VIAIEN   K LP + NA+IL  ++S  NS VY  SR   +MA  G  
Sbjct: 351 GSSSVDAASSPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNL 410

Query: 369 PKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISIS 428
           PK+L    K G P  A+L T   G L+++ +S+  + VF WL  ++ ++  F W+ I++S
Sbjct: 411 PKFLNRVDKRGRPMNAILLTLFFGLLSFVAASNKEAEVFTWLSALSGLSTIFCWMAINLS 470

Query: 429 HIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSD 484
           HIRF +A+K Q  S D+LPF ++    G++Y              T+  P          
Sbjct: 471 HIRFRKAMKVQERSLDELPFISQTGVLGSWYGFVVLFLVLIASFWTSLFPIGSSGASAES 530

Query: 485 FFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQ---KPRNLW 540
           FF  Y+S  +  V + G +I+ R   L +K EDIDLDT R+++D  +  E+   +  NL 
Sbjct: 531 FFEGYLSFPILIVCYFGHKIYTRNWTLMVKIEDIDLDTGRKQVDLTLRREEMKIERENLA 590

Query: 541 EK 542
           +K
Sbjct: 591 KK 592

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  312 bits (799), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 178/543 (32%), Positives = 287/543 (52%), Gaps = 20/543 (3%)

Query: 4   SKDYEATREKD---GSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTI 60
           + D   +++KD   GS      ++   +  +E     ++ +  + L  RH+  +A+GG I
Sbjct: 35  ADDRADSKQKDLMSGSETKALENLDSTSQEVED----QDARYNKDLSVRHLLTLAVGGAI 90

Query: 61  GTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLS 120
           GTGLF++    L+  GP   +I ++ I T  +++  +LGE+++  PV   F V+  RF+ 
Sbjct: 91  GTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPVVGGFNVYISRFVE 150

Query: 121 PALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKY 180
           P+ G A    Y   WA+   LEL      I++W   +   AW+AIF+ I+ ++NL  VK 
Sbjct: 151 PSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNHTINSDAWVAIFYTIILLANLLDVKS 210

Query: 181 YGEVEFWIACIKVLAIVGFIIYAFIMVC-GAGKTGPVGFRYWRNPGPWGPGIISKDVNEG 239
           +GE EF ++ +K+LAI+GF I   ++ C G  K G +G +YW NPG +  G  + D    
Sbjct: 211 FGETEFVLSMVKILAIIGFTILGIVLTCGGGPKGGYIGGKYWSNPGAF-VGHTAGD---- 265

Query: 240 RFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXX 299
           RF G  S  ++AAF+Y GTEL+ ++A E+ NPR T+P+A  +                  
Sbjct: 266 RFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLITVCYIVVLTLVGC 325

Query: 300 XXXXNDPKLKSEDSY--ISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSR 357
               +DP+L +  S   +++SP VIAIEN G K LP + NA+IL  ++S  NS VY  SR
Sbjct: 326 LVSSDDPRLLNGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSR 385

Query: 358 IAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVA 417
              SMA  G  PK  T+  + G P  A++ T + G L+++ +S     VF WL  ++ ++
Sbjct: 386 CMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFGLLSFIAASDKQEEVFTWLSALSGLS 445

Query: 418 GFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFA 477
             F W  I++SHIRF + +K +G + D+LPF +    WG+YY              T+  
Sbjct: 446 TLFCWFAINVSHIRFRRTMKERGRTLDELPFVSMTGVWGSYYGCIVIFIVLVVCFWTSLF 505

Query: 478 P----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWE 532
           P          FF  Y+S  +    + G +++ R   L   T++IDLD+ RR +D  + +
Sbjct: 506 PGGGEGANAESFFETYLSFPILLACYFGHKLYTRSWRLLTPTKEIDLDSGRRAVDLELMK 565

Query: 533 EQK 535
           ++K
Sbjct: 566 DEK 568

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  312 bits (799), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 182/509 (35%), Positives = 266/509 (52%), Gaps = 13/509 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSL 98
            + ++R LK RH+ MIA+GG IGTGLF+   + L   GP   LI +  IG + YSV  ++
Sbjct: 77  RSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAM 136

Query: 99  GEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFW-TDAV 157
           GE+A   PV   FT +  RF+  + G A  Y+Y L W +   LE+      + +W T A 
Sbjct: 137 GELAVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAK 196

Query: 158 PLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
               ++A+F+V++ I N+F VK YGE EF  + IKV  +VGFII   +++CG G  G   
Sbjct: 197 YRDGFVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYV 256

Query: 218 F-RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
             +YW NPG +     + D    RF    S  ++AAF++ GTELVG+ A E  NPRK +P
Sbjct: 257 GGKYWHNPGAF-----NGDNAGQRFKAVCSVFVTAAFSFAGTELVGLAAAETENPRKALP 311

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPHI 335
           RA  +V                         L    S   ++SPFV+AI+  G   LP +
Sbjct: 312 RAAKQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAASPFVLAIKTHGISGLPSV 371

Query: 336 FNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLA 395
            N VIL +++S GNS+VY  SR   ++A  G  P+  ++  + G P   +L T   G L 
Sbjct: 372 INVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCTFGLLC 431

Query: 396 YLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++  S     VFNWL+ ++ ++  FTW  I I H+RF +AL  QG S D+L F +    W
Sbjct: 432 FIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTSYVGVW 491

Query: 456 GAYYAAXXXXXXXXXXXXTAFAPKF---KVSDFFTAYISVMLFFVFWIGFQIWFRGPLFI 512
           G+Y+               A  P       SDFF AY+SV++   F++  +++ R   F 
Sbjct: 492 GSYFGVILICLVFIAQFWIAVWPMGGTPNASDFFQAYLSVVVVLFFYLAHKLYTRNWTFA 551

Query: 513 K-TEDIDLDTDRREID-DVVWEEQKPRNL 539
           K  +DID+DT RRE+D D + +E     L
Sbjct: 552 KRAKDIDIDTGRRELDLDALKQEIAEEKL 580

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  312 bits (799), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 190/535 (35%), Positives = 286/535 (53%), Gaps = 19/535 (3%)

Query: 8   EATREKDGSHLIIKPSIAE-DAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFI 66
           ++ RE++   L + P+++E D ++  +  S     ++  LK RH+ MIA+GG IGTGLF+
Sbjct: 52  DSFRERE--RLEVDPNMSELDQIAFRTANS----PLQHHLKNRHLQMIAIGGAIGTGLFV 105

Query: 67  SISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSA 126
              T L  AGP G LI +   GT+ YS+  +LGE+A   PV+  FT +  RF+  + G A
Sbjct: 106 GSGTALRTAGPAGILIGWGLTGTMIYSMVMALGELAVLFPVSGGFTTYATRFIDESYGFA 165

Query: 127 NGYLYWLSWAITFALELSVVGQIIQFW-TDAVPLTAWIAIFWVILTISNLFPVKYYGEVE 185
           N   Y L W +   LE+      + +W T+      ++A+FW+ + I NLF VK YGE E
Sbjct: 166 NNINYMLQWLVVLPLEIVAASITVNYWGTNPRYRDGFVALFWLAIFIINLFGVKGYGEAE 225

Query: 186 FWIACIKVLAIVGFIIYAFIMVCGAGKT-GPVGFRYWRNPGPWGPGIISKDVNEGRFLGW 244
           F  + IKV+ +VGFII   I+ CG G   G +G RYW +P     G    D    RF G 
Sbjct: 226 FIFSIIKVITVVGFIILGIILNCGGGPVKGYIGGRYWHHP----YGAFVGDSAGARFKGV 281

Query: 245 VSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXN 304
            S  ++AAF++ G+ELVG+ + E ANPRK+VP+A  +V                      
Sbjct: 282 CSVFVTAAFSFAGSELVGLASAETANPRKSVPKAAKQVFWRITLFYLLALGMVGLLVPYT 341

Query: 305 DPKLKSEDSY-ISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMA 363
           + +L    S   ++SPFVIAI   G + LP + N VIL  ++S GNS +Y  SR   ++A
Sbjct: 342 EKRLIGASSVDAAASPFVIAITTHGIRGLPSVVNVVILIAVLSVGNSAIYACSRTLCALA 401

Query: 364 MNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWI 423
                PK+  +  +SG P  ++L TS  G +A++  S     VFNWLL ++ ++  FTW 
Sbjct: 402 EQNFLPKFFGYIDRSGRPLYSILVTSGFGLVAFVAQSKKEGEVFNWLLALSGLSSLFTWG 461

Query: 424 LISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP---KF 480
            I + HIRF +AL  QG   D+L F +    +G+Y+               A  P   K 
Sbjct: 462 GICLCHIRFRKALSAQGRGTDELSFVSPAGVYGSYWGLFMIILMFIAQFYVALFPPGAKP 521

Query: 481 KVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREID-DVVWEE 533
               FF AY+S  +    ++G +I+ +   +FIK ED+D+DT R++ D D++ +E
Sbjct: 522 NAKAFFEAYLSFPIVIACYLGHKIYKKNWKIFIKAEDMDIDTGRKDDDLDLLRQE 576

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  313 bits (803), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 181/543 (33%), Positives = 281/543 (51%), Gaps = 35/543 (6%)

Query: 21  KPSIAED-------AVSMESLGSVK------------ETQVKRALKPRHISMIALGGTIG 61
           + ++AED       A+SM SL  V+            E  +K+++KPRH+ MI+LG  IG
Sbjct: 102 QHNLAEDLENDLTTAISMNSLDRVQNKPTGNGQMKFEEEALKKSIKPRHVVMISLGTGIG 161

Query: 62  TGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMAT-FIPVTSSFTVFTQRFLS 120
           TGL +  +  L NAGP G +I Y  +G+  Y + Q+ GEMA  +  +   F  +    + 
Sbjct: 162 TGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQAAGEMAVVYSNLLGGFNTYPSMLVD 221

Query: 121 PALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKY 180
           P  G A  ++Y L W     LEL      I++WT  V   A++ IF+V++    +F  + 
Sbjct: 222 PGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWTTTVNPDAFVVIFYVVIIFIQIFGARG 281

Query: 181 YGEVEFWIACIKVLAIVGFIIYAFIM-VCGAGKTGPVGFRYWRNPGPW-GPGIISKDVNE 238
           Y E EF+  C K+L I+GF I   I+   GAG  G +G +YW +PG + G   I      
Sbjct: 282 YAEAEFFFNCCKILMIIGFYILGIIINAGGAGNDGYLGAKYWHDPGAFRGTNGIQ----- 336

Query: 239 GRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXX 298
            RF G +++ +SAAF +  TE + +TA E +NPRK +P A  KV                
Sbjct: 337 -RFKGIMATFVSAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRVICIFVGTIALLG 395

Query: 299 XXXX-XNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSR 357
                 +D  + +  S   +SP+V+AI   G +V+PH  NAVIL ++ S  NS  Y  SR
Sbjct: 396 FLVPWDSDQLMGAGGSATKASPYVLAISIHGVRVVPHFINAVILISVFSVANSAFYSSSR 455

Query: 358 IAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVA 417
           +   +A  G APK+  +  + G P+ A+   ++ G +A+  +S     VF WLL I+ ++
Sbjct: 456 LLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVIAFCAASPKEDQVFTWLLAISGLS 515

Query: 418 GFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFA 477
             FTWI I +SHIRF +A+  QG S  ++ FKA+   +G+YYA              A A
Sbjct: 516 QLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGVYGSYYATIMMVLALIAQFWVAIA 575

Query: 478 P-----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVW 531
           P           FF  Y+++ +   F+ G+++W R   LFI+ +DIDLD+ R+  D+ + 
Sbjct: 576 PIGNNGDLDAEGFFENYLAMPILIAFYFGYKLWKRDWRLFIRAKDIDLDSYRQVFDEELL 635

Query: 532 EEQ 534
           +++
Sbjct: 636 KQE 638

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  312 bits (799), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 196/563 (34%), Positives = 288/563 (51%), Gaps = 25/563 (4%)

Query: 5   KDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGL 64
           K Y     +  S  II     E         S    ++K+ LK RHI +IALGGTIGT L
Sbjct: 59  KSYSQDELQTTSPTIIDSIDDEAEKEQGKERSSSNGELKQGLKSRHIQLIALGGTIGTSL 118

Query: 65  FISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTV-----FTQRFL 119
            +  S+ L+N GP G  I+Y+ I T  Y +  +LGEM  F+P   S +         +++
Sbjct: 119 LVGTSSALANCGPAGLFISYLIISTFVYPIMNALGEMVCFLPGNGSDSAGSAAHLVHKYV 178

Query: 120 SPALGSANGYLYWLSWAITFALELSVVGQIIQFWT--DAVPLTAWIAIFWVILTISNLFP 177
            P+LG A  + Y+  + I  A E+S    +I++W   + VP  AWI IF  ++ I N  P
Sbjct: 179 DPSLGFAASWNYYYCFVILVAAEVSAASGVIEYWAWAEHVPKGAWITIFLSLIVILNFLP 238

Query: 178 VKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG--KTGPVGFRYWRNPGPWGPGIISKD 235
           V  YGE EFW A IK+L I G II +FI+  G G    G +GFRYW+NPG +   I    
Sbjct: 239 VNVYGESEFWFASIKILCITGLIILSFILFWGGGPKSDGILGFRYWKNPGSFAHHITGG- 297

Query: 236 VNEGRFLGWVSSLISAAFTY-QGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXX 294
              G FL   + +I   F+   G ELV +T+ E A+ R+ + +A  +             
Sbjct: 298 -GGGNFLDIYTGIIKGGFSVILGPELVCLTSSECADQRRNIAKASKRFVWRLMFFYILGS 356

Query: 295 XXXXXXXXXNDPKLKS----EDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNS 350
                    NDP L++      +   SSPFVI I+N+G + +PHI N  IL++  SAGN+
Sbjct: 357 LSIGVIVAYNDPVLQNALAQSKAGAGSSPFVIGIQNAGIRAVPHIVNFCILTSAWSAGNA 416

Query: 351 NVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWL 410
            ++  SR   +MA NG APK      + G+PY AV  + +L  LAYL  SS  + VFNW 
Sbjct: 417 YMFASSRSLLTMARNGNAPKIFCRINQLGVPYTAVGASLLLSCLAYLNVSSSTADVFNWF 476

Query: 411 LNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXX 470
            NI+ ++GF  WI   +++IRF +A+ +  ++   +PF+AK   +  +Y+          
Sbjct: 477 SNISTISGFIGWICACVAYIRFRKAITYNKLTH-RIPFRAKGQQYTIWYSLFWVSLITLT 535

Query: 471 XXXTAFAPK-FKVSDFFTAYISVMLFFVFWIGFQIWFRGPL---FIKTEDIDLDTDRREI 526
                F P+ + V DF  AYI++ +F V WIG +++ R  L       + ID+ T   EI
Sbjct: 536 NGYAIFIPRNWNVKDFIAAYITLPIFIVLWIGHKVFTRTLLKAWLRPIDKIDVYTGLEEI 595

Query: 527 DDVVW----EEQKPRNLWEKFWA 545
           +++        Q P+N WEKF A
Sbjct: 596 EELTEELNANRQAPKNKWEKFMA 618

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  313 bits (801), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 177/525 (33%), Positives = 277/525 (52%), Gaps = 23/525 (4%)

Query: 19  IIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPV 78
           I +PS  +D           +  +K+ +KPRHI M++LG  IGTGL +  S  L+NAGP 
Sbjct: 129 IKQPSQEQDQ---------NQENLKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGPA 179

Query: 79  GALIAYMFIGTLAYSVTQSLGEMAT-FIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAI 137
           G +I Y  +G+  Y + Q+ GE+A  +  +   F  +    + PALG +  ++Y L W  
Sbjct: 180 GLVIGYAIMGSCIYCIIQACGELAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYCLQWLC 239

Query: 138 TFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIV 197
              LEL      I++WT  V    ++ IF+V++ + N+F  K Y E +F+  C K+L I+
Sbjct: 240 VCPLELVTASMTIKYWTVKVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMII 299

Query: 198 GFIIYAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQ 256
           GF I A I+ CG AG  G +G RYW NPG +       +    RF G V++ ++AAF + 
Sbjct: 300 GFFILAIIIDCGGAGTDGYIGSRYWHNPGAF-----RGNTGIQRFKGVVATFVTAAFAFG 354

Query: 257 GTELVGITAGEAANPRKTVPRAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI 315
            +E + +TA E +NPRK +P A  K +                     +D  L +  S  
Sbjct: 355 MSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLLGASGSAT 414

Query: 316 SSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWT 375
            +SP+VIA+ + G +V+PH  NAVIL +++S  N   Y  SRI  S+A  G APK   + 
Sbjct: 415 KASPYVIAVASHGVRVVPHFINAVILLSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYI 474

Query: 376 TKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQA 435
            + G P  A+L +S+ G +A+  SS     VF WLL I+ ++  FTWI I +SHIRF +A
Sbjct: 475 DREGRPAVAMLVSSIFGIIAFCASSPKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRA 534

Query: 436 LKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTAYI 490
           +K QG S  ++ +K++   WG+ YA              A +P     K     FF  Y+
Sbjct: 535 MKVQGRSLGEVGYKSQVGIWGSMYAIVMMVLALIAQFWVAISPIGGGGKLSAQSFFENYL 594

Query: 491 SVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQ 534
           ++ +    ++ +++W +   LFI  + IDL TDR+  D+ + +++
Sbjct: 595 AMPILIALYVFYKVWKKDWTLFIPADKIDLVTDRQIFDEELLKQE 639

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  311 bits (797), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 187/546 (34%), Positives = 285/546 (52%), Gaps = 23/546 (4%)

Query: 6   DYEATREKDGSH---------LIIKPSIAEDAVSMESLGSVK-ETQVKRALKPRHISMIA 55
           +Y  T E+ GS           +  P +  +    E +  +   T +K  LK RH+ MIA
Sbjct: 43  NYNQTGEEKGSKWRQFIDSFKRVEVPELDPNLTEQERIAIITAHTPLKHHLKSRHLQMIA 102

Query: 56  LGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFT 115
           +GG IGTGLF+   T L  AGP   +I +   G++ YS+  ++ EMA   P++  FT + 
Sbjct: 103 IGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAVAEMAVLYPISGGFTTYA 162

Query: 116 QRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFW-TDAVPLTAWIAIFWVILTISN 174
            RF+  + G AN + Y L W +   LE+      + +W T       ++A+FW+++ I N
Sbjct: 163 TRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTKYRDGFVALFWLVIVIIN 222

Query: 175 LFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGF-RYWRNPGPWGPGIIS 233
           LF VK YGE EF  + IKV+ +VGFII   ++VCG G TG     +YW +PG +      
Sbjct: 223 LFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGYVGAKYWHDPGAF-----V 277

Query: 234 KDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXX 293
                 +F G+ S  ++AAF++ G+EL+GI   EA NPRK VP A  +V           
Sbjct: 278 GATAGAQFQGFCSVFVTAAFSFSGSELIGIAGSEAENPRKAVPPAAKQVFWRILLFYILS 337

Query: 294 XXXXXXXXXXNDPKL-KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNV 352
                     ND +L  S +   ++SPFVIAI   G + LP + N VIL  ++S GNS +
Sbjct: 338 LLFIGLLVPSNDSRLIGSSNVDAAASPFVIAITVHGIRGLPSVINVVILIAVLSVGNSAI 397

Query: 353 YVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLN 412
           Y  SR   ++A  G  PK +++  +SG P   +  +S  G +A++  S     VFNWLL 
Sbjct: 398 YTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFFGLVAFVAQSDKEGDVFNWLLA 457

Query: 413 ITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXX 472
           I+ ++ FFTW  I + HIRF  ALK Q  S D+LPF +    +G+Y+             
Sbjct: 458 ISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVSPLGVFGSYWGLFLIVLMLAAQF 517

Query: 473 XTAFAP---KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREID- 527
             A  P       ++FF+AY+S+ +  V +I  ++W +   +FI    +DLDT R+++D 
Sbjct: 518 YVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKLWTKNWKIFIPLGQLDLDTGRKQLDL 577

Query: 528 DVVWEE 533
           D++ +E
Sbjct: 578 DLLRQE 583

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  311 bits (797), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 181/516 (35%), Positives = 274/516 (53%), Gaps = 13/516 (2%)

Query: 27  DAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMF 86
           D       G   + ++K+ +K RH+ MI+LG  IGTG+ +     L N GP G +I Y  
Sbjct: 81  DKEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAI 140

Query: 87  IGTLAYSVTQSLGEMA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSV 145
           +G+  Y + Q+ GE+A  +  ++  F  +    + PALG +  ++Y L W     LEL  
Sbjct: 141 MGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVT 200

Query: 146 VGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFI 205
               I++WT +V    ++AIF+V+    N+F  + Y E EF+    KVL I GF I   I
Sbjct: 201 ASITIKYWTTSVNPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMITGFFILGII 260

Query: 206 MVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGIT 264
           + CG AG  G +G +YW +PG +     S D     F G VS+L++AAF +  TE + +T
Sbjct: 261 VNCGGAGNDGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEFIALT 315

Query: 265 AGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIA 323
           A E ANPRK++P A  KV                     N  +L  S  S   +SP+VIA
Sbjct: 316 AAEQANPRKSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSATHASPYVIA 375

Query: 324 IENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYA 383
           I + G KV+PH  NAVIL +++S GNS  Y  SR+  S+A  G AP +L +  + G P  
Sbjct: 376 IASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREGRPTL 435

Query: 384 AVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISR 443
           A++ ++V G ++++ +S     VF WLL I+ ++  FTW  I +SHIRF +A+K QG S 
Sbjct: 436 AMIISAVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSL 495

Query: 444 DDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFW 499
            +L FK++   WG+YYA             TA AP    K     FF  Y+++ +    +
Sbjct: 496 GELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALY 555

Query: 500 IGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQ 534
            G+++W R   L+I    IDL ++RR  D+ V +++
Sbjct: 556 FGYKVWKRDWTLYIPASKIDLISNRRIFDEDVLKQE 591

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  312 bits (800), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 178/523 (34%), Positives = 278/523 (53%), Gaps = 18/523 (3%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97
           K+  +K+++KPRH  M++LG  IGTGL +  S  L+NAGP G +I Y  +G+  Y + Q+
Sbjct: 141 KQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQA 200

Query: 98  LGEMAT-FIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDA 156
            GE+A  +  +   F  +    + PALG +  +L+ L W     LEL      I++WT +
Sbjct: 201 CGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTTS 260

Query: 157 VPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGP 215
           V    ++ IF+V++ + N+F  K Y E +F+  C K+L IVGF I A I+ CG AG  G 
Sbjct: 261 VNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTDGY 320

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G +YWR+PG +       D    RF G V++ ++AAF +  +E + +TA E +NPRK +
Sbjct: 321 IGSKYWRDPGAF-----RGDTPIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAI 375

Query: 276 PRAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           P A  K +                     +D  L +  S   +SP+VIA+ + G +V+PH
Sbjct: 376 PSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPH 435

Query: 335 IFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFL 394
             NAVIL +++S  N   Y  SRI  S+A  G APK   +  + G P AA+L +++ G +
Sbjct: 436 FINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFGVI 495

Query: 395 AYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMP 454
           A+  SS     VF WLL I+ ++  FTWI I +SHIRF +A+K QG S  ++ +K++   
Sbjct: 496 AFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGV 555

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG- 508
           WG+ YA              A AP     K     FF  Y+++ ++   +I +++W +  
Sbjct: 556 WGSAYAVLMMVLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYIFYKVWKKDW 615

Query: 509 PLFIKTEDIDLDTDRREIDDVVW----EEQKPRNLWEKFWAAI 547
            LFI  + +DL + R   D+ +     EE K R     +W  +
Sbjct: 616 SLFIPADKVDLVSHRNIFDEELLKQEDEEYKERLRNGPYWKRV 658

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  310 bits (794), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 176/511 (34%), Positives = 272/511 (53%), Gaps = 16/511 (3%)

Query: 25  AEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAY 84
           ++D V  E    +  T + + L  RH+  +A+GG IGTGLF++    LS  GP   +I +
Sbjct: 72  SDDDVQQED---INNTNLSKELSVRHLLTLAVGGAIGTGLFVNTGAALSTGGPASLVIDW 128

Query: 85  MFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELS 144
           + I T  ++V  SLGE++   PV   F V++ RF+ P+   A    Y   W +   LEL 
Sbjct: 129 VIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELV 188

Query: 145 VVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAF 204
                I++W D +   AW+AIF+  + ++N+  VK +GE EF ++ IK+LAI+GF I   
Sbjct: 189 AASITIKYWNDKINSDAWVAIFYATIAMANMLDVKSFGETEFVLSMIKILAIIGFTILGI 248

Query: 205 IMVC-GAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGI 263
           ++ C G    G +G +YW +PG +    +  D +  +F G  S  ++AAF+Y G E+  +
Sbjct: 249 VLSCGGGPHGGYIGGKYWNDPGAF----VGHD-SGTKFKGLCSVFVTAAFSYSGIEMTAV 303

Query: 264 TAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSPFV 321
           +A E+ NPR+T+P+A  +                      NDP+L +  S +  +SSP V
Sbjct: 304 SAAESKNPRETIPKAAKRTFWLITISYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLV 363

Query: 322 IAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIP 381
           IAIEN   K LP + NA+IL  ++S  NS VY  SR   +MA  G  PK+L    K G P
Sbjct: 364 IAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLRRVDKRGRP 423

Query: 382 YAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGI 441
             A++ T   G L+++ +S   + VF WL  ++ ++  F W+ I++SHIRF QA+K Q  
Sbjct: 424 INAIVLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKFQER 483

Query: 442 SRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFV 497
           S D+LPF ++   WG+ Y              T+  P          FF  Y+S  +  V
Sbjct: 484 SLDELPFISQTGVWGSIYGFVVLFLVLIASFWTSMFPIGSSGANAESFFEGYLSFPILIV 543

Query: 498 FWIGFQIWFRG-PLFIKTEDIDLDTDRREID 527
            + G +I+ R   L +K ED+DLDT R+++D
Sbjct: 544 CYFGHKIYTRDWRLLVKLEDMDLDTGRKQVD 574

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  311 bits (798), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 178/523 (34%), Positives = 275/523 (52%), Gaps = 18/523 (3%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97
           K+  +K+++KPRH  M++LG  IGTGL +  S  L+NAGP G +I Y  +G+  Y + Q+
Sbjct: 141 KQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQA 200

Query: 98  LGEMAT-FIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDA 156
            GE+A  +  +   F  +    + PA+G +  +L+ L W     LEL      I++WT  
Sbjct: 201 CGELAVIYSDLIGGFNTYPSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVK 260

Query: 157 VPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGP 215
           V    ++ IF+V++ + N+F  K Y E +F+  C K+L I GF I A I+ CG AG  G 
Sbjct: 261 VNADVFVIIFYVLILVINIFGAKGYAEADFFFNCCKILMITGFFILAIIIDCGGAGTDGY 320

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G RYWR+PG +       D +  RF G V++ ++AAF +  +E + +TA E +NPRK +
Sbjct: 321 IGSRYWRDPGAF-----RGDTSIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAI 375

Query: 276 PRAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           P A  K +                     +D  L +  S   +SP+VIA+ + G +V+PH
Sbjct: 376 PSAAKKMIYRILFVFLASLALVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPH 435

Query: 335 IFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFL 394
             NAVIL +++S  NS  Y  SRI  S+A  G APK   +  + G P  A++ ++V G +
Sbjct: 436 FINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMIVSAVFGVI 495

Query: 395 AYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMP 454
           A+  SS     VF WLL I+ ++  FTWI I +SHIRF + +K QG S  ++ +K++   
Sbjct: 496 AFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEVGYKSQVGV 555

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG- 508
           WG+ YA              A +P     K     FF  Y+++ +    +I +++W R  
Sbjct: 556 WGSAYAVVLMVLALIGQFWVAISPIGGDKKLSAQSFFENYLAMPILIALYIFYKVWKRDW 615

Query: 509 PLFIKTEDIDLDTDRREIDDVVW----EEQKPRNLWEKFWAAI 547
            LFI  + IDL + R   D+ +     EE K R     FW  +
Sbjct: 616 SLFIPADKIDLVSHRNIFDEELLKQEDEEYKDRLRNGPFWKRV 658

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  311 bits (797), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 179/523 (34%), Positives = 274/523 (52%), Gaps = 18/523 (3%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97
           K+  +K+++KPRH  M++LG  IGTGL +  S  L+NAGP G +I Y  +G+  Y + Q+
Sbjct: 141 KQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQA 200

Query: 98  LGEMAT-FIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDA 156
            GE+A  +  +   F  +    + PALG +  +L+ L W     LEL      I++WT  
Sbjct: 201 CGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVK 260

Query: 157 VPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGP 215
           V    ++ IF+V++ + N+F  K Y E +F+  C K+L I+GF I A I+ CG AG  G 
Sbjct: 261 VDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGY 320

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G +YWR+PG +       D    RF G V++ ++AAF +  +E + +TA E +NPRK +
Sbjct: 321 IGSKYWRDPGAF-----RGDTPIQRFKGIVATFVTAAFAFGMSEQLAMTASEQSNPRKAI 375

Query: 276 PRAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           P A  K +                     +D  L +  S   +SP+VIA+ + G +V+PH
Sbjct: 376 PSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPH 435

Query: 335 IFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFL 394
             NAVIL +++S  NS  Y  SRI  S+A  G APK   +  + G P  A+L +++ G +
Sbjct: 436 FINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSALFGVI 495

Query: 395 AYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMP 454
           A+  SS     VF WLL I+ ++  FTWI I +SHIRF +A+K QG S  ++ +K++   
Sbjct: 496 AFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGV 555

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG- 508
           WG+ YA              A AP     K     FF  Y+++ +    +I F++W    
Sbjct: 556 WGSAYAVLMMMLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPILIALYIFFKVWKNDW 615

Query: 509 PLFIKTEDIDLDTDRREIDDVVW----EEQKPRNLWEKFWAAI 547
            LFI    +DL + R   D+ +     EE K R     +W  I
Sbjct: 616 SLFIPANKVDLVSHRNIFDEELLKQEDEEYKERLRNGPYWKRI 658

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  309 bits (792), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 189/521 (36%), Positives = 278/521 (53%), Gaps = 20/521 (3%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSL 98
            + +K  LK RH+ MIA+GG IGTGLF+     L  AGP G LI +   GT+ YS+  ++
Sbjct: 84  RSPLKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTGTMIYSMVMAV 143

Query: 99  GEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFW-TDAV 157
           GE+A   PV+  FT +  RF+  + G A  + Y L W IT  LE+      + +W  DA 
Sbjct: 144 GELAVVFPVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSASITVNYWGVDAK 203

Query: 158 PLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
               ++A+FWV   I NLF VK YGE EF  A IKV+ I+GFII A I++CG G  G   
Sbjct: 204 YRDGFVALFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVILICGGGPVGGYI 263

Query: 218 F-RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
             +YW +PG +       D    +F G+ +  I+A+F++ G+E+VG+   E+ NPRK+VP
Sbjct: 264 GAKYWHHPGAF-----VGDTAGQKFKGFCTVFITASFSFGGSEVVGVAGSESENPRKSVP 318

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPHI 335
            A  +V                     ND +L    S   ++SPFVIA+ N G + LP +
Sbjct: 319 GAAKQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASSVDAAASPFVIAVVNQGIRGLPSV 378

Query: 336 FNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLA 395
            N VIL +++S GNS++Y+ SR   ++A  G  PK + +  ++G P  A+   S  G +A
Sbjct: 379 INVVILISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAIGIASAFGLIA 438

Query: 396 YLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++  SS    VFNWLL ++ ++  F+W  I I HIRF +AL  QG S D+LPF +     
Sbjct: 439 FVAESSHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRSTDELPFVSTVGIA 498

Query: 456 GAYYAAXXXXXXXXXXXXTAFAPKF---KVSDFFTAYISVMLFFVFWIGFQIWFRG-PLF 511
           G+Y+                  P        DFF AY+S  +   F+I  +IW +   L+
Sbjct: 499 GSYWGIFICVLMLIAQFYVGLFPAGASPNAKDFFMAYLSFPIVLAFYIFHKIWKKNWKLY 558

Query: 512 IKTEDIDLDTDRREIDDVVWEEQ--------KPRNLWEKFW 544
           IK ED+D+DT RRE+D  + +++          R +W + W
Sbjct: 559 IKAEDMDIDTGRREVDRDLLKQEVAAERADLAARPIWYRCW 599

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  309 bits (792), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 188/523 (35%), Positives = 273/523 (52%), Gaps = 24/523 (4%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSL 98
           +T +K  LK RH+ MIA+GG IGTGL +   T L   GP   LI +   GT+ YS+  +L
Sbjct: 83  QTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMVMAL 142

Query: 99  GEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFW-TDAV 157
           GE+A   P++  FT +  RF+  + G AN + Y L W +   LE+      + FW TD  
Sbjct: 143 GELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPK 202

Query: 158 PLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
               ++A+FW+++ I N+F VK YGE EF  + IKV+ +VGFII   I+ CG G  G   
Sbjct: 203 YRDGFVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYI 262

Query: 218 F-RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
             +YW +PG +     + D    +F G  S  +++AF++ G+ELVG+ A E+ +PRK+VP
Sbjct: 263 GGKYWHDPGAF-----AGDTPGAKFKGLCSVFVTSAFSFAGSELVGLAASESVDPRKSVP 317

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPHI 335
           +A  +V                     NDP L    S   ++SPFVIAI+  G K LP +
Sbjct: 318 KAAKQVFWRITLFYILSLLMVGLLVPYNDPNLIGASSVDAAASPFVIAIKTHGIKGLPTV 377

Query: 336 FNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLA 395
            N VIL  ++S GNS +Y  SR   ++A     P+   +  + G P   +  TS  G +A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSAFGLIA 437

Query: 396 YLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++ +S     VFNWLL ++ ++  FTW  I I HIRF +AL  QG   D+L FK+    W
Sbjct: 438 FVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVW 497

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP---KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLF 511
           G+Y+               A  P         FF AY+S  L    ++G +I+ R   LF
Sbjct: 498 GSYWGLFMVVIMFIAQFYVALFPVGASPSAEGFFEAYLSFPLVVAMYLGHKIYKRNWKLF 557

Query: 512 IKTEDIDLDTDRREID-----DVVWEEQ-----KPRNLWEKFW 544
           I  ED+D+DT RRE+D       + EE+     KP+  W + W
Sbjct: 558 IPAEDMDIDTGRREVDLELLKQEIAEEKAIMATKPK--WYRIW 598

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  308 bits (789), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 181/559 (32%), Positives = 293/559 (52%), Gaps = 30/559 (5%)

Query: 7   YEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFI 66
           ++   + +  + I K  I  + +  +        Q+++ ++PRH+ MI+LG  IGTGL +
Sbjct: 47  FKKIDDNNNQYEIEKNEI--NNIKSDQFNDKLNNQLQKTIQPRHVIMISLGTGIGTGLLV 104

Query: 67  SISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMA-TFIPVTSSFTVFTQRFLSPALGS 125
                L NAGP G LI Y+ + +  Y + Q+ GEMA  ++ +   F  +    +  A   
Sbjct: 105 GNGATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNF 164

Query: 126 ANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFP-VKYYGEV 184
           A  ++Y + W     LEL      I++W + V    ++ IF++++   NLF   + Y E 
Sbjct: 165 AVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEA 224

Query: 185 EFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPVGFRYWRNPGPW---GPGIISKDVNEGR 240
           EF+    K+L I GF I   I++CG AG +G +G  YW NPG +    PG         R
Sbjct: 225 EFFFNLCKILMIAGFFILGIILICGGAGTSGYIGVSYWNNPGAFRGHTPGT--------R 276

Query: 241 FLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXX 300
           F G VS+L++AAF++  TE + ITA E +NPRK +P A  KV                  
Sbjct: 277 FKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFL 336

Query: 301 XXXNDPKL-KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIA 359
              N P+L  S+ S   +SP+VIA+ + G ++ PH  NAVIL +++S  NS+ Y  SR+ 
Sbjct: 337 VPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRML 396

Query: 360 YSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGF 419
            ++A  G APK  T+  + G P   ++  S+L  +A+  SS   + VF+WLL I+ ++  
Sbjct: 397 LTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQV 456

Query: 420 FTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP- 478
           FTW  I +SHIRF +A+K QG S ++L +K++   WG+ YAA             A  P 
Sbjct: 457 FTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPL 516

Query: 479 ---KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQ 534
                 +++FF  Y+++ +  +F+ G++ W +   LFI+ +DIDL + R   D+ V +++
Sbjct: 517 NSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQE 576

Query: 535 KPR--------NLWEKFWA 545
           K +        +LW K +A
Sbjct: 577 KNQYKENLKNGSLWLKIYA 595

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  308 bits (790), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 176/538 (32%), Positives = 286/538 (53%), Gaps = 23/538 (4%)

Query: 12  EKDGSHLIIKPSIAEDA-VSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISIST 70
           E D + ++   S+ +DA V +  +      ++K+ ++PRH+ M++LG  IGTGL +   T
Sbjct: 68  ETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSLGTGIGTGLLVGNGT 127

Query: 71  PLSNAGPVGALIAYMFIGTLAYSVTQSLGEMA-TFIPVTSSFTVFTQRFLSPALGSANGY 129
            L++AGP G +I Y  + +  Y + Q++GEMA  ++ +   F  +    + PAL  +  +
Sbjct: 128 TLAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAW 187

Query: 130 LYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFP-VKYYGEVEFWI 188
           +Y + W     LEL      IQ+WT  V    ++ IF++++   N+F   + Y E EF  
Sbjct: 188 IYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFIC 247

Query: 189 ACIKVLAIVGFIIYAFIMVCG-AGKTGPVGFRYWRNPGPW----GPGIISKDVNEGRFLG 243
              K+L ++GF I   +++CG AG  G +G +YWR+PG +    GP          RF G
Sbjct: 248 NSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPN---------RFKG 298

Query: 244 WVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXX 303
            VS+L++AAF++  TE + ITA E +NPRK +P A  KV                     
Sbjct: 299 VVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPY 358

Query: 304 NDPKL-KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSM 362
           +  +L  S  +   +SP+V+A+   G +V+PH  NAVIL ++ S  +S  Y  SR+  ++
Sbjct: 359 DSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTL 418

Query: 363 AMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTW 422
           A  G APK  T+  ++G P    L  +V+  +A+   SS  + VFNWLL I+ ++  FTW
Sbjct: 419 ARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTW 478

Query: 423 ILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP---- 478
            LI +SHIRF +A+K QG S D++ +K++   WG+ YA                 P    
Sbjct: 479 ALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEG 538

Query: 479 KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQK 535
              V  FF  Y+++ +F V ++G++IW R   LFI+ +DIDL + R   D  +  +++
Sbjct: 539 SADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQER 596

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  308 bits (789), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 186/533 (34%), Positives = 278/533 (52%), Gaps = 13/533 (2%)

Query: 10  TREKDGSHLIIKPSIAEDAVSMESLG-SVKETQVKRALKPRHISMIALGGTIGTGLFISI 68
           TR KD      K  +  +    E +  +  +  +K  LK RH+ M+A+GG IG+GLF+  
Sbjct: 62  TRIKDSFKRAEKEEVDPNLTEAERIAINTAKAPLKHTLKGRHMQMVAIGGAIGSGLFVGS 121

Query: 69  STPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANG 128
           ST L  AGP G +I +    T+ Y +  +LGE+A   PV+  FT +  RF+  + G A+ 
Sbjct: 122 STALRTAGPAGIVIGWGLTSTMIYCMVMALGELAVVFPVSGGFTTYATRFIDESFGFASN 181

Query: 129 YLYWLSWAITFALELSVVGQIIQFW-TDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFW 187
           + Y L W  T  LE+      + +W T       ++A+FW+++ I NLF V+ +GE EF 
Sbjct: 182 FNYALQWLATLPLEIVSASITVNYWQTPERYRDGFVALFWLVIVIINLFGVRGFGEAEFV 241

Query: 188 IACIKVLAIVGFIIYAFIMVCGAGKTGPVGF-RYWRNPGPWGPGIISKDVNEGRFLGWVS 246
            + IKVL ++GFII   ++V G G  G     RYW NPG +       D    +F G  S
Sbjct: 242 FSTIKVLTVIGFIILGIVLVAGGGPEGGFVGGRYWHNPGAF-----VGDNAGTQFKGVCS 296

Query: 247 SLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDP 306
             ++AAF++ G+ELVGITA EAANPRK+VPRA  +V                      DP
Sbjct: 297 VFVTAAFSFAGSELVGITAAEAANPRKSVPRAAKQVVWRIVLFYMGSLIMIGLLVPYTDP 356

Query: 307 KLKSEDSY-ISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMN 365
           +L    S   S+SPFVIAI   G + LP + N VIL  ++S GNS ++ GSR   +++  
Sbjct: 357 RLIGASSVDASASPFVIAIVTHGIRGLPSVINVVILIAVLSVGNSAIFAGSRTIAALSEQ 416

Query: 366 GLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILI 425
           G  P+   +  + G P   ++  S  G +A++ +S     VF WL+ ++ ++  FTW  I
Sbjct: 417 GFLPEIFGYIDRKGRPLVGIIVISTFGLIAFIAASKKQGEVFAWLMALSGLSSLFTWGGI 476

Query: 426 SISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP---KFKV 482
            + HIRF  ALK QG S ++LPF +     G+ +               A  P   K   
Sbjct: 477 CLCHIRFRMALKAQGRSTNELPFVSPAGIIGSSWGLFMLLLMFIAQFYVALFPPGSKPSA 536

Query: 483 SDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQ 534
             FF +Y+S  +   F+ G +I+ +   LFIK ED+D+DT RRE D  + +++
Sbjct: 537 EVFFESYLSFPIVLAFYFGHKIYKKNWKLFIKAEDMDIDTGRRETDLELLKQE 589

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  308 bits (788), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 173/506 (34%), Positives = 269/506 (53%), Gaps = 13/506 (2%)

Query: 37  VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQ 96
           +  T + + L  RH+  +A+GG IGTGL+++    LS  GP   +I ++ I T  ++V  
Sbjct: 81  INNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVIN 140

Query: 97  SLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDA 156
           SLGE++   PV   F V++ RF+ P+   A    Y   W +   LEL      I++W D 
Sbjct: 141 SLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDK 200

Query: 157 VPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVC-GAGKTGP 215
           +   AW+AIF+  + ++N+  VK +GE EF ++ IK+L+I+GF I   ++ C G    G 
Sbjct: 201 INSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGY 260

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G +YW +PG +         +  +F G  S  ++AAF+Y G E+  ++A E+ NPR+T+
Sbjct: 261 IGGKYWHDPGAF-----VGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETI 315

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSPFVIAIENSGTKVLP 333
           P+A  +                      NDP+L +  S +  +SSP VIAIEN G K LP
Sbjct: 316 PKAAKRTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGLP 375

Query: 334 HIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGF 393
            + NA+IL  ++S  NS VY  SR   +MA  G  PK+L    K G P  A+L T   G 
Sbjct: 376 SLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGL 435

Query: 394 LAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFM 453
           L+++ +S   + VF WL  ++ ++  F W+ I++SHIRF QA+K Q  S D+LPF ++  
Sbjct: 436 LSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQTG 495

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG- 508
             G++Y              T+  P          FF  Y+S  +  V + G +I+ R  
Sbjct: 496 VKGSWYGFIVLFLVLIASFWTSLFPLGSSGANAESFFEGYLSFPILIVCYFGHKIYTRNW 555

Query: 509 PLFIKTEDIDLDTDRREIDDVVWEEQ 534
            L +K EDIDLDT R+++D  +  E+
Sbjct: 556 TLMVKLEDIDLDTGRKQVDLALRREE 581

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  306 bits (785), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 180/548 (32%), Positives = 282/548 (51%), Gaps = 12/548 (2%)

Query: 5   KDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGL 64
           +++   +E   +    + S +        + S  E  +K+ L  RHI +IALGG IGTGL
Sbjct: 14  QEFNGMKEVKSNEETYRTSHSNLESQNSDVVSDYEHNLKKGLSNRHIQLIALGGCIGTGL 73

Query: 65  FISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALG 124
           F+  S+ L+  GP    ++++ I T+ Y +  +L EM  ++P   S      R++ P+LG
Sbjct: 74  FVGTSSTLTQCGPAPLFLSFIIISTMVYCIMCTLAEMVCYLPQQGSVPELVTRYVDPSLG 133

Query: 125 SANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEV 184
            A G+ Y  S+A+  A EL+    I+++WTD VP   WI IF +++ + N   V++YGE 
Sbjct: 134 FAAGWNYAYSYAMLVATELTAAAGIVRYWTDQVPQGVWITIFLIVVVVLNFSAVRFYGES 193

Query: 185 EFWIACIKVLAIVGFIIYAF-IMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLG 243
           EFW A +K++ I+  ++ +  I   GA     VGFRYWRNPG +G  I     N GRFL 
Sbjct: 194 EFWFASLKIICILALLVVSIVIFFGGAPNHDRVGFRYWRNPGAFGYHITGG--NLGRFLD 251

Query: 244 WVSSLISAAFTY-QGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXX 302
             +++I +AF +    ELVG+   EA + R+ + +A  +                     
Sbjct: 252 LWTAIIKSAFAFILSPELVGLACVEAKDTRRNIEKASRRFIYRIIFFYLSSSLMIGVIVA 311

Query: 303 XNDPK----LKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRI 358
            ND      L+      +SSPFV  I NSG  VL H+ N  IL++  SAGNS  Y  SR 
Sbjct: 312 KNDHNLLLALEENRPGAASSPFVQGIANSGIPVLNHVINVAILTSAWSAGNSFFYASSRS 371

Query: 359 AYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAG 418
             +++  G APK  +   + G+PY AV   S++  LAYL  SS +S VF WL NI  ++G
Sbjct: 372 ILALSKQGDAPKIFSKINRFGVPYNAVFLCSLVACLAYLNVSSTSSKVFQWLSNICTISG 431

Query: 419 FFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP 478
           F  W LI +++IRF +A+    +  D +P+++   P+ AY+                F  
Sbjct: 432 FIGWFLIGVAYIRFRKAILFNRL-LDRIPYRSPLQPFSAYFFTIVVAIITLTNGYVVFIK 490

Query: 479 -KFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEE--QK 535
            ++   DF T+YIS+ +F  F++G +  ++    I  + ID+ T   E ++       + 
Sbjct: 491 GRWDYKDFLTSYISLPIFLAFYLGHKTIYKTRFCIPVDQIDVITGLEEAEEEAKLSVVRV 550

Query: 536 PRNLWEKF 543
           P+N WEKF
Sbjct: 551 PKNAWEKF 558

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  307 bits (786), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 195/562 (34%), Positives = 287/562 (51%), Gaps = 38/562 (6%)

Query: 6   DYEA-TREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGL 64
           D E+ TREK      I  S +   V  E  G     ++K+ L  RH+  IALGGTIGTGL
Sbjct: 32  DLESLTREK------ITRSDSSSEVEAEGNG-----KLKQGLSSRHVQFIALGGTIGTGL 80

Query: 65  FISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIP-----VTSSFTVFTQRFL 119
           F+  S  L   GP G +I+Y+ I T+ Y +  +LGEM  ++P        S      R++
Sbjct: 81  FVGTSVTLKTVGPGGLVISYIIISTVIYPIMNALGEMVCYLPGNGEDSAGSVAHLVGRYV 140

Query: 120 SPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVK 179
             +L  A G+ Y+  + I  A E +    ++ +WT +VP   WI IF  I+T+ N   VK
Sbjct: 141 DKSLAFATGWNYYYCFVILVAAECTAASGVVTYWTTSVPTAVWITIFLGIVTLLNFSAVK 200

Query: 180 YYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG-PVGFRYWRNPGPWGPGIISKDVNE 238
           Y+GE EFW A IK+L I+G I+ +FI+  G G +   +GF YW++PG +   I     + 
Sbjct: 201 YFGETEFWFASIKILCILGLILVSFILFWGGGPSHVRLGFHYWKDPGTFAHHITGG--SW 258

Query: 239 GRFLGWVSSLISAAFTY-QGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXX 297
           G FL   + +I  AF +  G ELV +T+ E  + R+ + +A  +                
Sbjct: 259 GSFLDIYTGIIKGAFAFILGPELVALTSSECNDQRRNIAKASKRFIWRLMFFYILGTLSI 318

Query: 298 XXXXXXNDP----KLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVY 353
                 NDP     L+      +SSPFVI I+N+G KVLPHI NA ILS+  SAGNS ++
Sbjct: 319 SVIVAYNDPVLLNALEEGKEGAASSPFVIGIQNAGIKVLPHIINACILSSAWSAGNSFMF 378

Query: 354 VGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNI 413
             SR   +MA NG APK      + G+PY +V  +++L  LA+L  SS  + VF+W  NI
Sbjct: 379 ASSRSLMTMAHNGSAPKIFCKVNRFGVPYYSVGLSAMLSCLAFLNVSSSTAQVFDWFSNI 438

Query: 414 TAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXX 473
           + ++GF  WI   I+++RF +A+ +  +  D LPFK    P+  +Y+             
Sbjct: 439 STISGFLGWICAIIAYLRFRKAIFYNNM-YDRLPFKTFGQPYLIWYSLLVISVITLTNGY 497

Query: 474 TAFAPKF-KVSDFFTAYISVMLFFVFWIGFQIWFRG-------PLFIKTEDIDLDTDRRE 525
             F P+F   SDF  AYI++ LF + W+G + W R         L+   ++ID+ T   E
Sbjct: 498 QTFIPRFWSGSDFVAAYITLPLFLILWVGHKFWARYKHAVPLLKLYYPVDEIDVITGLAE 557

Query: 526 IDDVV----WEEQKPRNLWEKF 543
            ++V          P   W KF
Sbjct: 558 AEEVAEKLDMNRIPPSTYWGKF 579

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  307 bits (786), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 187/522 (35%), Positives = 273/522 (52%), Gaps = 16/522 (3%)

Query: 22  PSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGAL 81
           P    D  S++   + K  ++K+ ++PRH+ MI+LG  IGTGL +     L N GP G  
Sbjct: 71  PGRENDQESLQD--NNKHEKLKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGPGGLA 128

Query: 82  IAYMFIGTLAYSVTQSLGEMATFIPVTSS-FTVFTQRFLSPALGSANGYLYWLSWAITFA 140
           + +  +GT  Y V Q+ GEMA   P  S  F  +    + P  G A  +LY + W   F 
Sbjct: 129 VGFFVMGTCVYCVIQAAGEMAVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWLCVFP 188

Query: 141 LELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFI 200
           LEL      I++WT A+    ++A+F++++ + N F  + Y E EF+    KVL I+GF 
Sbjct: 189 LELVTASITIKYWTTAINPDIFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMIIGFF 248

Query: 201 IYAFIMVCGA-GKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTE 259
           I   ++  GA G  G +G +YWR PG +G G  + D     F G VS+L++AAF+   +E
Sbjct: 249 IVGILVNTGAAGNDGYIGAKYWREPGSFG-GHTAID----HFKGVVSTLVNAAFSLGCSE 303

Query: 260 LVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK-SEDSYISSS 318
            V +TA E ANPRK+VP A  K+                     N  +L  S DS +  S
Sbjct: 304 FVALTAAEQANPRKSVPSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDSSVHVS 363

Query: 319 PFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKS 378
           P+VIA+ + G +V+PH  NAVIL +++S GNS  Y  SR+  S+A  G AP    +  + 
Sbjct: 364 PYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQ 423

Query: 379 GIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKH 438
           G P  A++ +  +G L ++ +S     VF WLL I+ ++  FTW  I ISHIRF +AL  
Sbjct: 424 GRPLMAMMVSITMGCLCFVAASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRKALLV 483

Query: 439 QGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVML 494
           QG   D L FKA+   WG+YY+A            T   P    K     FF  Y++  +
Sbjct: 484 QGRGWDGLGFKAQTGVWGSYYSAVIMILTFIAQFWTCLIPMGSSKPNAESFFEGYLAFPI 543

Query: 495 FFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREID-DVVWEEQ 534
           F   + G++I+ +   LFI  E IDLD  R+  D DV+ +E 
Sbjct: 544 FVALYFGYKIYNKNWQLFIPAEKIDLDLHRKIFDADVLKQED 585

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  308 bits (788), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 180/545 (33%), Positives = 283/545 (51%), Gaps = 25/545 (4%)

Query: 6   DYEATREKDGSHLIIKPSIAEDAVSMESLGSVK-------ETQVKRALKPRHISMIALGG 58
           DYE   E       I  S++  A ++  L  ++          +K+ ++PRH+ MI+LG 
Sbjct: 92  DYEQALENG-----ITTSVSPSAPNLRKLNQLRTPTDANDNKALKQTIRPRHVVMISLGT 146

Query: 59  TIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMA-TFIPVTSSFTVFTQR 117
            IGTGL +   T L NAGP G +I Y  +G++ Y + Q+ GEMA  +  +   + V+   
Sbjct: 147 GIGTGLLVGNGTALKNAGPAGLVIGYSIMGSIIYCIIQATGEMAIAYSNLPGGYNVYPSF 206

Query: 118 FLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFP 177
            +    G A  ++Y + W     LEL      I++WT +V    ++AIF+ ++ I N+F 
Sbjct: 207 LVEKGFGFAIAWVYCIQWLTVCPLELVTASLTIKYWTTSVNSDIFVAIFYALIIIINVFG 266

Query: 178 VKYYGEVEFWIACIKVLAIVGFIIYAF-IMVCGAGKTGPVGFRYWRNPGPWGPGIISKDV 236
            K Y E EF+  C KVL ++GF I +  I   GAG  G +G  YW  PG +       D 
Sbjct: 267 AKGYAEAEFFCNCCKVLMMIGFFILSITITAGGAGNDGYLGGLYWHTPGAF-----RGDS 321

Query: 237 NEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXX 296
           +   F G   +L++AAF Y GTE + +TA E +NPR  +P A  KV              
Sbjct: 322 SIDHFKGICGTLVTAAFAYGGTEFLALTAAEQSNPRAAIPSAAKKVLYRIICVYLISILM 381

Query: 297 XXXXXXXNDPKLKSED-SYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVG 355
                  +  +L   D S  S+SP+V+A    G +V+PH  NAVIL +++S GNS  Y  
Sbjct: 382 IGFLVPFDSTRLLGSDGSATSASPYVLAASLHGVRVVPHFINAVILISVLSVGNSAFYSS 441

Query: 356 SRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITA 415
           SR+  S+A  G APK+  +  + G P  A+L +++ G +A+  +S   + VF WLL I+ 
Sbjct: 442 SRLLMSLARQGYAPKWFDYIDREGRPARAMLMSALFGVIAFCAASPKETEVFTWLLAISG 501

Query: 416 VAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTA 475
           ++  FTW  I +SHIRF  A+K QG S  ++ + A+   WG++YA              A
Sbjct: 502 LSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGYLAQTGVWGSWYALFMMFLIYIAQFWVA 561

Query: 476 FAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVV 530
            AP    +    +FF  Y+++ +  V ++G++I+++   L IK EDIDL + R+  D+ +
Sbjct: 562 IAPIGSGELSAQNFFENYLAMPILIVLYLGYKIYYKDWTLLIKAEDIDLQSHRQIFDEDL 621

Query: 531 WEEQK 535
            +E+ 
Sbjct: 622 LKEED 626

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  306 bits (783), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 179/522 (34%), Positives = 271/522 (51%), Gaps = 18/522 (3%)

Query: 26  EDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYM 85
           ED V  ES+ S  ++++K+++K RH+ M++LG  IGTGL ++ +  L   GP   +I Y+
Sbjct: 79  EDGV--ESITS--DSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYI 134

Query: 86  FIGTLAYSVTQSLGEMATFIP-VTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELS 144
            +  + Y + Q+ GEMA   P + ++F  ++  F+S + G A  +LY   W     LEL 
Sbjct: 135 LVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELI 194

Query: 145 VVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAF 204
                IQFW D +    +I IF+V L   + F VK YGE EF   C K+L I GFII + 
Sbjct: 195 TASMTIQFWNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSI 254

Query: 205 IMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGI 263
           ++ CG AG  G +G  YW NPG +     + D + GRF      L++A F++ G EL  +
Sbjct: 255 VINCGGAGNDGYIGATYWHNPGAF-----AGDTSIGRFKNVCYILVTAYFSFGGMELFAL 309

Query: 264 TAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK-SEDSYISSSPFVI 322
           +  E +NPRK+ P A  +                      ND +L  +  S   +SP+V+
Sbjct: 310 SVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVL 369

Query: 323 AIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPY 382
           A    G K++PHI NAVIL +++S  NS++Y G R+  S+A  G APK+L +  + G P 
Sbjct: 370 AASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPL 429

Query: 383 AAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGIS 442
            A++   V G +A++ +SS    VF WL  I  ++  FTW  I +SH+RF QA+K QG S
Sbjct: 430 RALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRS 489

Query: 443 RDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTAYISVMLFFV 497
            D+L +KA    WG+ Y               A AP     K     FF  Y++  ++  
Sbjct: 490 LDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLA 549

Query: 498 FWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQKPRN 538
           F+ G+ ++ R   L    + IDLD  RR  D  +  ++   N
Sbjct: 550 FYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEEN 591

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  305 bits (782), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 170/499 (34%), Positives = 267/499 (53%), Gaps = 13/499 (2%)

Query: 37  VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQ 96
           +  T + + L  RH+  +A+GG IGTGL+++    LS  GP   +I ++ I T  ++V  
Sbjct: 81  INNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVIN 140

Query: 97  SLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDA 156
           SLGE++   PV   F V++ RF+ P+   A    Y   W +   LEL      I++W D 
Sbjct: 141 SLGELSAAFPVVGGFNVYSMRFIEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDK 200

Query: 157 VPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVC-GAGKTGP 215
           +   AW+AIF+  + ++N+  VK +GE EF ++ IK+L+I+GF I   ++ C G    G 
Sbjct: 201 INSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGY 260

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G +YW +PG +         +  +F G  S  ++AAF+Y G E+  ++A E+ NPR+T+
Sbjct: 261 IGGKYWHDPGAF-----VGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETI 315

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSPFVIAIENSGTKVLP 333
           P+A  +                      NDP+L +  S +  +SSP VIAIEN G K LP
Sbjct: 316 PKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGLP 375

Query: 334 HIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGF 393
            + NA+IL  ++S  NS VY  SR   +MA  G  PK+L    K G P  A+L T   G 
Sbjct: 376 SLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGL 435

Query: 394 LAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFM 453
           L+++ +S   + VF WL  ++ ++  F W+ I++SHIRF QA+K Q  S D+LPF ++  
Sbjct: 436 LSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQTG 495

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG- 508
             G++Y              T+  P          FF  Y+S  +  V ++G +++ R  
Sbjct: 496 VKGSWYGFIVLFLVLIASFWTSLFPLGGSGASAESFFEGYLSFPILIVCYVGHKLYTRNW 555

Query: 509 PLFIKTEDIDLDTDRREID 527
            L +K ED+DLDT R+++D
Sbjct: 556 TLMVKLEDMDLDTGRKQVD 574

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  304 bits (779), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 175/524 (33%), Positives = 280/524 (53%), Gaps = 21/524 (4%)

Query: 37  VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQ 96
           +  T + + L  RH+  +A+GG+IGTGLF++  T LS+ GP   ++ ++ I T  ++V  
Sbjct: 38  LNNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVIN 97

Query: 97  SLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDA 156
           SLGE+A   P+   F V+  RF+ P++G A    Y   W +   LEL      I++W D 
Sbjct: 98  SLGELAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDK 157

Query: 157 VPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVC-GAGKTGP 215
           +   AW+AIF+V + ++N+  VK +GE EF ++ +K+LAI+GF I   ++   G    G 
Sbjct: 158 INSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGY 217

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +GF+YW NPG +  G      N  +F G  S  ++AAF++ G E++ ++A E+ NPRK +
Sbjct: 218 LGFKYWNNPGAFVGG-----TNASKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVI 272

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSPFVIAIENSGTKVLP 333
           P+A  +                      ND +L +  + +  ++SP VIAIEN G K LP
Sbjct: 273 PKAAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAASPLVIAIENGGIKGLP 332

Query: 334 HIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGF 393
            + NA+IL  I+S  NS VY  SR   SMA  G  PK L+   K G P  A++ T + G 
Sbjct: 333 SLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFGL 392

Query: 394 LAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFM 453
           L+++ +S   + VF WL  ++ ++  F W+ I+ S IRF +A++ Q  S D+LP+ ++  
Sbjct: 393 LSFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQTG 452

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRGP 509
            WGA+Y              T+  P          FF +++S+ +  V + G +++F   
Sbjct: 453 IWGAWYGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHKLYFARN 512

Query: 510 --LFIKTEDIDLDTDRREIDD-----VVWEEQKPRN--LWEKFW 544
             L I  E++D+D+ R+ ID+        EE+K  N     KFW
Sbjct: 513 WRLQIGAEEMDIDSGRKIIDEEGLKQEREEEEKAMNSSFLIKFW 556

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  305 bits (781), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 183/544 (33%), Positives = 286/544 (52%), Gaps = 25/544 (4%)

Query: 21  KPSIAEDAVSMESLGSVKETQVKRALKP----RHISMIALGGTIGTGLFISISTPLSNAG 76
           K S  ED + + S  SV +  + ++L      RH+  +A+GG IG GLF++    L++ G
Sbjct: 53  KDSPIEDNIDITSQSSVTKEDINKSLNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGG 112

Query: 77  PVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWA 136
           P   +I ++ I T  ++V  SLGE+A   PV   F V+  RF+ P+   A    Y   W 
Sbjct: 113 PASLVIDWVIISTCLFTVINSLGELAAAFPVVGGFNVYITRFVDPSFAFAVNLNYLAQWL 172

Query: 137 ITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAI 196
           +   LEL      I++W   +   AW+AIF+ ++T++N+  VK +GE EF ++ +K+LAI
Sbjct: 173 VLLPLELVAASITIKYWNSTINSDAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAI 232

Query: 197 VGFIIYAFIMVC-GAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY 255
           +GF I   ++ C G  K G +G +YW NPG +         +  +F G  S  ++AAF+Y
Sbjct: 233 IGFTILGIVLSCGGGPKGGYLGGKYWHNPGAF-----VGHTSGTKFKGLCSVFVTAAFSY 287

Query: 256 QGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI 315
            G E+  ++A E+ +PRKT+P+A  +                      +DP+L S  S +
Sbjct: 288 SGIEMTAVSAAESKDPRKTIPKAAKRTFWLITASYVTILTLVGCLVPYDDPRLMSGTSSV 347

Query: 316 --SSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLT 373
             ++SP VIAIEN G K L  + NA+IL +IIS  NS VY  SR   SMA  G  PK L 
Sbjct: 348 DAAASPLVIAIENGGIKGLDSLMNAIILISIISVANSAVYACSRCMVSMAHIGNLPKKLG 407

Query: 374 WTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFM 433
              K G P  A L T   G L+++ +S   + VF WL  ++ ++  F W+ I+ISHIRF 
Sbjct: 408 KVDKRGRPINATLVTLFFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFR 467

Query: 434 QALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAY 489
           QA+  Q  S D++P+ ++   WG+ Y              T+  P       V  FF  Y
Sbjct: 468 QAMIKQNRSLDEMPYLSQTGVWGSLYGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGY 527

Query: 490 ISVMLFFVFWIGFQIWFRGPLFIKT-EDIDLDTDRREID------DVVWEEQ--KPRNLW 540
           +S+ +  V +IG +++F+   ++ T E++DLDT R+ +D      +V+ EE      +  
Sbjct: 528 LSLPILIVCYIGHKLYFKNWSWVVTLEEMDLDTGRKALDPHLHRAEVIAEEAAVAKMSFI 587

Query: 541 EKFW 544
           ++FW
Sbjct: 588 KRFW 591

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  305 bits (781), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 190/523 (36%), Positives = 273/523 (52%), Gaps = 24/523 (4%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSL 98
           +T +K  LK RH+ MIA+GG IGTGL +   T L   GP   LI +   GT+ Y++  +L
Sbjct: 83  QTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMAL 142

Query: 99  GEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFW-TDAV 157
           GE+A   P++  FT +  RF+  + G AN + Y L W +   LE+      + FW TD  
Sbjct: 143 GELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPK 202

Query: 158 PLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
               ++A+FW+ + I N+F VK YGE EF  + IKV+ +VGFII   I+ CG G TG   
Sbjct: 203 YRDGFVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGYI 262

Query: 218 F-RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
             +YW +PG +     + D    +F G  S  ++AAF++ G+ELVG+ A E+  PRK+VP
Sbjct: 263 GGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVEPRKSVP 317

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPHI 335
           +A  +V                     ND  L    S   ++SPFVIAI+  G K LP +
Sbjct: 318 KAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAASPFVIAIKTHGIKGLPSV 377

Query: 336 FNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLA 395
            N VIL  ++S GNS +Y  SR   ++A     P+  ++  + G P   +  TS  G +A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGLIA 437

Query: 396 YLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++ +S     VFNWLL ++ ++  FTW  I I HIRF +AL  QG   D+L FK+    W
Sbjct: 438 FVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLDELSFKSPTGVW 497

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP---KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLF 511
           G+Y+               A  P         FF AY+S  L  V +IG +I+ R   LF
Sbjct: 498 GSYWGLFMVIIMFIAQFYVAVFPVGDSPSAEGFFEAYLSFPLVMVMYIGHKIYKRNWKLF 557

Query: 512 IKTEDIDLDTDRREID-DVVWEE---------QKPRNLWEKFW 544
           I  E +D+DT RRE+D D++ +E          KPR  W + W
Sbjct: 558 IPAEKMDIDTGRREVDLDLLKQEIAEEKAIMATKPR--WYRIW 598

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  305 bits (782), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 180/517 (34%), Positives = 282/517 (54%), Gaps = 16/517 (3%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSL 98
           ET++K+ +  RH+ M++LG  IGTG+ +     L N GP G +I Y  +G+  Y + Q+ 
Sbjct: 87  ETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCLYCIIQAA 146

Query: 99  GEMA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAV 157
           GE+A ++  ++ +F  +    +  A G +  ++Y L W     LEL      I++WT +V
Sbjct: 147 GELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITIKYWTTSV 206

Query: 158 PLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPV 216
               ++AIF+V++ + N+F  + Y E EF+  C KVL I+GF I   I+ CG AG  G +
Sbjct: 207 NPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGGAGNDGYI 266

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           G RYW NPG +     +K ++   F G +S++++AAF +  TE + +TA E ANPR+ +P
Sbjct: 267 GGRYWNNPGAF---YGTKPIHH--FKGIISTMVTAAFAFGATEFIALTAAEQANPRRAIP 321

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK-SEDSYISSSPFVIAIENSGTKVLPHI 335
            A  KV                     N P+L  S  S   +SP+VIA+ + G +V+PH 
Sbjct: 322 SAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHASPYVIAVASHGVRVVPHF 381

Query: 336 FNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLA 395
            NAVIL +++S GNS  Y  SR+  ++A    AP +L +  +SG P  A+L + V G ++
Sbjct: 382 INAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPMRAMLVSCVFGLIS 441

Query: 396 YLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++ +S     VF WLL I+ ++  FTWI I +SHIRF +AL  QG    +L +K++    
Sbjct: 442 FVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKPIGELGYKSQTGVA 501

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PL 510
           G+YYA              A AP    K   + FF  Y+++ LF V + GF+IW R   L
Sbjct: 502 GSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVLYFGFKIWKRDWRL 561

Query: 511 FIKTEDIDLDTDRREIDDVVWEEQK---PRNLWEKFW 544
           +I  E IDLD+ R+  D+ + +++      N+  K W
Sbjct: 562 YIPLEQIDLDSHRKTFDEELLKQEDAEYEENIRNKGW 598

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  306 bits (783), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 186/549 (33%), Positives = 288/549 (52%), Gaps = 19/549 (3%)

Query: 3   LSKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGT 62
           +SK+  A+        +I     E + S++  G  +  ++K+ L+ RH+ +IALGG IGT
Sbjct: 69  ISKNQSASSNGTIREDLIMDVDLEKSPSVD--GDSEPHKLKQGLQSRHVQLIALGGAIGT 126

Query: 63  GLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTV-----FTQR 117
           GL +  S+ L   GP G  I+Y+ I  + Y +  +LGEM  F+P   S +         R
Sbjct: 127 GLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTR 186

Query: 118 FLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFP 177
           ++ P+LG A G+ Y+  + I  A E +    ++++WT AVP   WI IF  ++ I N   
Sbjct: 187 YVDPSLGFATGWNYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVVILNFSA 246

Query: 178 VKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDV 236
           VK YGE EFW A IK+L IVG II +FI+  G G     +GFRYW++PG +   +    +
Sbjct: 247 VKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHPGAFAHHLTGGSL 306

Query: 237 NEGRFLGWVSSLISAAFTY-QGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXX 295
             G F    + +I  AF +  G ELV +T+ E A+ R+ + +A  +              
Sbjct: 307 --GNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTL 364

Query: 296 XXXXXXXXNDPKLKSEDSY----ISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSN 351
                   NDP L +  +       SSPFVI I+N+G KVLPHI N  IL++  SA N+ 
Sbjct: 365 AISVIVPYNDPTLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAF 424

Query: 352 VYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLL 411
           ++  +R   +MA  G APK L    K G+PY AV  + +   LAYL  SS  + VFNW  
Sbjct: 425 MFASTRSLLTMAQTGQAPKCLGRINKWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFS 484

Query: 412 NITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXX 471
           NI+ ++GF  W+   I+++RF +A+ + G+  D LPFK    P+  +++           
Sbjct: 485 NISTISGFLGWMCGCIAYLRFRKAIFYNGL-YDRLPFKTWGQPYTVWFSLIVIGIITITN 543

Query: 472 XXTAFAPKF-KVSDFFTAYISVMLFFVFWIGFQIWFRG--PLFIKTEDIDLDTDRREIDD 528
               F PK+ +V+DF  AYI++ +F V W G +++ R     ++   +ID+ T   EI++
Sbjct: 544 GYAIFIPKYWRVADFIAAYITLPIFLVLWFGHKLYTRTWRQWWLPVSEIDVTTGLVEIEE 603

Query: 529 VVWEEQKPR 537
              E ++ R
Sbjct: 604 KSREIEEMR 612

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  306 bits (783), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 189/563 (33%), Positives = 294/563 (52%), Gaps = 23/563 (4%)

Query: 3   LSKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGT 62
           +SK++ A+        +I     E + S+E  G  +  ++K+ L+ RH+ +IALGG IGT
Sbjct: 73  ISKNHSASSNGTIREDLIMDVDVEKSPSVE--GDNEPHKLKQGLQSRHVQLIALGGAIGT 130

Query: 63  GLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTV-----FTQR 117
           GL +  S+ L   GP G  I+Y+ I  + Y +  +LGEM  F+P   S +         R
Sbjct: 131 GLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTR 190

Query: 118 FLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFP 177
           ++  +LG A G+ Y+  + I  A E +    ++++WT AVP   WI IF  ++ + NL  
Sbjct: 191 YVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVVLLNLSA 250

Query: 178 VKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDV 236
           VK YGE EFW A IK+L IVG II +FI+  G G     +GFRYW++PG +   +    +
Sbjct: 251 VKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHPGAFAHHLTGGSL 310

Query: 237 NEGRFLGWVSSLISAAFTY-QGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXX 295
             G F    + +I  AF +  G ELV +T+ E A+ R+ + +A  +              
Sbjct: 311 --GNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNISKASRRFVWRLIFFYVLGTL 368

Query: 296 XXXXXXXXNDPKLKSEDSY----ISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSN 351
                   NDP L +  +       SSPFVI I+N+G KVLPHI N  ILS+  SA N+ 
Sbjct: 369 AISVIVPYNDPSLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILSSAWSAANAF 428

Query: 352 VYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLL 411
           ++  +R   +MA  G APK L    + G+PY AV  + +   LAYL  SS  + VFNW  
Sbjct: 429 MFASTRSLLTMAQTGQAPKCLGRINRWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFS 488

Query: 412 NITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXX 471
           NI+ ++GF  W+   I+++RF +A+ + G+  D LPFK    P+  + +           
Sbjct: 489 NISTISGFLGWMCGCIAYLRFRKAIFYNGL-FDRLPFKTWGQPYTVWASLIVVGIITLTN 547

Query: 472 XXTAFAPKF-KVSDFFTAYISVMLFFVFWIGFQIWFR--GPLFIKTEDIDLDTDRREIDD 528
               F PK+ K++DF  AYI++ +F V W G +++ R     ++   +ID+ T   EI++
Sbjct: 548 GYAIFIPKYWKIADFIAAYITLPIFLVLWFGHKLYTRTWSQWWLPVSEIDVTTGLIEIEE 607

Query: 529 VVWEEQK----PRNLWEKFWAAI 547
              E ++    P +  +KF  A+
Sbjct: 608 KSREIEEMRLPPSSFKDKFMDAL 630

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  305 bits (780), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 185/548 (33%), Positives = 279/548 (50%), Gaps = 21/548 (3%)

Query: 8   EATREKDGSHLIIKPSIAEDAVSMESLGSVK----ETQVKRALKPRHISMIALGGTIGTG 63
           ++ +  +GS    K  I E+   +E  G V     ++++K+++K RH+ M+ LG  IGTG
Sbjct: 56  DSFKRAEGSTTHTK-QINENTSDLE--GDVNSFTSDSKLKKSMKSRHVVMMTLGTGIGTG 112

Query: 64  LFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIP-VTSSFTVFTQRFLSPA 122
           L ++ +  L   GP   +I Y  +  + Y + Q+ GEMA   P + ++F  ++  F+S  
Sbjct: 113 LLVANAKGLHYGGPAALVIGYFLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKP 172

Query: 123 LGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYG 182
            G A  ++Y   W     LEL      I+FW D +    +I IF+V L   + F VK YG
Sbjct: 173 FGFATVWVYCFQWLTVLPLELITAAMTIKFWNDTINPDIFILIFFVFLLFIHFFGVKGYG 232

Query: 183 EVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRF 241
           E EF   C K+L I GFII + ++ CG AG  G +G +YWRNPG +     + D + GRF
Sbjct: 233 ETEFIFNCCKILMIAGFIILSVVINCGGAGNDGYIGGKYWRNPGAF-----AGDTSAGRF 287

Query: 242 LGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXX 301
                 L++A F++ G EL  ++  E ANPRKT P A  +                    
Sbjct: 288 KNVCYILVTAYFSFGGMELFALSVQEQANPRKTTPVAAKRSIYRILVIYLLTMILIGFNV 347

Query: 302 XXNDPKLK-SEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAY 360
             ND +L  +  S   +SP+V+A    G KV+PHI NAVIL ++IS  NS++Y G R+  
Sbjct: 348 PYNDDQLMGAGGSATHASPYVLAASIHGVKVVPHIINAVILISVISVANSSLYAGPRLMC 407

Query: 361 SMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFF 420
           S+A  G  PK+L +  + G P  A++  SV G + ++ +SS    VF WL  I  ++  F
Sbjct: 408 SLAQQGYGPKFLDYVDREGRPLIALIVCSVFGVIGFVAASSKEEVVFAWLAAIAGLSELF 467

Query: 421 TWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-- 478
           TW  I +SH+RF QA+K QG S D+L +KA    WG+ Y               A AP  
Sbjct: 468 TWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSAYGVFFNILVFIAQFWVALAPLN 527

Query: 479 ---KFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTED-IDLDTDRREIDDVVWEEQ 534
              K     FF +Y++  ++  F++G+ I+ R   F+   D IDLD  R   D  +  ++
Sbjct: 528 NGGKCSAESFFQSYLAFPIWIAFYLGYMIYNRDFTFLNPLDKIDLDFHRHIYDPELMRQE 587

Query: 535 KPRNLWEK 542
              N   K
Sbjct: 588 DLENEERK 595

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  303 bits (777), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 180/537 (33%), Positives = 291/537 (54%), Gaps = 16/537 (2%)

Query: 5   KDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGL 64
           KD++ + ++  S + + P++  DA  +  L S  ++ ++R LK RH+ MIA+GG IGTGL
Sbjct: 51  KDFKDSFKRMDS-VDLDPNLT-DAQKIAILTS--QSPLQRKLKNRHLQMIAIGGAIGTGL 106

Query: 65  FISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALG 124
           FI  S  L  AGP G LI +  + T+   +  SLGEMA   PV+  +T +  RF+  + G
Sbjct: 107 FIGSSKALRTAGPAGILIGWGLMATMILCMCLSLGEMAVTFPVSGGYTTYATRFIDESYG 166

Query: 125 SANGYLYWLSWAITFALELSVVGQIIQFW-TDAVPLTAWIAIFWVILTISNLFPVKYYGE 183
            AN   Y +   +   LE+      + +W   +    A++A+FW+ +   N+F VK YGE
Sbjct: 167 FANNINYMMQALVVLPLEIVAASITVDYWGPKSQYRAAFVALFWLCIVSINMFGVKGYGE 226

Query: 184 VEFWIACIKVLAIVGFIIYAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNEGRFL 242
            EF  + IKV+ ++GFII   I+VCG G T   +G ++W NPG +       D    +F 
Sbjct: 227 AEFVFSLIKVVTVIGFIILGVILVCGGGPTHEYIGSKFWSNPGAF-----VGDTAGQKFK 281

Query: 243 GWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXX 302
           G  S  ++AAF++  TELVG+ A E  +PRK+VP+A  +V                    
Sbjct: 282 GICSVFVTAAFSFANTELVGLAAAETEDPRKSVPKAAKQVFWRITLFYILSLLMVGLLVP 341

Query: 303 XNDPKL-KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYS 361
             DP+L  S     ++SPFV+A++N G K LP + N VIL+ ++S GNS+V+  SR   +
Sbjct: 342 YTDPRLLGSSIVDAAASPFVLALKNHGIKGLPSVINVVILTAVLSVGNSSVFSCSRCLTA 401

Query: 362 MAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFT 421
           ++  G  P    +  + G P  +++ +S  G L +L  S     +F+W+L+++ ++  F 
Sbjct: 402 LSEQGFLPNVFGYIDRKGRPLVSIIFSSAFGLLCFLAVSHQVQEIFDWMLSLSGLSSLFI 461

Query: 422 WILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP--- 478
           W+ IS+ HIRF +AL  Q  S D+L F +    WG+YY+              A  P   
Sbjct: 462 WLTISLCHIRFRKALSAQNRSIDELAFASPIGIWGSYYSVFLIIVVLILQFWIALFPGHQ 521

Query: 479 KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQ 534
           K   S+FF AY+S+ +    ++G +I+ +   L I  + +D+DT RRE+D  +++++
Sbjct: 522 KPSASNFFKAYLSMPIAVAMYLGHKIYTKNWKLLIDPKYMDIDTGRRELDIELFKQE 578

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  303 bits (777), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 172/505 (34%), Positives = 272/505 (53%), Gaps = 13/505 (2%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97
           K   +K+ ++PRH+ MIALG  IGTGL +   T L +AGP G LI Y  +G++ Y + Q+
Sbjct: 112 KSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQA 171

Query: 98  LGEMA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDA 156
            GEMA  +  +T  +  +    +    G A  ++Y L W     LEL      I++WT +
Sbjct: 172 CGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 157 VPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIM-VCGAGKTGP 215
           V    ++ IF+V++   N+F  + Y E EF+  C K+L + GF I   I+ V GAG  G 
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGF 291

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G +YW +PG +  G  S D    RF G V++L++AAF + G+E + IT  E ANPRK V
Sbjct: 292 IGGKYWHDPGAFN-GKHSID----RFKGVVATLVTAAFAFGGSEFIAITTAEQANPRKAV 346

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIAIENSGTKVLPH 334
           P A  ++                     N  +L  S      +SP+VIA+ + G +V+PH
Sbjct: 347 PGAAKQMIYRILFLFLATIILLGFLVPYNSNQLLGSSGGGTKASPYVIAVASHGVRVVPH 406

Query: 335 IFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFL 394
             NAVIL +++S  NS+ Y  +RI  +++  G AP+  T+  K+G P  A+  +++ G +
Sbjct: 407 FINAVILLSVLSMANSSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSALFGVI 466

Query: 395 AYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMP 454
           A+  +S     VF WLL I+ ++  FTW  I +SHIRF +A+K QG S  +L F+++   
Sbjct: 467 AFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFRSQTGV 526

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-P 509
           WG+ YA              A AP    K     FF  Y+++ +    ++G++IW +   
Sbjct: 527 WGSTYACIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWKKDWK 586

Query: 510 LFIKTEDIDLDTDRREIDDVVWEEQ 534
           LFI+ + IDL + R+  D+ + +++
Sbjct: 587 LFIRADKIDLISHRQIFDEELIKQE 611

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  302 bits (774), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 178/542 (32%), Positives = 279/542 (51%), Gaps = 17/542 (3%)

Query: 8   EATREKDGSHLIIKPSIAEDAVSMES--LGSVKETQVKRALKPRHISMIALGGTIGTGLF 65
           ++ +  +GS   IKP I E+   +E        ++++K+++K RH+ M++LG  IGTGL 
Sbjct: 56  DSFKRAEGSTTKIKP-INENTSDLEDGIQSFTSDSKLKKSMKSRHVVMMSLGTGIGTGLL 114

Query: 66  ISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIP-VTSSFTVFTQRFLSPALG 124
           ++ +  L   GP   +I Y+ +  + Y + Q+ GEMA   P + ++F  ++  F+S   G
Sbjct: 115 VANAKGLHYGGPAALVIGYVLVSFITYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFG 174

Query: 125 SANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEV 184
            A  +LY   W     LEL      IQFW D +    +I IF+V L   + F VK YGE 
Sbjct: 175 FATVWLYCFQWTTVLPLELITASMTIQFWNDKINPDIYILIFYVFLLFVHFFGVKAYGET 234

Query: 185 EFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLG 243
           EF   C K+L I GFI+ + ++ CG AG  G +G  YW  PG +     + D +  RF  
Sbjct: 235 EFIFNCCKILMIAGFIVLSVVINCGGAGNDGYIGGAYWHKPGAF-----AGDTSIARFKN 289

Query: 244 WVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXX 303
               L++A F++ G EL  ++  E  NPRK+ P A  +                      
Sbjct: 290 VCYILVTAYFSFGGMELFVLSVQEQTNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPY 349

Query: 304 NDPKL-KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSM 362
           ND +L  +  S   +SP+V+A    G +++PHI NAVIL +++S  NS++Y G R+  S+
Sbjct: 350 NDDQLLGAGGSATHASPYVLAASIHGVRIVPHIINAVILISVVSVANSSLYAGPRLICSL 409

Query: 363 AMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTW 422
           A  G APK+L +  + G P  A++   V+G +A++ +SS    VF WL  I  ++  FTW
Sbjct: 410 AQQGYAPKFLDYVDREGRPLRALIVCCVIGVIAFVAASSKEEIVFTWLAAIAGLSELFTW 469

Query: 423 ILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP---- 478
             I +SH+RF QA+K QG S ++L +KA    WG+ Y +             A AP    
Sbjct: 470 TSIMLSHLRFRQAMKVQGRSLNELGYKATTGIWGSIYGSFFNILVFIAQFWVALAPLGNG 529

Query: 479 -KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQKP 536
            K     FF +Y++  ++ +F+IG+ I+ R   L    + IDLD  RR  D  +  ++  
Sbjct: 530 GKCNAEAFFESYLAAPIWLIFYIGYMIYNRDFTLLNPLDKIDLDFHRRVYDPELMRQEDE 589

Query: 537 RN 538
            N
Sbjct: 590 EN 591

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  301 bits (771), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 175/525 (33%), Positives = 272/525 (51%), Gaps = 30/525 (5%)

Query: 40  TQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLG 99
           +++K+ +K RH+ MI+LG  IGTGL +   T L+ AGP G +I Y     + Y + Q+ G
Sbjct: 62  SKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLIIGYGVASAMLYCIIQAAG 121

Query: 100 EMA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVP 158
           E+   +  +T ++T ++   + PALG +  ++Y + W   F L+L      I++WTD  P
Sbjct: 122 ELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFPLQLVTAAITIKYWTDTNP 181

Query: 159 LTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPVG 217
              ++AI + ++   NLF  K Y E EF     KVL +VGF+I   I+ CG AG  G +G
Sbjct: 182 -DIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFVILGIIINCGGAGNDGYIG 240

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
            RYW  PG +  G          F G       AAF Y G E++ +TA E  NPRK++P 
Sbjct: 241 ARYWHTPGAFSTG----------FKGVCYVFCYAAFAYGGIEVMVLTASEQENPRKSIPS 290

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           A  KV                     + P+L S  S   +SPFVIAI + G  V+PHI N
Sbjct: 291 ACKKVIYRILLIYMLTTLIVCFLVPYDAPELTSTGSASRASPFVIAIASHGISVVPHIIN 350

Query: 338 AVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYL 397
           AVIL  ++S GNS++Y   R+  S++  G APK   +  + G P    L    +G LA++
Sbjct: 351 AVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQGRPLLCFLVAMFVGLLAFI 410

Query: 398 ESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
            +S     VF+WLL I+ ++  F WI I +SH+RF  A+K QG S  ++ +K++   WG+
Sbjct: 411 AASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQGRSLGEVGYKSQTGYWGS 470

Query: 458 YYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLF 511
           ++A              A AP     K    DFF +Y++  +    + G++I+++   L 
Sbjct: 471 WFAIIVSLFVLVAQFWVAIAPIGNGGKLSAKDFFQSYLAAPVLIFIYFGYKIYYKDWRLC 530

Query: 512 IKTEDIDLDTDRREID-------DVVWEEQ-KPRNLWEK---FWA 545
           I   ++DL++ R+  D       D+ W+E+ +  ++W K   FW 
Sbjct: 531 IPATEVDLNSHRKIFDEDELKQEDLDWKEKMRTASIWVKIYHFWC 575

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  302 bits (774), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 174/523 (33%), Positives = 278/523 (53%), Gaps = 17/523 (3%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97
           K   +K+ ++PRH+ MIALG  IGTGL +   T L +AGP G LI Y  +G++ Y + Q+
Sbjct: 112 KSGSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQA 171

Query: 98  LGEMA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDA 156
            GE+A  +  +T  +  +    +    G A  ++Y L W     LEL      I++WT +
Sbjct: 172 CGELALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 157 VPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIM-VCGAGKTGP 215
           V    ++ IF+V++   N+F  + Y E EF+  C K+L + GF I + I+ V GAG  G 
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGNDGF 291

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G +YW +PG +  G  S D    RF G V++L++AAF + G+E + IT  E +NPRK +
Sbjct: 292 IGGKYWHDPGAFN-GKHSID----RFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAI 346

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           P A  ++                     N D  L S      +SP+VIAI + G +V+PH
Sbjct: 347 PGAAKQMIYRILFLFLATIIMLGFLVPYNSDQLLGSGGGGTKASPYVIAIASHGVRVVPH 406

Query: 335 IFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFL 394
             NAVIL +++S  NS+ Y  +R+  +++  G APK+ ++  ++G P  A+  +++   +
Sbjct: 407 FVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALFAVI 466

Query: 395 AYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMP 454
           A+  +S     VF WLL I+ ++  FTW  I  SHIRF +A+K QG S  +L FK++   
Sbjct: 467 AFCAASPKEEQVFTWLLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFKSQTGV 526

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-P 509
           WG+ YA              A AP    K     FF  Y+++ +    ++G++IW +   
Sbjct: 527 WGSMYACIMMLLILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWTKDWK 586

Query: 510 LFIKTEDIDLDTDRREIDDVVW----EEQKPRNLWEKFWAAIA 548
           LFI+ + IDL++ R+  D+ +     EE + R     +W  +A
Sbjct: 587 LFIRADKIDLESHRQIFDEELIKQEDEEYRERLRNGPYWKRVA 629

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  301 bits (771), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 182/535 (34%), Positives = 270/535 (50%), Gaps = 37/535 (6%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           GS     +KR LK RH+ MIA+GG+IGTGLFI     L++ GP+  +I +   GT     
Sbjct: 78  GSFHTHNLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALIIGWSIAGTQIVGT 137

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
              LGE+    PV  +F  ++ RFL P++      +Y + W     LE+      IQ+W 
Sbjct: 138 IHGLGEITVRFPVVGAFANYSTRFLDPSISFVISTIYVIQWFFVLPLEIIASAMTIQYWN 197

Query: 155 DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
            ++    W+AIF+ ++   NLF  + +GE EF  + IKV+ I+GFII   +++CG G   
Sbjct: 198 QSIDPVVWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIILCIVLICGGGPDH 257

Query: 215 P-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
             VG RYW +PG    G          F G +S L+ A+++  GTE+V + +GE  NPR+
Sbjct: 258 DFVGARYWHDPGCLSHG----------FPGVLSVLVVASYSLGGTEMVCLASGE-TNPRE 306

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
            +P AI +                       +P L    S +++SPFVIAI+    K LP
Sbjct: 307 -LPSAIKQTFWRILFFFLISLTLIGFLVPYTNPNLLGGSS-VNNSPFVIAIKLHHIKALP 364

Query: 334 HIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGF 393
            I NAVIL +I+S GNS ++  SR   SMA  GL PK+  +  ++G P   +LT S+ G 
Sbjct: 365 SIVNAVILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGRPLTGILTNSLFGL 424

Query: 394 LAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFM 453
           LA+L  SS    VF+WL+ I  +A    W+ I+ISHIRF  A+K QG S D+L F +   
Sbjct: 425 LAFLVKSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGKSLDELEFVSAVG 484

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP-------KFKVSDFFTAYISVMLFFVFWIGFQIWF 506
            WG+ Y+A             A  P         +   FF +Y+  ++    ++  ++++
Sbjct: 485 MWGSAYSALINSLILIAQFYCALWPIGGWKDSSERAKTFFQSYLCALIMAFLFVCHKVFY 544

Query: 507 RGPL-----FIKTEDIDLDTDRREID-DVVWEEQKPRN----------LWEKFWA 545
           R         +  + IDL+TDR+ ID DV+ +E   RN           W  FW 
Sbjct: 545 RYKTGKWWAIMDLDKIDLETDRKNIDIDVLKQEIAERNRHLQASPWYVRWYHFWC 599

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  301 bits (772), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 181/531 (34%), Positives = 281/531 (52%), Gaps = 26/531 (4%)

Query: 36  SVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVT 95
           + K   +K+ +K RH+ MI+LG  IGTGL +   T L + GP G+ I ++ +G   Y V 
Sbjct: 84  NAKHENLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVI 143

Query: 96  QSLGEMA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFW- 153
           Q+ GE+A  +  +   F  +    + PALG A  ++Y L W   F LEL      I+FW 
Sbjct: 144 QAAGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFWP 203

Query: 154 -TDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGA-G 211
            + +V    ++AIF+V++ + N F  + Y E EF+    KVL ++GF I   ++  GA G
Sbjct: 204 GSRSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAVG 263

Query: 212 KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271
            +G +G +YWR+PG  G        +   F G V++L++AAF+   +E V +TA E ANP
Sbjct: 264 TSGYIGGKYWRDPGSLG-----GRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQANP 318

Query: 272 RKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK-SEDSYISSSPFVIAIENSGTK 330
           RK++P A  K+                     +  +L  S DS +  SP+VIA+   G  
Sbjct: 319 RKSIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVSPYVIAVRMHGVN 378

Query: 331 VLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSV 390
           V+P   NAVIL +++S GNS  Y  SR+ +S+A    APK   +  ++G P  A++ + +
Sbjct: 379 VVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISIL 438

Query: 391 LGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKA 450
            G + ++ +S     VF WLL I+ ++  FTW  I +SHIRF +AL  QG S D+L FKA
Sbjct: 439 FGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFKA 498

Query: 451 KFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWF 506
           +    G+Y +A             +  P    +     FFT Y+++ +F +F+ G++IW 
Sbjct: 499 QTGIIGSYVSAIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYKIWN 558

Query: 507 RG-PLFIKTEDIDLDTDRREID-DVVWEEQ-----KPRN--LWEK---FWA 545
           +   LFI+ + IDL + RR  D DV+ +E      K RN  +W +   FW 
Sbjct: 559 KDWRLFIRADQIDLVSHRRIFDADVLKQEDIEYRAKLRNSSIWHRIANFWC 609

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  301 bits (771), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 168/506 (33%), Positives = 271/506 (53%), Gaps = 13/506 (2%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97
           K   +K+ ++PRH+ MIALG  IGTGL +   T L +AGP G LI Y  +G++ Y + Q+
Sbjct: 112 KSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQA 171

Query: 98  LGEMA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDA 156
            GEMA  +  +T  +  +    +    G A  ++Y L W     LEL      I++WT +
Sbjct: 172 CGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 157 VPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIM-VCGAGKTGP 215
           V    ++ IF+V++   N+F  + Y E EF+  C K+L + GF I   I+ V GAG  G 
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGY 291

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G +YW  PG +  G+ + D    RF G V++L++AAF + G+E + IT  E +NPRK +
Sbjct: 292 IGGKYWHEPGAFN-GVHAID----RFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAI 346

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           P A  ++                     N D  L S      +SP+VIAI + G +V PH
Sbjct: 347 PGAAKQMIYRILFLFLATIIIVGFLVPYNSDQLLGSSGGGTKASPYVIAIASHGVRVAPH 406

Query: 335 IFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFL 394
             NAVIL +++S  NS+ Y  +R+  +++  G APK  ++  ++G P  A+  +++   +
Sbjct: 407 FVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCVSALFAVI 466

Query: 395 AYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMP 454
           A+  +S     VF WLL I+ ++  FTW  I +SHIRF +A+K QG S  +L FK++   
Sbjct: 467 AFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFKSQTGV 526

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-P 509
           WG+ Y+              A AP    K     FF  Y+++ +  V ++G+++W +   
Sbjct: 527 WGSIYSCIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIVLYVGYKMWNKDWK 586

Query: 510 LFIKTEDIDLDTDRREIDDVVWEEQK 535
           LFI+ + IDL + R+  D+ + +++ 
Sbjct: 587 LFIRADKIDLTSHRQIFDEELIKQED 612

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  300 bits (769), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 168/499 (33%), Positives = 262/499 (52%), Gaps = 13/499 (2%)

Query: 37  VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQ 96
           +  T + + L  RH+  +A+GG IGTGLF++    L+  GP   +I ++ + T  ++V  
Sbjct: 83  INNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVIN 142

Query: 97  SLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDA 156
           SLGE+A   PV   F V+  RF+ P+   A    Y   W +   LEL      I++W D 
Sbjct: 143 SLGELAAAFPVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYWNDK 202

Query: 157 VPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVC-GAGKTGP 215
           +   AW+AIF+  + ++N+  VK +GE EF ++ +K+LAI+GF I   ++ C G    G 
Sbjct: 203 INSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGGY 262

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G +YW NPG +            +F G  S  ++AAF+Y G E+  ++A E+ NP++T+
Sbjct: 263 IGGKYWHNPGAF-----VGHSAGSQFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKETI 317

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSPFVIAIENSGTKVLP 333
           P+A  +                      NDP+L +  S +  ++SP VIAIEN G K LP
Sbjct: 318 PKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAASPLVIAIENGGIKGLP 377

Query: 334 HIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGF 393
            + NA+IL  I+S  NS VY  SR   SMA  G  PK+L+   K G P  A+L T   G 
Sbjct: 378 SLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFFGL 437

Query: 394 LAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFM 453
           L+++ +S     VF WL  ++ ++  F W+ I++S IRF  A+K QG S D++PF ++  
Sbjct: 438 LSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQSG 497

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG- 508
            WGA+Y              T+  P          FF  Y+S+ +    ++G ++W R  
Sbjct: 498 TWGAWYGVIVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLSLPILIACYVGHKLWKRDW 557

Query: 509 PLFIKTEDIDLDTDRREID 527
            L +   ++DLD+ RR +D
Sbjct: 558 RLLVPLMEMDLDSGRRVLD 576

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  300 bits (768), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 173/509 (33%), Positives = 270/509 (53%), Gaps = 14/509 (2%)

Query: 36  SVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVT 95
            +  + + + L  RH+  +A+GG IGTGLF++    L+  GP   +I +  + T  ++V 
Sbjct: 80  DIHTSNMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVSTALFTVI 139

Query: 96  QSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTD 155
            SLGE+A   PV   F V+  RF+ P+   +    Y + W +   LEL      I++W D
Sbjct: 140 NSLGELAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTIRYWDD 199

Query: 156 AVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVC-GAGKTG 214
            +   AW+AIF+ ++ I+NL  VK +GE EF ++ +K+LAI+GF I   ++ C G  K G
Sbjct: 200 TINSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTCGGGPKGG 259

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
            +G +YW +PG +       D    +F G  S  ++AAF+Y G E++ ++A E+ NPRKT
Sbjct: 260 YIGGKYWHDPGAF-----VGDSAGTQFKGLCSVFVTAAFSYAGIEMIAVSAAESQNPRKT 314

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY--ISSSPFVIAIENSGTKVL 332
           +P A  +                      ND +L +  S   +++SP VIAIEN G K L
Sbjct: 315 IPTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAASPLVIAIENGGIKGL 374

Query: 333 PHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLG 392
           P + NA+IL  I+S  NS VY  SR   SMA+ G  PK L+   K G P  A+ TT   G
Sbjct: 375 PSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIFTTLFFG 434

Query: 393 FLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKF 452
            L+++ +S     VF WL  ++ ++  F W+ I+I+HIRF QA+  Q  S D++P+ ++ 
Sbjct: 435 LLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEMPYLSQT 494

Query: 453 MPWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG 508
             +G+YY              T+  P          FF  Y+S  +    +IG +++F+ 
Sbjct: 495 GIYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIGHKLYFKN 554

Query: 509 -PLFIKTEDIDLDTDRREID-DVVWEEQK 535
             +    E+IDL T R+E+D D++ EE K
Sbjct: 555 WRIMTPLEEIDLLTGRKEVDIDILKEELK 583

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  300 bits (769), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 166/508 (32%), Positives = 271/508 (53%), Gaps = 13/508 (2%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97
           K   +K+ ++PRH+ MIALG  IGTGL +   T L +AGP G LI Y  +G++ Y + Q+
Sbjct: 112 KSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQA 171

Query: 98  LGEMA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDA 156
            GEMA  +  +T  +  +    +    G A  ++Y L W     LEL      I++WT +
Sbjct: 172 CGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 157 VPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIM-VCGAGKTGP 215
           V    ++ IF+V++   N+F  + Y E EF+  C K+L + GF I   I+ V GAG  G 
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGF 291

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G +YW +PG +  G  + D    RF G  ++L++AAF + G+E + IT  E +NPRK +
Sbjct: 292 IGGKYWHDPGAFN-GKHAID----RFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAI 346

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           P A  ++                     N D  L S      +SP+VIA+ + G +V+PH
Sbjct: 347 PGAAKQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPH 406

Query: 335 IFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFL 394
             NAVIL +++S  NS+ Y  +R+  +++  G APK  ++  ++G P  A+  +++   +
Sbjct: 407 FINAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVI 466

Query: 395 AYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMP 454
           A+  +S     VF WLL I+ ++  FTW  I +SH+RF +A+K QG S  +L FK++   
Sbjct: 467 AFCAASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGV 526

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-P 509
           WG+ YA              A AP    K     FF  Y+++ +    ++G+++W +   
Sbjct: 527 WGSAYACIMMILILIAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKVWHKDWK 586

Query: 510 LFIKTEDIDLDTDRREIDDVVWEEQKPR 537
           LFI+ + IDLD+ R+  D+ + +++   
Sbjct: 587 LFIRADKIDLDSHRQIFDEELIKQEDEE 614

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  299 bits (765), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 181/536 (33%), Positives = 276/536 (51%), Gaps = 17/536 (3%)

Query: 21  KPSIAEDAVSMESLG-SVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVG 79
           KP + ++   +E +     +  +K+A+K RH+ M+ LG  +GTGL ++ +  LS  GP  
Sbjct: 44  KPPVEDEKSDLEEMSMESTDRHLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGA 103

Query: 80  ALIAYMFIGTLAYSVTQSLGEMATFIP-VTSSFTVFTQRFLSPALGSANGYLYWLSWAIT 138
            +I Y+ +  + Y + Q+ GEMA   P +  SF  +T  F+S  +G A  +L+ + W   
Sbjct: 104 LVIGYILVSFVTYFMIQAAGEMAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTV 163

Query: 139 FALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVG 198
             LEL      IQ+W D++    WI IF+V L   ++F VK YGE+EF     K+L I G
Sbjct: 164 LPLELITGTMTIQYWNDSINADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILFIGG 223

Query: 199 FIIYAFIM-VCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQG 257
           FII++ ++   GAG  G +G +YW+NPG +     +   + GRF      L++A F+Y G
Sbjct: 224 FIIFSIVVNAGGAGTDGYIGAKYWKNPGSF-----ASSTSAGRFKDVCYVLVTAYFSYGG 278

Query: 258 TELVGITAGEAANPRKTVPRAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYIS 316
           TEL  ++  E ANPR++ P+A  + +                     ND  + +  S   
Sbjct: 279 TELYVLSVNEQANPRRSTPKAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAGGSSTH 338

Query: 317 SSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTT 376
           +SP+V+A    G KV+PHI NAVIL  + S GNS++Y   R+  S+A  G APK L +  
Sbjct: 339 ASPYVLAASIHGVKVVPHIINAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYID 398

Query: 377 KSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQAL 436
           + G P  A+   +V+G +A+  +SS    VF WL  I A++  FTW  I +SHIRF  A+
Sbjct: 399 REGRPIIALAACAVVGVIAFAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMAM 458

Query: 437 KHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP---KFKVSDFFTAYISVM 493
           K QG   ++L +KA    WG+ +               A +P         FF +Y++  
Sbjct: 459 KVQGKDLNELGYKALTGVWGSMWGFGFCVLVFIAQFWVALSPPGGTISAEGFFESYLAFP 518

Query: 494 LFFVFWIGFQIWFRGPLFI-KTEDIDLDTDRREIDDVVW----EEQKPRNLWEKFW 544
           L+  F+  + +W R   F+ K EDIDLD  RR  D        EE+K +     FW
Sbjct: 519 LWLFFYFAYMLWKRDFTFLTKLEDIDLDAHRRIYDPEFLRQEDEERKEKIRNSSFW 574

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  302 bits (773), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 193/577 (33%), Positives = 292/577 (50%), Gaps = 36/577 (6%)

Query: 2   SLSKDYEATREKDGSHLIIKPSIAEDAVSMESL-------------GSVKETQVKRALKP 48
           S +  YEA  EKD +  + K S  + A S  ++             G     ++K+ L+ 
Sbjct: 111 SRTHHYEA--EKDDAIRMEKISKNQSASSNGTVREELDLEKSPSADGDAGPHRLKQGLQS 168

Query: 49  RHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVT 108
           RH+ +IALGG IGTGL +  S+ L   GP G  I+Y+ I  + Y +  +LGEM  F+P  
Sbjct: 169 RHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGD 228

Query: 109 SSFTV-----FTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWI 163
            S +         R++  +LG A G+ Y+  + I  A E +    ++++WT AVP   WI
Sbjct: 229 GSDSAGSSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAASGVVEYWTTAVPKGVWI 288

Query: 164 AIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KTGPVGFRYWR 222
            IF  ++ + N   VK YGE EFW A IK+L IVG II +FI+  G G K   +GFRYW+
Sbjct: 289 TIFLCVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFRYWQ 348

Query: 223 NPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVGITAGEAANPRKTVPRAINK 281
           +PG +   +    +  G F    + +I  AF +  G ELV +T+ E A+ R+ + +A  +
Sbjct: 349 HPGSFAHHLAGGSL--GNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRR 406

Query: 282 VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY----ISSSPFVIAIENSGTKVLPHIFN 337
                                 NDP L +  +       SSP+VI I+N+G KVLPHI N
Sbjct: 407 FVWRLIFFYVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYVIGIQNAGIKVLPHIIN 466

Query: 338 AVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYL 397
             IL++  SA N+ ++  +R   +MA  G APK L    + G+PY AV  + +   LAYL
Sbjct: 467 GCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVPYVAVGVSFLCSCLAYL 526

Query: 398 ESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
             SS  + VFNW  NI+ ++GF  WI   I+++RF +A+   G+  D LPFK    P+  
Sbjct: 527 NVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFFNGL-YDRLPFKTWGQPYTV 585

Query: 458 YYAAXXXXXXXXXXXXTAFAPKF-KVSDFFTAYISVMLFFVFWIGFQIWFR--GPLFIKT 514
           +++               F PK+  V+DF  AYI++ +F V W+G +++ R     +   
Sbjct: 586 WFSLTVVSIITITNGYAIFIPKYWNVADFIAAYITLPIFLVLWLGHKLYTRTWNHWWHSV 645

Query: 515 EDIDLDTDRREID----DVVWEEQKPRNLWEKFWAAI 547
            +ID+ T   EI+    D+      P    EKF  A+
Sbjct: 646 SEIDVTTGLVEIEEKSRDIEELRLPPATFKEKFMDAL 682

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  299 bits (765), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 167/501 (33%), Positives = 264/501 (52%), Gaps = 15/501 (2%)

Query: 36  SVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVT 95
            +    + + L  RH+  +A+GG+IG GLF++    L++ GP   +I ++ I T  ++V 
Sbjct: 69  DINNVNLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVI 128

Query: 96  QSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTD 155
            +LGEMA   PV   F V+  RF+ P++G A    Y   W +   LEL      I++W +
Sbjct: 129 NALGEMAAAFPVVGGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNE 188

Query: 156 AVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVC-GAGKTG 214
            +   AW+AIF+ ++ ++N+  VK +GE EF ++ IK+LAI+GF I   ++ C G    G
Sbjct: 189 TINSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGG 248

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEG-RFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
            +G +YW +PG +         N G +F G  S  ++AAF+Y G E+  ++A E+ +PR 
Sbjct: 249 FIGGKYWNHPGSF------VGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRT 302

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSPFVIAIENSGTKV 331
           T+P+A  +                      +DP+L S  S +  +SSP VIAIEN G K 
Sbjct: 303 TIPKAAKRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAASSPLVIAIENDGIKG 362

Query: 332 LPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVL 391
           LP + NA+IL +IIS  NS VY  SR   +MA  G  P+ L      G P  A++ T   
Sbjct: 363 LPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFF 422

Query: 392 GFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAK 451
           G L+++ +S   + VF WL  ++ ++  F W+ I++SHIRF Q++  Q  S D+LPF ++
Sbjct: 423 GLLSFVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQ 482

Query: 452 FMPWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFR 507
              WG++Y              T+  P          FF  Y+S  +    + G +++ R
Sbjct: 483 TGVWGSWYGTIVLFLVLVASFWTSLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYVR 542

Query: 508 GPLF-IKTEDIDLDTDRREID 527
              F +   D+DLDT RR++D
Sbjct: 543 KREFMVGLADMDLDTGRRQVD 563

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  299 bits (765), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 173/507 (34%), Positives = 274/507 (54%), Gaps = 15/507 (2%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97
           +ET++K+ +  RH+ MI+LG  IGTG+ +     L N GP G  I Y  +G+  Y + Q+
Sbjct: 75  RETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAIMGSCIYCIIQA 134

Query: 98  LGEMA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDA 156
            GEMA ++  ++ +F  +    + PALG +  ++Y L W     LEL      I++WT A
Sbjct: 135 AGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVTATITIKYWTTA 194

Query: 157 VPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGP 215
           V    ++ IF+V+  + NLF  + Y E EF+    KVL I GF I   I+ CG AG  G 
Sbjct: 195 VNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDGY 254

Query: 216 VGFRYWRNPGP-WGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
           +G +YW +PG  +G    +K ++   F G ++++++AAF +  TE + +TA E ANPR+ 
Sbjct: 255 LGGKYWHDPGALYG----TKPIHH--FKGIIATMVTAAFAFGATEFIALTAAEQANPRRA 308

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVIAIENSGTKVLP 333
           +P A  K+                     N D  + S  S   +SP+VIAI + G KV+P
Sbjct: 309 IPSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHASPYVIAIASHGVKVVP 368

Query: 334 HIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGF 393
           H  NAVIL +++S GNS  Y  SR+  S++    AP +L +  + G P  A+L + + G 
Sbjct: 369 HFINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIRAMLVSCIFGL 428

Query: 394 LAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFM 453
           +A++ +S     VF WLL I+ ++  FTWI I +SHIRF +AL  QG S  +L +K++  
Sbjct: 429 IAFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSLGELGYKSQTG 488

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG- 508
             G+YYA              A AP    K   ++FF  Y+++ +    + G+++W R  
Sbjct: 489 VVGSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPILIALYFGYRVWKRDW 548

Query: 509 PLFIKTEDIDLDTDRREIDDVVWEEQK 535
            L+I  E IDL + R+  D+ + +++ 
Sbjct: 549 KLYIPLEQIDLVSHRKVFDEDLLKQED 575

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  299 bits (766), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 174/524 (33%), Positives = 279/524 (53%), Gaps = 27/524 (5%)

Query: 24  IAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIA 83
           I+E+ ++ +     ++ ++K+ L  RHI +IALGG IGTGLF+     L+  GP G + +
Sbjct: 88  ISEELINEDG----RKNKLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKCGPAGLVAS 143

Query: 84  YMFIGTLAYSVTQSLGEMATFIPVTSSFTV-----FTQRFLSPALGSANGYLYWLSWAIT 138
           Y+ I T+ Y +   LGEM  ++P   S +        +R+L  +L  A G+ Y+  + + 
Sbjct: 144 YLIISTMVYPIMNVLGEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNYYYCFVML 203

Query: 139 FALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVG 198
            A E +    ++++WT  VP  AWI +F +I+   N+ PV+ YGE EFW A  K+L IVG
Sbjct: 204 VAAECTAASGVVEYWTKVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAISKILCIVG 263

Query: 199 FIIYAFIMVCGAG-KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-Q 256
            II +FI+  G G     +GFRYW  PG +   I +     G FL     +I  AF++  
Sbjct: 264 LIILSFILFWGGGPNHDRLGFRYWITPGSFANTITNGSF--GNFLDVYKGIILGAFSFIL 321

Query: 257 GTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKS----ED 312
           G ELV + + E ++PR+ + +A  +                      NDP L +    + 
Sbjct: 322 GPELVVLPSSECSDPRRNIKKASKRFIWRLMFFYILGTLSISVIVSYNDPILSTALIQDK 381

Query: 313 SYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYL 372
               SSPFVI I+N+G  VLPHI N  IL +  S+GN+ ++  SR   +MA+N  APK L
Sbjct: 382 PGAGSSPFVIGIQNAGIDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAINSQAPKCL 441

Query: 373 TWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRF 432
               + G+PY AV+ + +L  +AYL  S   S VF W  N++ ++GF  WI++S++++RF
Sbjct: 442 GKINRFGVPYVAVIVSIILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWIIVSVTYLRF 501

Query: 433 MQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPK-FKVSDFFTAYIS 491
            +A+++ G+ +D LP+     P+   Y+                 P+ + VSDF  AY++
Sbjct: 502 RKAIEYHGM-KDRLPYTTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVSDFIAAYLT 560

Query: 492 VMLFFVFWIGFQIW-FRGPLFIK-------TEDIDLDTDRREID 527
           + +F + WIG + + +R  +F +        EDID+ T   EI+
Sbjct: 561 LPIFLMIWIGHKFYKYRFKIFTRQCRWWYQVEDIDVITGLEEIE 604

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  295 bits (754), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 159/514 (30%), Positives = 273/514 (53%), Gaps = 6/514 (1%)

Query: 12  EKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTP 71
           E   +  +++P++++ A S +  GS  E  + R L P  +S++ LG  +GTGL I   T 
Sbjct: 3   EIKNTVTVVEPTLSDSASSRDEGGSTNEATLSRELSPGVVSLLTLGSAVGTGLIIGSGTA 62

Query: 72  LSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLY 131
           L+  GP+   +AY+F G++   V  SL EMA F P+   F+ +  +++ PA G A G+ Y
Sbjct: 63  LARGGPISIFLAYLFTGSILAVVIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNY 122

Query: 132 WLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACI 191
           +L +AI  +  L+  G +I +W   + +  W+ + +    + N   V+Y+G++E ++   
Sbjct: 123 FLKYAIVLSANLTAFGLVIGYWRPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVA 182

Query: 192 KVLAIVGFIIYAFIMVCGAG-KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLIS 250
           K+  ++   I   ++ CG G     +GFRYWR  G + P ++    N G+FLGW + +I 
Sbjct: 183 KLTILLLIFIVCLVITCGGGPDHTTIGFRYWRESG-FLPYLVKG--NTGKFLGWWACVIQ 239

Query: 251 AAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-K 309
           + F + G+E++GI  GE ANPRKT+P+A   V                     ++ KL  
Sbjct: 240 SIFGFMGSEMIGIIYGETANPRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLVH 299

Query: 310 SEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAP 369
           +  +  ++SPFVIAI  SG KVLP   NA +L  I S+  +++Y+ SR  Y +A +G AP
Sbjct: 300 AHSTDANASPFVIAISTSGIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGAAP 359

Query: 370 KYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISH 429
           K      K  IP    +  S+LGFLAY+ +   A+ VF ++ +  +V G   W  I +++
Sbjct: 360 KIFLRLNKHKIPMVGCVVGSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYILVAY 419

Query: 430 IRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAY 489
           I + + +K  G+  D++PF+  F P+ AY A             +AF  KF    F T+Y
Sbjct: 420 IHYDRVVKSHGVRLDEIPFRMPFQPYAAYIALFFVSVITFFNGYSAFILKFNYKLFITSY 479

Query: 490 ISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDR 523
           I +    +  +G++++++   ++K E+I  +  +
Sbjct: 480 IGIFANVLLVLGYKLYYKTK-WVKPEEITFEKKQ 512

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  297 bits (761), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 171/503 (33%), Positives = 271/503 (53%), Gaps = 14/503 (2%)

Query: 41  QVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGE 100
           ++K+ +KPRH+ MI+LG  IGTG+ +   T L+N+GP G +I Y  +G+  Y + Q+ GE
Sbjct: 108 ELKKTIKPRHVVMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGE 167

Query: 101 MAT-FIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPL 159
           +A  +  +T  F  +    + PA G A  ++Y + W     LEL      I++WT  V  
Sbjct: 168 LAVLYTKLTGGFNAYPSMLIDPAFGFAVAWVYCIQWLCVCPLELVTASMTIKYWTTKVDP 227

Query: 160 TAWIAIFW-VILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPVG 217
             ++ IF+ +IL I+ L     Y E EF+    K+L + GF I   +++CG AG  G +G
Sbjct: 228 DVFVVIFYCLILCINVLGGAAGYAEAEFFFNSFKILMLTGFFILGIVVICGGAGNDGYIG 287

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
            R W NPG +       D    RF G VS+L++AAF +  +E +G+TA E +NPRK +P 
Sbjct: 288 TRLWHNPGSF-----RGDKPVDRFKGVVSTLVNAAFAFGMSEFLGVTASEQSNPRKAIPS 342

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVIAIENSGTKVLPHIF 336
           A  K+                     + D  L S  +   +SP+V+AI   G +V+PH  
Sbjct: 343 AAKKMLYRIICIYLGSVTIVGFLVPYDSDQLLGSSGAATKASPYVLAISLHGVRVVPHFI 402

Query: 337 NAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAY 396
           NAVIL +++S GNS  Y  SR   S++  G AP +L +  ++G P  A   ++++G +A+
Sbjct: 403 NAVILLSVLSVGNSAFYSSSRQLLSLSQLGYAPSFLNYVDRNGRPLKAYCVSALVGVIAF 462

Query: 397 LESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWG 456
             +S     VF WLL I+ ++  FTW  I +SH+RF +A++ QG S  ++ FK++   +G
Sbjct: 463 CATSPKEDQVFVWLLAISGLSQLFTWFSICLSHLRFRRAMRVQGRSMGEVGFKSQVGIYG 522

Query: 457 AYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLF 511
           + Y+             TA  P    K  V  FF  Y+++ +F V + GF+IW +   LF
Sbjct: 523 SLYSCVMMVLILIAQFWTALVPVGEGKPDVQAFFENYLAMPIFIVLYFGFKIWKKDWRLF 582

Query: 512 IKTEDIDLDTDRREIDDVVWEEQ 534
           I+ EDIDL + R   D+ + +++
Sbjct: 583 IRAEDIDLVSHREIFDEELLKQE 605

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  297 bits (760), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 176/496 (35%), Positives = 265/496 (53%), Gaps = 12/496 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSL 98
            + ++  LK RH+ MIA+GG IGTGLF+     L  AGP G LI +   GT+ +++  +L
Sbjct: 85  RSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWSITGTMIFTMVMAL 144

Query: 99  GEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVP 158
           GE+A   PV+  FT +  RF+  + G A  + Y L W +   LE+      + +W   V 
Sbjct: 145 GELAVMFPVSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAASITVAYWETPVR 204

Query: 159 LT-AWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
            T  ++A+FW+++ I N+F V+ YGE EF  + IKV A++GFII   ++VCG G  G   
Sbjct: 205 YTDGFVALFWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGIVLVCGGGPVGGYV 264

Query: 218 F-RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
             RYW NPG +         +  +F G+ S  ++AAF++ G+EL+G+   EA NPRK VP
Sbjct: 265 GARYWHNPGAF-----VGSTSGQKFHGFCSVFVTAAFSFAGSELIGLAGSEAKNPRKAVP 319

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIAIENSGTKVLPHI 335
            A  +V                     NDP+L  S     S+SPFVIAI   G   LP +
Sbjct: 320 SAAKQVFWRILLFYIICLLLIGFLVPYNDPRLISSSSVDASASPFVIAIVTHGISGLPSV 379

Query: 336 FNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLA 395
            N VIL +++S GNS +Y  SR   +++  G  PK +++  + G P   +  +S  G +A
Sbjct: 380 INVVILISVLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGIAISSTFGLIA 439

Query: 396 YLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++ +S+  + +FNWLL I+ ++ FFTW  I I HIRF  ALK QG   D+LPF +     
Sbjct: 440 FVAASNKQNEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGRGTDELPFVSPAGVI 499

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP---KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLF 511
           G+Y+               A  P        +FF+AY++  +   F+I  ++W +     
Sbjct: 500 GSYWGLFLNILMLIAQFYIALFPIGGSPSAYEFFSAYLAAPVILAFYIAHKLWKKNWKFL 559

Query: 512 IKTEDIDLDTDRREID 527
           I  ED+D+DT RR+ D
Sbjct: 560 IPLEDVDIDTGRRDTD 575

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  296 bits (759), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 185/530 (34%), Positives = 271/530 (51%), Gaps = 14/530 (2%)

Query: 13  KDGSHLIIKPSIAEDAVSMESLGS-VKETQVKRALKPRHISMIALGGTIGTGLFISISTP 71
           KD    + +  + +D   +E +        +K  LK RH+ MIA+GG IGTGLF+   T 
Sbjct: 51  KDSFKPLDEAVVTDDMSDIEKIAHRTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTA 110

Query: 72  LSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLY 131
           L  AGP G LI +   GT+ Y +  ++GE++   P++  FT +  RF+  + G AN + Y
Sbjct: 111 LRTAGPAGILIGWGLTGTMIYCMVMAMGELSVVFPISGGFTTYATRFIDESFGFANNFNY 170

Query: 132 WLSWAITFALELSVVGQIIQFW-TDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIAC 190
            L W     LE+      + +W TD      ++A+FWV++ I NLF VK YGE EF  + 
Sbjct: 171 MLQWLCVLPLEIVAASITVNYWGTDPKYRDGFVALFWVVIVIINLFGVKGYGEAEFVFSI 230

Query: 191 IKVLAIVGFIIYAFIMVCGAGKTGPVGF-RYWRNPGPWGPGIISKDVNEGRFLGWVSSLI 249
           IKVL ++GFII   ++ CG G  G     +Y+ +PG +       D    RF G  S  +
Sbjct: 231 IKVLTVIGFIIMGIVLNCGGGPEGGYIGGKYFHDPGAF-----VGDTAGARFQGVCSVFV 285

Query: 250 SAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK 309
           +AAF++ G+EL+GI A E+A PRK+VP+A  +V                      D +L 
Sbjct: 286 TAAFSFAGSELIGIAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERLI 345

Query: 310 SEDSY-ISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLA 368
              S   ++SPFVIAI + G + LP + N VIL  ++S GNS VY  SR   ++A     
Sbjct: 346 GASSVDAAASPFVIAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFL 405

Query: 369 PKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISIS 428
           PK   +  +SG P   +  TS  G +A++  S     VF WLL ++ ++  FTW  I   
Sbjct: 406 PKIFGYIDRSGRPLFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFC 465

Query: 429 HIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP---KFKVSDF 485
           HIRF  AL  QG S D+LPFKA    +G+ +               A  P   K     F
Sbjct: 466 HIRFRAALTAQGRSTDELPFKAPAGIYGSMWGLFMIVLMFMAQFYVALFPPGGKPSAEVF 525

Query: 486 FTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREID-DVVWEE 533
           F +Y+S  +   F+ G +++ R   L I    +D+DT RRE+D DV+ +E
Sbjct: 526 FQSYLSFPVVLAFYFGHKLYARNWKLLIPLSKLDIDTGRREMDLDVLRQE 575

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  297 bits (760), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 171/511 (33%), Positives = 269/511 (52%), Gaps = 13/511 (2%)

Query: 37  VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQ 96
           + E+ +K+++K RH+ M+ LG  IGTGL ++ ++ L  +GP   ++AY  +  + Y + Q
Sbjct: 96  ISESHLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYGLVSFVTYFMIQ 155

Query: 97  SLGEMATFIP-VTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTD 155
           + GEMA   P +  +F  +   F+S   G A  +L+ L W     LEL      I++W D
Sbjct: 156 AAGEMAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELITSSLTIKYWND 215

Query: 156 AVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTG 214
            +    ++ IF+V L   + F V+ YGE EF     K+L I GFII++ ++ CG AG  G
Sbjct: 216 KINSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSIVVNCGGAGHDG 275

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
            +G +YW +PG +     +   N GRF G    L++A F+Y GTEL  ++  E  NPRK+
Sbjct: 276 YIGGKYWHDPGAF-----TSHTNIGRFKGICFILVTAYFSYGGTELYVLSVNEQENPRKS 330

Query: 275 VPRAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
            P+A  + +                     ND  + S  S   +SP+V+A    G +++P
Sbjct: 331 TPQAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSHGSATHASPYVLAASIHGVRIVP 390

Query: 334 HIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGF 393
           H  NAVIL ++IS  NS++Y   R+  S+A  G APK+LT+  + G P  A+ T S+ G 
Sbjct: 391 HFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRPLTALATCSLFGV 450

Query: 394 LAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFM 453
           + +  +S+    VF WL  I  ++  FTW  I +SH+RF QA+K QG   ++L +KA   
Sbjct: 451 IGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGRDLNELGYKAVSG 510

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP---KFKVSDFFTAYISVMLFFVFWIGFQIWFRGPL 510
            WG+ Y               A AP   K     FF +Y++  +FF F+ G+ +W +   
Sbjct: 511 VWGSVYGVFFNILVFFAQFWVALAPPGSKPTALSFFESYLAFPIFFTFYFGYMLWNKDFT 570

Query: 511 F-IKTEDIDLDTDRREID-DVVWEEQKPRNL 539
           F I  E IDLD  RR  D + + +E++ + +
Sbjct: 571 FLIPLESIDLDFHRRVYDPEFIRQEREEKKI 601

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  296 bits (758), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 169/522 (32%), Positives = 280/522 (53%), Gaps = 14/522 (2%)

Query: 30  SMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGT 89
           +M S   +  + + + L  RH+  +A+GG IGTGLF++    L+  GP   +I ++ + T
Sbjct: 77  NMLSKEDIDGSNLNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLVIGWVIVST 136

Query: 90  LAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQI 149
             ++V  SLGE+A   PV   F+V+  RF+ P++  +    Y + W +   LEL      
Sbjct: 137 ALFTVINSLGELAAAYPVVGGFSVYMTRFIDPSIAFSINLNYLVQWLVLLPLELVAASIT 196

Query: 150 IQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVC- 208
           I++W D +   AW++IF+ ++ + N+  VK +GE EF ++ IK+LAI+GF I   ++ C 
Sbjct: 197 IRYWNDKINSDAWVSIFYTVIGLLNMLDVKSFGETEFVLSFIKILAIIGFTILGIVLSCG 256

Query: 209 GAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEA 268
           G    G +G +YW +PG +            +F G  S  ++AAF+Y G E++ ++A E+
Sbjct: 257 GGPVGGYIGGKYWHDPGAF-----VGHTAGSQFKGLCSVFVTAAFSYSGIEMIAVSAAES 311

Query: 269 ANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY--ISSSPFVIAIEN 326
            +PRKT+P A  +                      +DP+L +  S   ++SSP VIAIEN
Sbjct: 312 IDPRKTIPVAAKRTFWLITASYVTILTLIGCLVPYDDPRLLNGSSSVDVASSPLVIAIEN 371

Query: 327 SGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVL 386
            G K LP + NA+IL  ++S  NS VY  SR   SMA+ G  PK L    K G P  A L
Sbjct: 372 GGIKGLPSLMNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGRPINATL 431

Query: 387 TTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDL 446
            T   G ++++ +S   + VF WL  ++ ++  F W+ I+ISHIRF +A+  QG S +++
Sbjct: 432 VTLFFGLISFVAASDKQAEVFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQGRSLEEM 491

Query: 447 PFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGF 502
           P+ ++   +G++Y              T+  P    +   + FF  Y+S+ +    ++G 
Sbjct: 492 PYLSQVGVYGSWYGCIILFLVLIAAFWTSLFPVGSSQANATTFFEGYLSLPILLACYVGH 551

Query: 503 QIWFRG-PLFIKTEDIDLDTDRREID-DVVWEEQKPRNLWEK 542
           + +F+   LF    +IDLD+ +R+ID +++ EE+K   L  K
Sbjct: 552 KFYFKNWRLFTPYNEIDLDSGKRDIDLELLREEKKMEELALK 593

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  297 bits (760), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 182/565 (32%), Positives = 289/565 (51%), Gaps = 39/565 (6%)

Query: 2   SLSKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIG 61
            L+K +E T E         PS  ED      +   K  ++K ++KPRH+ MI+LG  IG
Sbjct: 95  DLTKTFEGTLE---------PS--EDGTQPAEVAG-KSEELKHSIKPRHVIMISLGTGIG 142

Query: 62  TGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMAT-FIPVTSSFTVFTQRFLS 120
           TG+ +   T L+N+GP G +I Y  +G+  Y + Q+ GEMA  +  +   F  +    + 
Sbjct: 143 TGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGEMAVLYSKLIGGFNSYPSFLIE 202

Query: 121 PALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFP-VK 179
           PALG +  ++Y + W     LEL      I++WT  V    ++ IF+V++ + N+     
Sbjct: 203 PALGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYVLIILINVLGGAA 262

Query: 180 YYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPVGFRYWRNPGPW-GPGIISKDVN 237
            Y E EF+    K+L ++GF I   I++CG AG  G +G RYW +PG + G   I     
Sbjct: 263 GYAEAEFFFNSCKILMLLGFFILGIILICGGAGDDGYIGGRYWHDPGAFRGEHAID---- 318

Query: 238 EGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXX 297
             RF G VS+L++AAF +  +E++G+TA E +NPRK +P A  K+               
Sbjct: 319 --RFKGVVSTLVNAAFAFGLSEMIGVTASEQSNPRKAIPSAAKKMIYRIVCIYLGSVVIV 376

Query: 298 XXXXXXN-DPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGS 356
                 N D  L S    + +SP+V+A+   G +V+PH  NAVIL +++S  NS  Y  S
Sbjct: 377 GFLVPWNSDQLLGSSGGGVKASPYVLAVSTHGVRVVPHFINAVILLSVLSVANSAFYSSS 436

Query: 357 RIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAV 416
           R+   +A  G APK   +  + G P   +   +++  +++  +S     VF WLL I+ +
Sbjct: 437 RLLLGLAEQGYAPKIFKYVDREGRPTMGMCVAALVNVISFCATSPKEDQVFVWLLAISGL 496

Query: 417 AGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAF 476
           +  FTW  I +SHIRF +A+  QG S  ++ FK++   WG++YA              A 
Sbjct: 497 SQLFTWSAICLSHIRFRRAMAVQGRSLGEIGFKSQCGVWGSWYAFIMMMLILIAQFWVAI 556

Query: 477 AP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVW 531
           AP    +  V  FF  Y++  +    + G++I+ +   LFI+ +DIDLD +R   D+ + 
Sbjct: 557 APIGEGRLDVQAFFENYLAAPILIALYFGYKIYTKDWRLFIRAKDIDLDINRDVFDEELI 616

Query: 532 E------EQKPRN--LWEK---FWA 545
                  ++K RN  +W+K   FW 
Sbjct: 617 RQEEEEYKEKMRNAPIWQKIYEFWC 641

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  295 bits (756), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 173/522 (33%), Positives = 271/522 (51%), Gaps = 18/522 (3%)

Query: 26  EDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYM 85
           ED +  ES+ S  ++++K+++K RH+ M++LG  IGTGL ++ +  L   GP   +I Y+
Sbjct: 79  EDGI--ESITS--DSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYV 134

Query: 86  FIGTLAYSVTQSLGEMATFIP-VTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELS 144
            +  + Y + Q+ GEMA   P + ++F  ++  F+S   G A  +LY   W     LEL 
Sbjct: 135 LVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWLTVLPLELI 194

Query: 145 VVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAF 204
                IQ+W D +    +I IF++ L   ++F VK YGE EF   C K+L I GFII + 
Sbjct: 195 TASMTIQYWNDKLNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMIAGFIILSV 254

Query: 205 IMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGI 263
           ++ CG AG  G +G  YW NPG +     + D +  RF      L++  F++ G EL  +
Sbjct: 255 VINCGGAGDDGYIGGAYWHNPGAF-----AGDTSIARFKNVCYILVTGYFSFGGMELFAL 309

Query: 264 TAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK-SEDSYISSSPFVI 322
           +  E +NPRK+ P A  +                      ND +L  +  S   +SP+V+
Sbjct: 310 SVQEQSNPRKSTPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVL 369

Query: 323 AIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPY 382
           A    G K++PHI NAVIL +++S  NS++Y G R+  S++  G APK+L +  + G P 
Sbjct: 370 AASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVDREGRPL 429

Query: 383 AAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGIS 442
            A++   + G +A++ +SS    VF WL  I  ++  FTW  I +SH+RF QA+K QG S
Sbjct: 430 RALIVCCIFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRS 489

Query: 443 RDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTAYISVMLFFV 497
            D+L +KA    WG+ Y               A AP     +  V  FF +Y++  ++  
Sbjct: 490 LDELGYKATTGIWGSVYGFFFNILVFIAQFWVALAPLGNDGRCSVESFFESYLAAPIWLT 549

Query: 498 FWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQKPRN 538
           F+ G+ I+ R   L    + IDLD  RR  D  +  ++   N
Sbjct: 550 FFFGYMIYNRDFTLLNPLDKIDLDFHRRIYDPELIRQEDQEN 591

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  294 bits (753), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 183/496 (36%), Positives = 266/496 (53%), Gaps = 12/496 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSL 98
            + +KR LK RH+ MIA+GG IGTGLF+     L  AGP G LI +   GT+ Y +  ++
Sbjct: 74  NSPLKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWALTGTMIYCMVMAM 133

Query: 99  GEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFW-TDAV 157
           GE+A   PV+  FT +  RF+  + G AN + Y L W +   LE+      + +W TD  
Sbjct: 134 GELAVTFPVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVAASITVNYWGTDPK 193

Query: 158 PLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
               ++A+F+V++   N+F VK YGE EF  + IKV+ ++GFII   I+VCG G  G   
Sbjct: 194 YRDGFVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFIILGIILVCGGGPVGGYI 253

Query: 218 FR-YWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
               W NPG +      K     RF G  S  ++AAF++ G+ELVG+ + E ANPRK++P
Sbjct: 254 GGANWHNPGAFVGNTAGK-----RFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSLP 308

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPHI 335
           RA  +V                     ND +L    S   ++SPFV+AI+N G K LP +
Sbjct: 309 RAAKQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAASPFVLAIKNHGIKGLPSV 368

Query: 336 FNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLA 395
            N VIL  ++S GNS V+  SR   ++A  G  PK   +  + G P   +  TS  G L+
Sbjct: 369 VNVVILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFFGLLS 428

Query: 396 YLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++ +S     VF+WLL ++ ++  FTW+ I I H+RF +AL  QG S D+L F +    W
Sbjct: 429 FIAASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELSFVSPAGVW 488

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP---KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLF 511
           G+ Y               A  P        DFF +Y+S+ +  V +IG + + R   LF
Sbjct: 489 GSIYGTVLIMLILAAQFWIALFPIGSPPDAKDFFESYLSLPVVLVMYIGHKCYKRNWKLF 548

Query: 512 IKTEDIDLDTDRREID 527
           I+ E+ID+DT RRE+D
Sbjct: 549 IRAENIDIDTGRREVD 564

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  295 bits (754), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 177/535 (33%), Positives = 269/535 (50%), Gaps = 37/535 (6%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           GS     +KR+LK RH+ MIA+GG+IGTGLF+     ++  GP+  +I +   G+     
Sbjct: 78  GSFDTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIGT 137

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
              LGE+    PV  +F  ++ RFL P+L      +Y + W     LE+      +Q+W 
Sbjct: 138 IHGLGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYWN 197

Query: 155 DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
            ++    W+AIF+  +   NLF  + +GE EF  + +KVL I GFII   +++CG G   
Sbjct: 198 QSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGGGPDH 257

Query: 215 P-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
             VG +YW +PG    G          F G +S L+ A+++  GTE+V + +GE  +P K
Sbjct: 258 DFVGAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGTEMVCLASGE-TDP-K 305

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
            +P AI +                       +  L    S +++SPFVIAI+    KVLP
Sbjct: 306 ELPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSS-VNNSPFVIAIKLHQIKVLP 364

Query: 334 HIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGF 393
            I NAVIL +I+S GNS ++  SR   SMA  GL P++  +  ++G P   ++T S+ G 
Sbjct: 365 SIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIITNSLFGL 424

Query: 394 LAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFM 453
           LA+L  SS  S VF+WL+ I  +A    W+ I+ISHIRF  A+K QG S D+L F +   
Sbjct: 425 LAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELEFVSAVG 484

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP-------KFKVSDFFTAYISVMLFFVFWIGFQIWF 506
            WG+ Y+A             A  P         +   FF +Y+  ++  V ++G +I++
Sbjct: 485 IWGSAYSAVINSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVLFVGHKIFY 544

Query: 507 RGPL-----FIKTEDIDLDTDRREID-DVVWEEQKPRN----------LWEKFWA 545
           R         +    IDL+TDR+ ID +++ +E   RN           W  FW 
Sbjct: 545 RYKTGKWWSMLPLNKIDLETDRKNIDIEILKQEIAERNRHLRASPWYVRWYHFWC 599

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  296 bits (757), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 171/527 (32%), Positives = 274/527 (51%), Gaps = 24/527 (4%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97
           K+  +++ +KPRH+ +++LG  IGTGL +   + L  AGP G +I Y  +G+  Y + Q+
Sbjct: 127 KDDHLQKTIKPRHVLLMSLGTGIGTGLLVGNGSALHKAGPGGLVIGYAIMGSCLYCIIQA 186

Query: 98  LGEMAT-FIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDA 156
            GEMA  +  +  +F  +    +  A G +  ++Y L W     LEL      IQ+WT  
Sbjct: 187 CGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTT 246

Query: 157 VPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIM-VCGAGKTGP 215
           V    ++ IF+V++   N+F  K Y E EF+    KVL + GF I A ++   GAG  G 
Sbjct: 247 VNADVFVVIFYVLIIFINVFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGY 306

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G +YW NPG +       D +  RF   +S+  +AAF +  +E + I A E +NPR+ +
Sbjct: 307 IGAKYWHNPGAF-----RGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAI 361

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYIS-SSPFVIAIENSGTKVLPH 334
           P A   +                     N  +L    S  + +SP+VIA+ + G +V+PH
Sbjct: 362 PSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPH 421

Query: 335 IFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFL 394
             NAVIL +++S  NS  Y   RI YS++  G AP +  +  + G P  A++ +++   +
Sbjct: 422 FINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVI 481

Query: 395 AYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMP 454
           A+   SS    VF WLL I+ ++  FTWI I +SHIRF +A+K QG S D++ FK++   
Sbjct: 482 AFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGV 541

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-P 509
           WG+ YAA             + AP         +FF  Y+++ +  V + G++I  R   
Sbjct: 542 WGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWK 601

Query: 510 LFIKTEDIDLDTDRREID-DVVWEEQKP-----RN--LWEK---FWA 545
           LFI+ +DIDL + R+  D +++ +E++      RN   W+K   FW 
Sbjct: 602 LFIRAKDIDLVSHRKIYDGELIKQEEEEFKERLRNGPFWKKVVAFWC 648

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  293 bits (751), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 185/562 (32%), Positives = 277/562 (49%), Gaps = 22/562 (3%)

Query: 1   MSLSKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTI 60
           + +SK     R  D       P + E+ +   +   V +T +K+A+K RH+ M+++G  I
Sbjct: 12  VEISKSNLVHRFVDSFRRAESPELEENDLEDGTRSIVTKTHLKKAMKSRHVVMMSIGTGI 71

Query: 61  GTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIP-VTSSFTVFTQRFL 119
           GTGL ++ +  L  +GP   +I Y+ +  + Y + Q+ GEMA   P +  SF  +T  F+
Sbjct: 72  GTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQAAGEMAVAYPTLPGSFNSYTSTFI 131

Query: 120 SPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVK 179
           S   G A  +L+++ W   F LEL      +++W D +    +I IF+  L   + F VK
Sbjct: 132 SKPFGFATVWLFFIQWLTVFPLELITASLTVKYWNDKINADVFIIIFYAFLLFIHFFGVK 191

Query: 180 YYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPVGFRYWRNPGPW--GPGIISKDV 236
            YGE EF     KVL + GFII + ++ CG AG  G +G +YW +PG +  GP I     
Sbjct: 192 AYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDGYIGAKYWHDPGSFADGPPIT---- 247

Query: 237 NEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXX 296
              RF G    L+SA F+Y G EL  ++  E  NPRK+ P A  +               
Sbjct: 248 ---RFKGVCFILVSAYFSYGGAELFSLSVNEQENPRKSTPAAAKQSIYRILIIYLATMIL 304

Query: 297 XXXXXXXNDPKLKSEDSYIS-SSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVG 355
                  N  +L    S  + +SP+V+A      KV+PH  NAVIL ++IS  NS +Y  
Sbjct: 305 IGFNVPHNSDELMGAGSAATHASPYVLAASLHSVKVVPHFINAVILISVISVANSALYAA 364

Query: 356 SRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITA 415
            R+  S+A  G APK+L +  + G P   ++  ++ G + ++ +SS    VF WL  I  
Sbjct: 365 PRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALFGVIGFVSASSKEEEVFTWLAAIAG 424

Query: 416 VAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTA 475
           ++  FTW  I +SHIRF QA+K  G S D++ FKA    WG+YY               A
Sbjct: 425 LSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKAVTGIWGSYYGCAFNILVFIAQFWVA 484

Query: 476 FAP-----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREID-D 528
            +P     K     FF +Y++  ++ VF+ G+ I+ R   +    E IDLD  RR  D D
Sbjct: 485 LSPPGSGGKCDAEAFFQSYLAAPIWLVFYFGYMIYKRDFTILNPLEKIDLDFHRRIYDPD 544

Query: 529 VVW---EEQKPRNLWEKFWAAI 547
            +    EE K R      WA I
Sbjct: 545 FIKQEDEENKERLKNSSIWARI 566

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  295 bits (755), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 185/559 (33%), Positives = 291/559 (52%), Gaps = 23/559 (4%)

Query: 3   LSKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGT 62
           +SKD  A+        ++     E + S +  G  +  ++K+ L+ RH+ +IALGG IGT
Sbjct: 68  ISKDQSASSNGTIHEELVMDVDLEKSPSAD--GDNEPRKLKQGLQSRHVQLIALGGAIGT 125

Query: 63  GLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTV-----FTQR 117
           GL +  S+ L   GP G  I+Y+ I  + Y +  +LGEM  F+P   S +         R
Sbjct: 126 GLLVGTSSTLHTCGPGGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTR 185

Query: 118 FLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFP 177
           ++  +LG A G+ Y+  + I  A E +    ++++WT AVP   WI +F +++ + N   
Sbjct: 186 YVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITVFLLVVVLLNFSA 245

Query: 178 VKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KTGPVGFRYWRNPGPWGPGIISKDV 236
           VK YGE EFW A IK+L IVG II +FI+  G G K   +GFRYW++PG +   +    +
Sbjct: 246 VKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFRYWQHPGAFAHHLTGGSL 305

Query: 237 NEGRFLGWVSSLISAAFTY-QGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXX 295
             G F    + +I  AF +  G ELV +T+ E A+ R+ + +A  +              
Sbjct: 306 --GNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTL 363

Query: 296 XXXXXXXXNDP----KLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSN 351
                   NDP     L        SSPFVI I+N+G KVLPHI N  IL++  SA N+ 
Sbjct: 364 SISVIVPYNDPVLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAF 423

Query: 352 VYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLL 411
           ++  +R   +MA  G APK L    + G+PY AV  + +   LAYL  SS  + VFNW  
Sbjct: 424 MFASTRSLLTMAQTGQAPKCLGKINRWGVPYVAVAASFLCSCLAYLNVSSSTADVFNWFS 483

Query: 412 NITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXX 471
           NI+ ++GF  WI   I+++RF +A+ + G+  D LPFK    P+  +++           
Sbjct: 484 NISTISGFLGWICGCIAYLRFRKAIFYNGL-YDRLPFKTWGQPYTVWFSLIVVSIITITN 542

Query: 472 XXTAFAPKF-KVSDFFTAYISVMLFFVFWIGFQIWFR--GPLFIKTEDIDLDTDRREIDD 528
               F PK+ KV+DF  AY+++ +F V W+G +++ R     ++   +ID+     EI++
Sbjct: 543 GYAIFIPKYWKVADFIAAYVTLPIFLVLWLGHKLYTRTWHQWWLPVSEIDVTRGLVEIEE 602

Query: 529 VVWEEQK----PRNLWEKF 543
              E ++    P ++ +KF
Sbjct: 603 KSREIEELRLPPTSIKDKF 621

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  294 bits (753), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 181/499 (36%), Positives = 266/499 (53%), Gaps = 18/499 (3%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSL 98
            + ++  LK RH+ MIA+GG IGTGLF+     L  AGP G LI +   GT+ +++  +L
Sbjct: 85  RSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWGITGTMIFTMVMAL 144

Query: 99  GEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVP 158
           GE+A   PV+  F  +  RF+  + G AN + Y   W +   LE+      + +W   V 
Sbjct: 145 GELAVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVAASITVDYWETPVR 204

Query: 159 LT-AWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
            T  ++A+FW+++ I N+F V+ YGE EF  + IKV+A++GFII   I+VCG G  G   
Sbjct: 205 YTDGFVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIILGIILVCGGGPVGGYV 264

Query: 218 F-RYWRNPGPWG---PGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
             RYW +PG +    PG         RF G+ S  ++AAF++ G+ELVGI + E+ NPRK
Sbjct: 265 GGRYWHDPGAFAGHSPG--------RRFKGFCSVFVTAAFSFAGSELVGIASAESKNPRK 316

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIAIENSGTKVL 332
           +VP+A  +V                      DP+L  S     S+SPFVIAI   G   L
Sbjct: 317 SVPQAAKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASASPFVIAIVTHGISGL 376

Query: 333 PHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLG 392
           P + N VIL +++S GNS++Y  SR   +++  G  PK + +  + G P   +   S  G
Sbjct: 377 PSVVNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPLVGIAICSGFG 436

Query: 393 FLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKF 452
            +A++ +S+    +FNWLL I+ ++ F TW  I   HIRF  ALK  G S D+LPFK+  
Sbjct: 437 LIAFVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDELPFKSPV 496

Query: 453 MPWGAYYAAXXXXXXXXXXXXTAFAP---KFKVSDFFTAYISVMLFFVFWIGFQIWFRG- 508
              G+Y+               A  P        DFF+AY++  +   F+I  ++W R  
Sbjct: 497 GIIGSYWGMCLAVLMLVAQFYNALFPIGSSPNAYDFFSAYLAAPIVLAFYIAHKLWKRNW 556

Query: 509 PLFIKTEDIDLDTDRREID 527
            L I  +DID+DT RRE D
Sbjct: 557 KLLIPLKDIDIDTGRRETD 575

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  294 bits (753), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 168/513 (32%), Positives = 274/513 (53%), Gaps = 22/513 (4%)

Query: 41  QVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGE 100
            + + L  RH+  +A+GG+IG GLF++    L++ GP   +I ++ I T  ++V  +LGE
Sbjct: 91  NLNKDLSIRHLITLAVGGSIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGE 150

Query: 101 MATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLT 160
           +A   PV   F V+  RF+ P++  A    Y   W +   LEL      I++W D +   
Sbjct: 151 LAAAYPVVGGFNVYITRFVDPSVAFAINLNYLAQWLVLLPLELVAASITIKYWNDTINSD 210

Query: 161 AWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVC-GAGKTGPVGFR 219
           AW+AIF+ ++ ++N+  VK +GE EF ++ +K+LAI+GF I   ++ C G  + G +G  
Sbjct: 211 AWVAIFYSVIALANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLACGGGPQGGFLGGH 270

Query: 220 YWRNPGPW---GPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           YW +PG +    PG         +F G  S  ++AAF+Y G EL  ++A E+ +PRKT+P
Sbjct: 271 YWHDPGSFVGDKPGT--------QFKGLCSVFVTAAFSYSGIELTAVSAAESKDPRKTIP 322

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSPFVIAIENSGTKVLPH 334
           +A  +                      +DP+L +  S +  ++SP VI+I+N+G K L  
Sbjct: 323 KATKRTFWLVTASYVTILTIIGCLVPFDDPRLLNGSSSVDAAASPLVISIKNAGIKGLDS 382

Query: 335 IFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFL 394
           + NA+IL +I+S  NS VY  SR   SMA  G  PK L+   K G P  A+L+T   G L
Sbjct: 383 LMNAIILISIVSVANSAVYACSRCMVSMAHIGNLPKVLSRVDKRGRPVNAILSTLFFGLL 442

Query: 395 AYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMP 454
           +++ +S   + VF WL  ++ ++  F W+ I+ SHIRF  A+K Q  + D+LP+ ++   
Sbjct: 443 SFIAASDKQAEVFTWLSALSGLSTIFCWMAINYSHIRFRAAMKVQNKTLDELPYLSQCGV 502

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-P 509
            G++Y              T+  P       V+ FF  Y+S+ +    ++G +++ R   
Sbjct: 503 IGSWYGVIVLFLVLVASFWTSLFPLGSGTADVTSFFEGYLSLPILIACYVGHKLYVRNLQ 562

Query: 510 LFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEK 542
           + +K ED+DL+T R+ ID     E +   L EK
Sbjct: 563 VLVKLEDMDLETGRKHIDA---HEHRAEILAEK 592

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  293 bits (751), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 170/510 (33%), Positives = 272/510 (53%), Gaps = 15/510 (2%)

Query: 36  SVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVT 95
            + + +++R+++PRH++M+++   IGTGL ++    L   GP G +I Y  +  +AY + 
Sbjct: 73  DLTDGRLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGLIIGYAAVSVVAYIMM 132

Query: 96  QSLGEMATFIP-VTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
           Q+ GEMA   P +  +F  ++  F+S   G A+ +LY L W   F LEL      I++WT
Sbjct: 133 QAAGEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVFPLELITASLTIKYWT 192

Query: 155 DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKT 213
           D+V    +IAIF+V +   + F  + YGE EF     KVL I GF+I A ++ CG AG +
Sbjct: 193 DSVNADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIAGFVILAIVINCGGAGNS 252

Query: 214 GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
           G +G RYW +PG +  G  +      +F G+   L++  F+Y GTEL  +T  E ++PR+
Sbjct: 253 GYIGARYWHDPGAFAVGDPAS-----KFKGFCYVLVTGYFSYGGTELYAMTVNEQSSPRR 307

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSE--DSYISSSPFVIAIENSGTKV 331
            +  A  +                         +L      S   +SP+V+A+   G KV
Sbjct: 308 AIHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGKSATHASPYVLAVSLHGVKV 367

Query: 332 LPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVL 391
           +PHI NAVIL  ++S GNS +Y G R+  ++A  G APK+L +  ++G P  A++  SV+
Sbjct: 368 VPHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLAYIDRAGRPLMALIACSVI 427

Query: 392 GFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAK 451
           G LA++ +S     VF WL  I  ++  FTW  I +SHIRF QA+K+ G S   L +K+ 
Sbjct: 428 GLLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFRQAMKYHGYSLSQLGYKSI 487

Query: 452 FMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTAYISVMLFFVFWIGFQIWF 506
              WG+ Y               A AP     K  V  FF +Y++  L+FVF++G+ ++ 
Sbjct: 488 TGLWGSIYGVCFNILVFVAQFWVALAPIGNNGKTDVLSFFQSYLAFPLWFVFFLGYMVYS 547

Query: 507 RGPLFIK-TEDIDLDTDRREIDDVVWEEQK 535
              + ++  +DID++  R   D+   E++K
Sbjct: 548 GEWMILRPLKDIDINHFRCVYDEERIEQEK 577

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  293 bits (749), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 173/519 (33%), Positives = 268/519 (51%), Gaps = 18/519 (3%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSL 98
           + ++K+ +K RHI+MI+LG  IGTGL ++    L   GP G +I Y+   T+ Y V Q+ 
Sbjct: 73  QKKMKQTMKSRHITMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVTTSTMLYCVIQAC 132

Query: 99  GEMA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAV 157
            E+  ++  +  ++  +    +      A  ++Y L WAI   LEL      I++W D++
Sbjct: 133 CELGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSSMTIKYWNDSI 192

Query: 158 PLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
               ++AIF+  +   + F  + Y E EF     KVL +VGFII    + CGA K+G +G
Sbjct: 193 NPDVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISVNCGASKSGYIG 252

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
            +YW  PG +   +  K ++   F G  S  + +AF Y G+E + +TA E  NPRK+VP+
Sbjct: 253 GKYWHTPGAF---VGEKAIDH--FKGICSVWVQSAFAYGGSEFIALTAAEQTNPRKSVPK 307

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISS--SPFVIAIENSGTKVLPHI 335
           A  +                      + P L       +S  SPFVIA  + G KV+PHI
Sbjct: 308 ATKRWLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQAASHASPFVIAAASHGVKVVPHI 367

Query: 336 FNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLA 395
            NAVIL ++IS GNS  Y   RI  S+A  G+ PK  T+  + G P   +L  ++ G ++
Sbjct: 368 INAVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLVTMLFVAIFGLIS 427

Query: 396 YLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++ +S     VF WL  I +++  FTW  IS+SHIRF  A+K QG S  +L +KA    W
Sbjct: 428 FVAASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSLGELGYKANTGYW 487

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-P 509
           G++YA              A AP     K  V++FF  Y++  +   F+ G+++W+R   
Sbjct: 488 GSWYAIAFNIIVLAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVFFYFGYKLWYRDWK 547

Query: 510 LFIKTEDIDLDTDRREID-DVVWE---EQKPRNLWEKFW 544
           LFI  + +DL++ R+  D D++ +   E K R     FW
Sbjct: 548 LFIPADKVDLESHRKIFDADLIKQEDFEHKERIRNSSFW 586

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  292 bits (747), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 184/555 (33%), Positives = 271/555 (48%), Gaps = 37/555 (6%)

Query: 7   YEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFI 66
           Y    EK+GS L  KP   +               +K+ LK  HI +IA+GG IGTGLF+
Sbjct: 31  YSNDSEKNGS-LPNKPQSGDH-------------NLKKGLKSAHIQLIAIGGCIGTGLFV 76

Query: 67  SISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIP-------VTSSFTVFTQRFL 119
             S+ L   GP G  I+Y  + T+ Y V  +L EM  F+P          S +    R++
Sbjct: 77  GTSSTLYKCGPAGLFISYCIMSTIIYPVMNALAEMVCFLPGLPDENETGGSISTLCTRYV 136

Query: 120 SPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVK 179
             +LG A G+ Y   + I  A E +    ++ +WT AVP  AWI IF  I+ + N   V+
Sbjct: 137 DSSLGFAVGWNYVYCYVILVAAECTAASGVVTYWTTAVPKAAWITIFLGIIVVLNCTAVE 196

Query: 180 YYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNE 238
           +YG  E     +K+  I+G II + ++  G G     +GFR+W++PG W   +   D   
Sbjct: 197 FYGTSEAIFCSLKIFCILGIIIVSIVLFFGGGPNHDRLGFRFWKDPGAWAYHL--ADGGA 254

Query: 239 GRFLGWVSSLISAAFTY-QGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXX 297
           GR    ++ +I A F +  G ELV +T+ EA + R+ + +A  +                
Sbjct: 255 GRLSDIITGVIRAGFAFILGPELVVLTSTEAQDSRRNIEKAARRFVWRLIFFYCVSSLCA 314

Query: 298 XXXXXXNDPKLKSEDSY----ISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVY 353
                 NDP L +  S       SSPFVI I+N+G KVLPHI N  ILS+  S+GNS +Y
Sbjct: 315 GVIVSRNDPVLLNALSQGKPGAGSSPFVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMY 374

Query: 354 VGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNI 413
             +R   S++  G APK      + G+PY  V   +    LAYL  SS  + VFNW  NI
Sbjct: 375 ATTRSLLSLSQEGYAPKIFNRVNRWGVPYTGVAFATAFSCLAYLNVSSSTADVFNWFSNI 434

Query: 414 TAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXX 473
           + ++GF  WI   ++++RF +A+    +  D LPFK  F P+  ++              
Sbjct: 435 STISGFLGWICSGVAYLRFRKAVFFNNL-YDRLPFKTPFQPYFTWFYIILIAIICLINGY 493

Query: 474 TAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFR--GPLFIKTEDIDLDTDRREIDDVVW 531
            +F   +   DF  AYI++ LF + W+G + + R      I   +ID+ T  REI++   
Sbjct: 494 ESFV-HWNYKDFIAAYITLPLFLILWLGHKAYTRTWSQWMISVSEIDVTTGLREIEEETK 552

Query: 532 EEQK----PRNLWEK 542
           E       PRNLWEK
Sbjct: 553 ELNARRIPPRNLWEK 567

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  293 bits (749), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 174/529 (32%), Positives = 276/529 (52%), Gaps = 22/529 (4%)

Query: 19  IIKPSIAEDAVSMESLG-SVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGP 77
           +I P+++E     E L        + R LK RH+ MIA+GG IG GLF+     L+ AGP
Sbjct: 63  VIDPNLSE----AEKLAIRTAAAPLSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGP 118

Query: 78  VGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAI 137
            G LI +    T+   +  SLGE+A   PV+  +  +  RF+  + G AN + Y +   +
Sbjct: 119 AGVLIGWGLTATMILIMCLSLGELAVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMV 178

Query: 138 TFALELSVVGQIIQFW-TDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAI 196
              LE+      + +W TD     A++A+FWV++   NLF V+ +GE E   + IKV+ I
Sbjct: 179 VMPLEIVAASVTVGYWDTDPKYKLAFVALFWVVIVSINLFGVRGFGEAESIFSLIKVITI 238

Query: 197 VGFIIYAFIMVCGAGKTGPV-GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY 255
           +GFII   +++ G G    V G +YW +PGP+       +    +F G  S  ++AAF++
Sbjct: 239 IGFIIMGVVLISGGGPDHEVIGGKYWNDPGPF-----VGNAPSDKFKGVCSVFVTAAFSF 293

Query: 256 QGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI 315
            G+EL+G+ A E   PRK++P+A  +V                     N+  L +     
Sbjct: 294 AGSELIGLAAAETREPRKSIPKAAKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQID 353

Query: 316 SS-SPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTW 374
           ++ SPFVIA++    +VLP I N VIL+ +IS GNS+VY  SR   ++A +G  PK   +
Sbjct: 354 AAHSPFVIAMDMHRIRVLPSIINVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGY 413

Query: 375 TTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQ 434
             + G P  A+  TS+ G L ++  +     +F+WLL I+ ++ FFTW+ I+++H+RF  
Sbjct: 414 IDRKGRPLFAICFTSLFGLLCFVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRM 473

Query: 435 ALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP--------KFKVSDFF 486
           ALK QG + ++L F +     G+ YA              A  P        K     FF
Sbjct: 474 ALKAQGRTTNELSFTSPTGFIGSCYAVGLICVVLVAQFWVALYPPSPDGTSAKPSPILFF 533

Query: 487 TAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQ 534
             Y+S  +  V ++  +IW R    FIK +++D+DT RRE+D  +++E+
Sbjct: 534 KQYLSFAVAIVMYLAHKIWSRNWKFFIKAKEMDIDTGRRELDLELFKEE 582

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  290 bits (742), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 166/473 (35%), Positives = 257/473 (54%), Gaps = 9/473 (1%)

Query: 32  ESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLA 91
           E++G   +T ++R  K RH+ M+A+ G IGTGL I   T L   GP   LIA++F G+L 
Sbjct: 37  EAIGESSQT-LQRGFKQRHVDMLAIAGAIGTGLVIGTGTALKRGGPGSLLIAFIFTGSLL 95

Query: 92  YSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQ 151
             V  SL EMA+F P+  SF+ +  R++ PALG A G+ Y+L +AI  A ELS +G ++Q
Sbjct: 96  IGVLMSLAEMASFAPMDKSFSGYATRYVDPALGFATGWNYFLKYAIALASELSAIGLLVQ 155

Query: 152 FWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG 211
           +W + + +  +I +F V+L   N   +K+YGEVEFW A +K L ++   +   ++ CG G
Sbjct: 156 YWREDLSIAIFIVVFLVVLLSLNFMNIKFYGEVEFWSALLKFLVLIICFVTGLVLTCGGG 215

Query: 212 KTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAAN 270
            +   +GFRYWR    + P ++      GRFLGW + +I + + Y G+E +G+  GEA N
Sbjct: 216 PSKETIGFRYWREYA-FVPYLVKG--TTGRFLGWWACVIQSCYAYIGSETIGVVFGEAPN 272

Query: 271 PRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIAIENSGT 329
           P+KT+P A   V                     +D  L  ++ S  S SPFVIA  N+G 
Sbjct: 273 PKKTIPAATRNVIFRITGFYIVGVLILGLIISPHDKTLANAKTSDASGSPFVIAFTNAGI 332

Query: 330 KVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTS 389
           K LP   NA+++  I SA N+ +YV SR AY +A +G+APK      + G+P+   L   
Sbjct: 333 KGLPSFINAMLIMFIASAANTALYVCSRTAYGLAKDGMAPKIFLAQNRYGVPFNGCLLAG 392

Query: 390 VLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFK 449
           ++  L+++  S+ +S +F +L +   V G   W+ + IS+I + +A     + RD +PF+
Sbjct: 393 LISLLSFMNISNSSSVIFGYLTSSVTVFGTLNWLSVLISYIGYERARVFHDVPRDRIPFR 452

Query: 450 AKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFF---VFW 499
             F P+ AY               +AF   FK   F  +YI + +F    +FW
Sbjct: 453 MWFQPYSAYVCLFFVSLIIFFNGYSAFIAGFKYKSFIVSYIGIAVFIGNTLFW 505

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  291 bits (746), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 170/508 (33%), Positives = 263/508 (51%), Gaps = 14/508 (2%)

Query: 40  TQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLG 99
           + +K+A+K RH+ M+ +G  IGTGL ++ ++ LS  GP   +I Y+ +  + Y + Q+ G
Sbjct: 73  SHLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQAAG 132

Query: 100 EMATFIP-VTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVP 158
           EMA   P +  +F  +T  F+S   G A  +L+++ W   F LEL      I++W D + 
Sbjct: 133 EMAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWLTVFPLELITASLTIKYWNDKIN 192

Query: 159 LTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPVG 217
              +I IF+V L   + F VK YGE EF     KVL I GFII + ++ CG AGK G +G
Sbjct: 193 ADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKDGYIG 252

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
            +YWR+PG +  G    D  E +F G    L++A F+Y G EL  ++  E  NPRK+ P+
Sbjct: 253 AKYWRDPGSFAEG----DSVE-KFKGICYILVTAYFSYGGAELFSLSVNEQENPRKSTPQ 307

Query: 278 AINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIF 336
           A  + +                     ND  + S  S   +SP+V+A    G KV+PH  
Sbjct: 308 AAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHGVKVVPHFI 367

Query: 337 NAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAY 396
           NAVIL ++IS  NS +Y   R+  S+A  G APK+L +  + G P  A++  +V G + +
Sbjct: 368 NAVILISVISVANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCAVFGVIGF 427

Query: 397 LESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWG 456
           + +SS    VF WL  I  ++  FTW  I +SH+RF Q +K  G S +++ F+A    WG
Sbjct: 428 VSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFRAVTGIWG 487

Query: 457 AYYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLF 511
           + Y               A AP     K     FF +Y++  ++  F+ G+ ++ R   F
Sbjct: 488 SMYGISFNMLVFIAQFWVALAPPSLHGKVDAESFFQSYLAAPIWLFFYFGYMLYKRDFTF 547

Query: 512 -IKTEDIDLDTDRREIDDVVWEEQKPRN 538
            +  + IDL+  RR  D  +  ++   N
Sbjct: 548 LVPLDKIDLNFHRRIYDPELIRQEDEEN 575

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  291 bits (746), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 176/540 (32%), Positives = 269/540 (49%), Gaps = 19/540 (3%)

Query: 8   EATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFIS 67
           ++ R  +   L     + +   SM S        +K+++K RH+ M++LG  IGTGL ++
Sbjct: 57  DSFRRAESQRLEDDNDLEDGTRSMRS-----NNHLKKSMKSRHVVMMSLGTGIGTGLLVA 111

Query: 68  ISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIP-VTSSFTVFTQRFLSPALGSA 126
            +  L  AGP   +I Y+ +  + Y + Q+ GEM    P +  +F  +   F+S + G A
Sbjct: 112 NAKGLKLAGPGSLVIGYVLVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFVSKSFGFA 171

Query: 127 NGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEF 186
             +L+ + W     LEL      I++W D +    +IAIF+V L   + F VK YGE EF
Sbjct: 172 TTWLFCIQWLTVLPLELITSSMTIKYWNDTINADVFIAIFYVFLLFIHFFGVKAYGETEF 231

Query: 187 WIACIKVLAIVGFIIYAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWV 245
                K+L I GFII + I+ CG AG  G +G  YWRNPG +  G      +  RF G  
Sbjct: 232 IFNSCKILMIAGFIILSVIINCGGAGVDGYIGGEYWRNPGSFADG-----SSATRFKGIC 286

Query: 246 SSLISAAFTYQGTELVGITAGEAANPRKTVPRAINK-VXXXXXXXXXXXXXXXXXXXXXN 304
             L++A F++ G EL  ++  E ANPRK+ P A  + +                     N
Sbjct: 287 FILVTAYFSFGGIELFVLSINEQANPRKSTPVAAKRSIYRILIIYLLTMILIGFNVPHDN 346

Query: 305 DPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAM 364
           D  + S  S   +SP+V+A    G KV+PHI NAVIL ++IS  NS +Y   R+  S+A 
Sbjct: 347 DQLMGSGSSATHASPYVLAASIHGVKVIPHIINAVILISVISVANSALYAAPRLMCSLAQ 406

Query: 365 NGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWIL 424
            G APK+L +  + G P  A++  S +G + ++  SS     F WL  I  ++  FTW  
Sbjct: 407 QGYAPKFLNYIDREGRPLRALVVCSFVGLVGFVACSSQEEQAFTWLAAIAGLSEIFTWSG 466

Query: 425 ISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----K 479
           I +SHIRF +A+K QG S D++ +K+    WG+YY               A +P     K
Sbjct: 467 IMLSHIRFRKAMKVQGRSLDEVGYKSNTGIWGSYYGVIFNILVFMAQFWVALSPPGSDGK 526

Query: 480 FKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQKPRN 538
             V  FF +Y++  L+   ++G+ I+ +   L    + IDLD  RR  D  +  ++   N
Sbjct: 527 CDVESFFQSYLAAPLWIFMYLGYMIYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQEDEEN 586

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  292 bits (748), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 180/531 (33%), Positives = 280/531 (52%), Gaps = 22/531 (4%)

Query: 23  SIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALI 82
           + AE    M S+    E  +K+ +KPRH+ MI+LG  IGTGL +   + L  AGP G + 
Sbjct: 95  TTAEPEAEMASV----EDNLKQTIKPRHVIMISLGTGIGTGLLVGNGSALVKAGPAGLVT 150

Query: 83  AYMFIGTLAYSVTQSLGEMAT-FIPVTSSFTVFTQRFLSPA--LGSANGYLYWLSWAITF 139
            Y  +GT  Y + QS GEMA  +  +   F  +    + P   +    G L+ +   ++F
Sbjct: 151 GYAIMGTCVYCIIQSAGEMAVVYSKLNGGFNAYPTMLVEPGFWVCCRLGVLFTMVDCLSF 210

Query: 140 ALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGF 199
            +         ++WT  V    ++ IF+V++ + N+F  + Y E EF+  C KVL + GF
Sbjct: 211 GIGYCF--DDYKYWTTRVDPDVFVVIFYVLIIVINVFGARGYAEAEFFFNCCKVLMMAGF 268

Query: 200 IIYAFIM-VCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGT 258
            I   I+ V GAG  G +G  YWRNPG +       D     F G V++L++AAF + GT
Sbjct: 269 FILGIIINVGGAGNDGYLGNIYWRNPGAF-----RGDKGIDHFKGVVATLVTAAFAFGGT 323

Query: 259 ELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISS 317
           E + +TA E +NPRK +P A  KV                       P+L  S  +  ++
Sbjct: 324 EFIALTAAEQSNPRKAIPSAAKKVLYRIVLVYLTSIILIGFLVPFTSPELLGSGSAATAA 383

Query: 318 SPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTK 377
           SP+VIA+ + G +V+PH  NAVIL +++S GNS  Y  SR+  S++  G APK+  +  +
Sbjct: 384 SPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSKQGYAPKWFDYVDR 443

Query: 378 SGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALK 437
            G P  A++ +++ G +A+  +S   + VF WLL I+ ++  FTWI I +SHIRF  A+K
Sbjct: 444 EGRPSRAMIVSALFGVIAFCATSPKETEVFTWLLAISGLSQIFTWISICLSHIRFRAAMK 503

Query: 438 HQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVM 493
            QG S  ++ FKA+   WG+YY+              A AP    +    +FF  Y+++ 
Sbjct: 504 AQGRSMGEVGFKAQTGIWGSYYSIFLMILTLIGQFWVAIAPIGTAELSARNFFENYLAMP 563

Query: 494 LFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKF 543
           +   F+ G++IW +   L+IK EDIDL + R+  D+ +  +Q+   L EK 
Sbjct: 564 ILIGFYFGYKIWKKDWTLYIKAEDIDLISHRQIFDEELL-KQEDYELKEKL 613

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  289 bits (739), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 174/517 (33%), Positives = 263/517 (50%), Gaps = 21/517 (4%)

Query: 20  IKPSIAEDAVSMESLGSVKE----TQVKRALKPRHISMIALGGTIGTGLFISISTPLSNA 75
           ++P IAE  +      S+ E    + VKRALK RHIS++ALGG IG G  I     L+  
Sbjct: 16  LEPKIAEVELQRLETDSLNEFDPHSGVKRALKNRHISLLALGGIIGPGCLIGAGNALNKG 75

Query: 76  GPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSW 135
           GP+  L+ +  IG + +S+ +S+GE+ T  P    F    +RF S  L + +GY Y + +
Sbjct: 76  GPLALLLGFGIIGLVCFSIMESIGELVTLYPSGGGFITLARRFHSEGLSAVSGYAYIVVF 135

Query: 136 AITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLA 195
               A E + +  I+QFW   VP+  +  IFW    +  L  V  +GE E+W+A  K+L 
Sbjct: 136 FAVLANEYNTISSILQFWGPQVPIYGYTLIFWFFFLVFQLIGVGAFGECEYWLAWFKILG 195

Query: 196 IVGFIIYAFIMVCGA--GKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAF 253
           +V F I++ + + G   GK  P+GF+YW+NPG    G          F G     +  + 
Sbjct: 196 LVAFYIFSIVYMSGGIPGKP-PIGFQYWKNPGALSHG----------FRGIAVVFVFCST 244

Query: 254 TYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDS 313
            Y GTE V + A E+ NPRK VP A+ +                      NDP L ++  
Sbjct: 245 FYSGTESVALAATESRNPRKAVPLAVRQTFWRILIVYLGISFFYGVTVPYNDPTLGAQTK 304

Query: 314 YISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLT 373
            +  SP  IA+  +G     H+ NA IL T ISA NS++Y+GSR    +A  GLAP+ L 
Sbjct: 305 SL-KSPISIALSRAGWAGGVHLVNAFILMTCISAINSSLYIGSRTLSHLAHEGLAPRILA 363

Query: 374 WTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFM 433
           WT K G+P  A++  + LG ++ +  S GAS  +N+++N++ V  F  W  ISI+H+RF 
Sbjct: 364 WTDKRGVPVPALIVFNALGLISLMNVSVGASNAYNYIVNLSGVGVFIVWSAISITHLRFR 423

Query: 434 QALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVM 493
           +A   QG S  +LP++A F PW   ++             T+  P F   DF  AYI + 
Sbjct: 424 KAWVAQGRSLSELPYRALFYPWTTIFSLAANIFLALIQGWTSLVP-FVAKDFVDAYILLP 482

Query: 494 LFFVFWIGFQIW-FRGPLFIKTEDIDLDT-DRREIDD 528
              + ++G   W  R    +    I+L+   RR++D+
Sbjct: 483 AAGLLYVGINFWKNRNFKTVNIHGINLEEGQRRDLDE 519

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  290 bits (741), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 176/493 (35%), Positives = 259/493 (52%), Gaps = 17/493 (3%)

Query: 42  VKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEM 101
           +KR LK RH+ MIA+GG IGTGLF+     L+ AGP G LI +   GT+ Y +  ++GE+
Sbjct: 76  LKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAMGEL 135

Query: 102 ATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFW-TDAVPLT 160
           A   P+   FT +  RF+  + G A   +Y L W +   LE+      + +W T      
Sbjct: 136 AVTFPIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYRD 195

Query: 161 AWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGF-R 219
            ++A+F+V++   N F VK YGE EF  + IKV+ ++G+II   I+VCG G  G     R
Sbjct: 196 GFVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGGR 255

Query: 220 YWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAI 279
            W NPG +  G          F G  S  ++AAF++ G+ELVG+ A E ANPRK++P A 
Sbjct: 256 LWHNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSLPSAA 305

Query: 280 NKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPHIFNA 338
            +V                        +L  + S   ++SPFVI+I+N+G K LP + N 
Sbjct: 306 KQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINV 365

Query: 339 VILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLE 398
           VIL  ++S GNS V+  SR   ++A  G  PK   +  ++G P   ++ T V G L+++ 
Sbjct: 366 VILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLSFIA 425

Query: 399 SSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAY 458
           +S     VF+WLL ++ ++  FTW  I + HIR  +AL  Q  +  +L F A    WG+ 
Sbjct: 426 ASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPTGVWGSV 485

Query: 459 YAAXXXXXXXXXXXXTAFAP---KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKT 514
           Y               A  P   K   S FF AY+S  +   F+IG +IW +   LFI+ 
Sbjct: 486 YGFVLIILILMAQFWIALFPIGDKPSASAFFEAYLSFPILIAFYIGHKIWKKNWKLFIRA 545

Query: 515 EDIDLDTDRREID 527
           ++ID+DT RRE D
Sbjct: 546 KNIDIDTGRRETD 558

>Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)
          Length = 523

 Score =  287 bits (734), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 169/508 (33%), Positives = 264/508 (51%), Gaps = 18/508 (3%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSL 98
            T VKRALK RHIS++ALGG IG G  +     L   GP+  L+ ++ IG +A++V +S+
Sbjct: 29  NTGVKRALKNRHISLLALGGIIGPGCLVGAGNALQKGGPLALLLGFVIIGIIAFAVMESI 88

Query: 99  GEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVP 158
           GEM T  P    FT   +RF S AL +  GY Y + +    A E + +  I+QFW   VP
Sbjct: 89  GEMITLYPSGGGFTTLARRFHSDALSAVCGYAYVIVFFAVLANEYNTLSSILQFWGPQVP 148

Query: 159 LTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPV-G 217
           L A+  IFW++  I  L  V  +GE E+W++ +K+L ++ + I++ I + G  +  P  G
Sbjct: 149 LYAYTLIFWIVFEIFQLIGVGVFGETEYWLSLLKILGLIVYYIFSIIYMSGGVRNKPAFG 208

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           F YW++PG    G          F G     +  +  Y GTE V +TA E+ NP K+VP 
Sbjct: 209 FHYWKDPGSLSHG----------FKGIAVVFVFCSSFYSGTESVALTATESKNPTKSVPY 258

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           A+ +                      NDP L S ++ +  SP  IAI  +G     H+ N
Sbjct: 259 AVRQTLWRIVVVYIGIAIFYGSTVPFNDPNL-SVNTKVLKSPIAIAISRAGWAGGSHLVN 317

Query: 338 AVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYL 397
           A IL + ISA N ++Y+GSR   ++A  GLAPK+L WT K G+P  A+   + LG ++ +
Sbjct: 318 AFILFSCISAINGSLYIGSRTLTNLAYEGLAPKFLAWTDKRGVPIPAITIFNALGLISLM 377

Query: 398 ESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
             S GAS  +++++N++ V  F  W +IS +H+R  +A   QG   ++LP+KA F PW  
Sbjct: 378 NMSVGASNAYSYIVNLSGVGVFIVWGVISYTHLRLRKAWVAQGRLLEELPYKALFYPWTP 437

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLF--IKTE 515
            ++             T+  P FK  +F  AYI +    + ++G  + F+   F  +   
Sbjct: 438 IFSLISNIFLALIQGWTSLVP-FKAPEFVDAYILLPAAIILYVGVCV-FKNHNFRIVDLT 495

Query: 516 DIDLDTDRREIDDVVWEEQKPRNLWEKF 543
            ++LD  RR+  D+  ++    ++   F
Sbjct: 496 SVNLDEGRRK--DMENDQSDQESILSSF 521

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  289 bits (740), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 176/496 (35%), Positives = 267/496 (53%), Gaps = 12/496 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSL 98
           +T +K  LK RH+ MIA+GG IGTGL +     L   GP   LI +  +GT+ Y++  +L
Sbjct: 82  QTPLKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWGSMGTMIYAMVMAL 141

Query: 99  GEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFW-TDAV 157
           GE+A   P++  FT +  RF+  + G A  + Y L W +T  LE+      + +W TD  
Sbjct: 142 GELAVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVSASITVNYWGTDPK 201

Query: 158 PLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KTGPV 216
               ++A+FW+++   N+F VK YGE EF  + IKV+ I+GFII   I+ CG G + G +
Sbjct: 202 YRDGFVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGIILNCGGGPEKGYI 261

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           G +Y+ +PG +     + D    +F G  S  ++AAF++ G+ELVG+ A E+ +PRK+VP
Sbjct: 262 GGKYFHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVDPRKSVP 316

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPHI 335
           +A  +V                     ND +L    S   ++SPFVIAI   G K LP +
Sbjct: 317 KAAKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSVDAAASPFVIAIVTHGIKGLPSV 376

Query: 336 FNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLA 395
            N VIL  ++S GNS ++  SR   ++A  G  P+   +  + G P   ++ TS +G +A
Sbjct: 377 VNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPLVGIIITSAVGLIA 436

Query: 396 YLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++ +S+    VFNWLL ++ ++  FTW  I I HIRF +AL  QG S D+L FK+    W
Sbjct: 437 FVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRSVDELSFKSPTGVW 496

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP---KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLF 511
           G+Y+               A  P         FF AY+S  L    +IG +I+ R   L 
Sbjct: 497 GSYWGLFMIVIMFIAQFYVALFPVNGSPSAEGFFEAYLSFPLVLAMYIGHKIYKRNWKLL 556

Query: 512 IKTEDIDLDTDRREID 527
           I   ++D+D+ RRE+D
Sbjct: 557 IPAGEMDIDSGRREVD 572

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  288 bits (737), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 177/504 (35%), Positives = 269/504 (53%), Gaps = 14/504 (2%)

Query: 41  QVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGE 100
           Q+ + L  RH+  +A+GG IGTGLF++    LS+ GP   +I ++ I T  ++V  SLGE
Sbjct: 95  QMNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPASLVIDWVIISTCLFTVVNSLGE 154

Query: 101 MATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLT 160
           +A   PV   F V+  RF+ P+ G A    Y   W +   LEL      I++W D +   
Sbjct: 155 LAAAFPVVGGFNVYITRFIDPSFGFAVNINYLAQWLVLLPLELVAASITIRYWNDKINSD 214

Query: 161 AWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVC-GAGKTGPVGFR 219
           AW+AIF+  +  +N+  VK +GE EF ++ IK+LAIVGF I   ++ C G  K G +G +
Sbjct: 215 AWVAIFYAAIAFANMLDVKSFGETEFILSMIKILAIVGFTILGIVLSCGGGPKGGYIGGK 274

Query: 220 YWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAI 279
           YW +PG +       + +  +F G  S  ++AAF+Y G EL  ++A E+ NPR+T+P+A 
Sbjct: 275 YWHDPGAF-----VGETSGTKFKGLCSVFVTAAFSYSGMELTAVSAAESLNPRETIPKAA 329

Query: 280 NKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSPFVIAIENSGTKVLPHIFN 337
            +                      N+PKL +  S +  +SSP VIAIEN G + LP + N
Sbjct: 330 KRTFWLITLSYVTILTLIGCLVPYNNPKLLNGSSSVDAASSPLVIAIENGGIRGLPSLMN 389

Query: 338 AVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYL 397
           A+IL  I+S  NS VY  SR   SMA     P++L    + G P  A L T   G L+++
Sbjct: 390 AIILIAIVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRKGRPLNATLLTLFFGLLSFI 449

Query: 398 ESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
            +S     VF WL  ++ ++  F W+ I++SHIRF QA+ HQGIS D+LP+ +     G+
Sbjct: 450 AASDKQEEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAHQGISLDELPYISMTGVSGS 509

Query: 458 YYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRGP-LFI 512
           +Y              T+  P        + FF  Y+S  +  V ++G +++ R   L I
Sbjct: 510 WYGVIVLFLVLVASFWTSLFPLGGKGADATSFFEGYLSFPILIVCYVGHKLYIRKKRLLI 569

Query: 513 KTEDIDLDTDRREID-DVVWEEQK 535
              D+DL +DR+ +D +V  EE +
Sbjct: 570 DVADMDLVSDRKVVDVEVCREEMR 593

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  288 bits (736), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 174/517 (33%), Positives = 269/517 (52%), Gaps = 16/517 (3%)

Query: 33  SLGSVK-ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLA 91
           S+ SV+  ++ K+++K RH+ M++LG  IGTGL ++    L   GP G LI Y  +  +A
Sbjct: 72  SINSVRSNSKFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGPAGLLIGYSLVSVVA 131

Query: 92  YSVTQSLGEMATFIP-VTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQII 150
           Y + Q+ GEMA   P +  +F V++  F+S + G A  +LY L W     LEL      I
Sbjct: 132 YIMMQAAGEMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWLTVLPLELITASLTI 191

Query: 151 QFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGA 210
           ++W  ++   A+IAIF+ ++   + F    YGE EF  +  KV  I GFII + ++ CG 
Sbjct: 192 KYWNSSINPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSMIAGFIILSIVINCGG 251

Query: 211 GKTGPVGF-RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAA 269
             TG      YWRNPG +  G        G F G    L++A F+Y G EL  +T  E A
Sbjct: 252 AGTGGYIGGEYWRNPGAFAGG-----SPIGHFKGIAYVLVTAYFSYGGMELFALTVNEQA 306

Query: 270 NPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL--KSEDSYISSSPFVIAIENS 327
           NPRK VP A  K                      N  +L   S  S   +SP+VIA+ + 
Sbjct: 307 NPRKAVPSATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSGKSATHASPYVIAVASH 366

Query: 328 GTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLT 387
           G KV+PHI NAVIL +++S GNS +Y   R+  S+A  G APK  ++  ++G P  A++ 
Sbjct: 367 GVKVVPHIINAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYVDRAGRPLVALVG 426

Query: 388 TSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLP 447
            S+ G L+++ +S     VF WL  I  ++  FTW  I +SH+RF  A+K+QG S  +L 
Sbjct: 427 CSIFGLLSFVAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRDAMKYQGYSLSELG 486

Query: 448 FKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTAYISVMLFFVFWIGF 502
           +K+K   WG+ YA              A AP     K     FF +Y++  ++   ++G+
Sbjct: 487 YKSKTGYWGSIYAIFFNIIVFVAQFWVALAPIGNGGKADAEAFFQSYLAFPIWISCYVGY 546

Query: 503 QIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQKPRN 538
           +I+ +   L +  ++IDL++ R   D  + +++   +
Sbjct: 547 KIYSKEWKLLVPLDEIDLNSHRHIFDKHILQQEDDEH 583

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  288 bits (736), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 178/501 (35%), Positives = 264/501 (52%), Gaps = 14/501 (2%)

Query: 42  VKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEM 101
           ++  LK R  +MIA+GG IG+GLF+  ST L   GP G +I +    T+ YS+  +LGE+
Sbjct: 103 LQHTLKGRQQTMIAIGGAIGSGLFVGSSTALRTGGPAGLIIGWGLTSTMIYSMVMALGEL 162

Query: 102 ATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFW-TDAVPLT 160
           A   PV   FT +  RF+  + G AN + Y L W +   LE+      + +W T      
Sbjct: 163 AVVFPVAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEIVSASITVNYWGTPTRYRD 222

Query: 161 AWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGF-R 219
            ++A+FW+++ I N+F VK +GE EF  + IKV  ++GFII   ++VCG G  G     +
Sbjct: 223 GFVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTTVIGFIILGIVLVCGGGPKGGFVGAK 282

Query: 220 YWRNPGPW-GPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRA 278
           YW +PG + G G      +  +F G  S  ++AAF++ G+EL+GITA EAANPRK++P A
Sbjct: 283 YWHDPGAFVGHG------SGAQFKGVCSVFVTAAFSFAGSELIGITAAEAANPRKSIPGA 336

Query: 279 INKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPHIFN 337
             +V                     ND +L    S   ++SPFVIAI   G K LP + N
Sbjct: 337 AKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGASSVDAAASPFVIAIVTHGIKGLPSVIN 396

Query: 338 AVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYL 397
            VIL  ++S GNS ++  SR   +++  G  PK   +  +SG P   +  TS  G LA++
Sbjct: 397 VVILIAVLSVGNSAIFACSRTIAALSDQGFLPKVFGYIDRSGRPLVGIAITSTFGLLAFV 456

Query: 398 ESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
            +S     VFNWLL ++ ++  FTW  I + HIRF  ALK QG   ++L F +     G+
Sbjct: 457 AASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRMALKAQGRDTNELTFVSPAGVAGS 516

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFKVSD---FFTAYISVMLFFVFWIGFQIWFRG-PLFIK 513
           Y+               A  P     D   FF +Y+S  +    + G +I+ R   LFI 
Sbjct: 517 YWGLFMIVLMFIAQFYVALFPPGGKPDAEVFFQSYLSFPIVVATYFGHKIYKRNWKLFIP 576

Query: 514 TEDIDLDTDRREIDDVVWEEQ 534
            ED+D+DT RRE D  + +++
Sbjct: 577 LEDMDIDTGRRETDMELLKQE 597

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  289 bits (740), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 175/552 (31%), Positives = 284/552 (51%), Gaps = 24/552 (4%)

Query: 5   KDYEATREKDGSHLIIKPSIAEDA-VSMESL---GSVKETQVKRALKPRHISMIALGGTI 60
           ++++   E   S+L I+    + A V+++S       +  Q+K+ +KPRH+ M++LG  I
Sbjct: 109 QEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSLGTGI 168

Query: 61  GTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMAT-FIPVTSSFTVFTQRFL 119
           GTGL +   TPL+ AGP   +I Y  +GT  Y + Q+ GE+A  +  V  SF  F    +
Sbjct: 169 GTGLLVGNGTPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLV 228

Query: 120 SPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVK 179
            P    A  ++Y + W     LEL      I++WT  V    ++ IF+V++ + N F  K
Sbjct: 229 DPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDVFVVIFYVLILLINFFGAK 288

Query: 180 YYGEVEFWIACIKVLAIVGFIIYAFIMVCGA-GKTGPVGFRYWRNPGPW-GPGIISKDVN 237
            Y E EF+  C KV+ ++GF I A  +  GA G  G +G +YW +PG + G   I     
Sbjct: 289 GYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIE---- 344

Query: 238 EGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXX 297
             RF G + + ++AAF +  TE + +TA E +NPRK +P A  KV               
Sbjct: 345 --RFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVAYRILLIFLTSIILI 402

Query: 298 XXXXXXN-DPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGS 356
                 N D  + S     S+SP+V+A    G  V+ H  NAVIL +++S  NS  Y  S
Sbjct: 403 GFLVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSS 462

Query: 357 RIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAV 416
           R+   +A  G APK+  +  ++G P  ++L  +++  +A+  +S   + VF WLL I+ +
Sbjct: 463 RLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCAAIIAVIAFCATSPKETDVFTWLLAISGL 522

Query: 417 AGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAF 476
           +  FTW  I +SHIRF + ++ QG S  +L F+A+    G+YYAA             A 
Sbjct: 523 SQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVAL 582

Query: 477 AP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVW 531
            P         +FF  Y+++ +    ++GF++W R   LFI+ ++IDL + R     +++
Sbjct: 583 VPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHR-----IIF 637

Query: 532 EEQKPRNLWEKF 543
           +E+  R   E++
Sbjct: 638 DEELLRQEDEEY 649

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  287 bits (735), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 169/522 (32%), Positives = 265/522 (50%), Gaps = 16/522 (3%)

Query: 27  DAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMF 86
           D   +E   +  + Q K+ +K RH+ M++LG  IGTGL +S    LS AGP   +IAY  
Sbjct: 79  DHNDLEKTTTAHQEQ-KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGL 137

Query: 87  IGTLAYSVTQSLGEMATFIP-VTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSV 145
           +  + Y + Q+ GEMA   P +  SF  +T  F+S   G A  +L+ + W     LEL  
Sbjct: 138 VSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELIT 197

Query: 146 VGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFI 205
               I++W  ++    ++ IF+V L   + F V+ YGE EF     K+L I GFII+A +
Sbjct: 198 AAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIV 257

Query: 206 MVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGIT 264
           + CG AGK G +G +YW +PG +     +      RF G   +L++A F+Y G EL  ++
Sbjct: 258 VNCGGAGKDGYIGGKYWHDPGAF-----ASSNGASRFKGICYNLVNAYFSYGGNELFVLS 312

Query: 265 AGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL--KSEDSYISSSPFVI 322
             +  NPRK+ P A                         N  +L   S  + + +SP+V+
Sbjct: 313 VNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVL 372

Query: 323 AIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPY 382
           A    G KV+PHI NAVIL  +IS  NS++Y G R+  S+A  G AP++L++  + G P 
Sbjct: 373 AASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPL 432

Query: 383 AAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGIS 442
            A+L ++++G + +  +S     VF WL  I+ ++  FTW  I  SHIRF +A+K Q  S
Sbjct: 433 TALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKS 492

Query: 443 RDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTAYISVMLFFV 497
            D L +KA    WG+Y+               A +P     K   + FF +Y+++ ++ V
Sbjct: 493 LDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLV 552

Query: 498 FWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQKPRN 538
           F+ G+  W++   +      +DLD  R+  D     ++   N
Sbjct: 553 FYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLEN 594

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  286 bits (731), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 166/506 (32%), Positives = 261/506 (51%), Gaps = 23/506 (4%)

Query: 41  QVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGE 100
           ++K+ +K RH+ MI LG  IGTGL +   + L+ AGP G ++ Y+    + Y + ++ GE
Sbjct: 64  KMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLYLIVEAAGE 123

Query: 101 MA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPL 159
           +   +  +T ++T ++   + PA+G +  ++Y + W   F L+L     IIQ+WTD  P 
Sbjct: 124 LGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQYWTDINP- 182

Query: 160 TAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPVGF 218
             ++AI + ++   NLF  K Y E EF+    KVL I+GF+I   ++ CG AG +G +G 
Sbjct: 183 DIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGGAGTSGYIGD 242

Query: 219 RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRA 278
           +YW  P P+  G          F G       AAF Y G E++ ++A E  NPRK++  A
Sbjct: 243 KYWHEPRPFMNG----------FKGLCFVFCYAAFAYGGIEVMVLSASEQENPRKSISSA 292

Query: 279 INKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNA 338
             KV                     + P L SE S   +SP VIA+   G K++PHI NA
Sbjct: 293 CKKVIYRIVLIYLLTTVIVCFLVPADHPSLASEGS--RASPLVIAVSFHGVKIVPHIINA 350

Query: 339 VILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLE 398
           VIL  ++S GNS++Y   R+  S+A  G APK  T+  + G P  A     V G LA+L 
Sbjct: 351 VILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMVFGLLAFLA 410

Query: 399 SSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAY 458
           +S     VF WLL I+ ++  F W+ I ISHIRF  A+K QG S  ++ +KA+   WG++
Sbjct: 411 ASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKARTGYWGSW 470

Query: 459 YAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIK 513
            A              A +P          FF +Y++  +  + + G++I+ +   + I 
Sbjct: 471 IAVVTAFLILIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFGYKIYHKDWRICIP 530

Query: 514 TEDIDLDTDRREIDDVVWEEQKPRNL 539
             ++DL + R+  D+   +E K  +L
Sbjct: 531 ASEVDLISHRQVFDE---DELKQEDL 553

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  286 bits (733), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 171/540 (31%), Positives = 269/540 (49%), Gaps = 19/540 (3%)

Query: 8   EATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFIS 67
           ++ R  +   L     + +   SM+S        +K+++K RH+ M++LG  IGTGL ++
Sbjct: 57  DSFRRAESQRLEEDNDLEDGTKSMKS-----NNHLKKSMKSRHVVMMSLGTGIGTGLLVA 111

Query: 68  ISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIP-VTSSFTVFTQRFLSPALGSA 126
            +  LS AGP   +I Y+ +  + Y + Q+ GEM    P +  +F  +   F+S + G A
Sbjct: 112 NAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFA 171

Query: 127 NGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEF 186
             +L+ + W     LEL      +++W D +    +I IF+V L   + F VK YGE EF
Sbjct: 172 TTWLFCIQWLTVLPLELITSSMTVKYWNDTINADVFIVIFYVFLLFIHFFGVKAYGETEF 231

Query: 187 WIACIKVLAIVGFIIYAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWV 245
                K+L + GFII + ++ CG AG  G +G +YWR+PG +  G         RF G  
Sbjct: 232 IFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEG-----SGATRFKGIC 286

Query: 246 SSLISAAFTYQGTELVGITAGEAANPRKTVPRAINK-VXXXXXXXXXXXXXXXXXXXXXN 304
             L+SA F++ G EL  ++  E +NPRK+ P A  + V                     N
Sbjct: 287 YILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNN 346

Query: 305 DPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAM 364
           D  + S  S   +SP+V+A      +V+PHI NAVIL ++IS  NS +Y   R+  S+A 
Sbjct: 347 DQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQ 406

Query: 365 NGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWIL 424
            G APK+L +  + G P  A++  S++G + ++  S      F WL  I  ++  FTW  
Sbjct: 407 QGYAPKFLNYIDREGRPLRALVVCSLVGVVGFVACSPQEEQAFTWLAAIAGLSELFTWSG 466

Query: 425 ISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----K 479
           I +SHIRF +A+K QG S D++ +KA    WG+YY               A +P     K
Sbjct: 467 IMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGK 526

Query: 480 FKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTED-IDLDTDRREIDDVVWEEQKPRN 538
                FF +Y++  L+   ++G+ ++ R   F+   D IDLD  RR  D  +  ++   N
Sbjct: 527 CDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEEN 586

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  287 bits (735), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 169/542 (31%), Positives = 276/542 (50%), Gaps = 15/542 (2%)

Query: 4   SKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTG 63
           ++D E T E   + L+   S ++            +  ++++++PRH+ M++LG  IGTG
Sbjct: 81  AEDDEETAEDLENELVSTLSPSKSKQLHGQKNGDDDAHLQKSIRPRHVLMMSLGTGIGTG 140

Query: 64  LFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMA-TFIPVTSSFTVFTQRFLSPA 122
           L +   + LS AGP   +I Y  +G+  Y + Q+ GEMA  +  +  +F  +    +   
Sbjct: 141 LLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQACGEMAVCYSGLPGNFNAYPSFLVDEG 200

Query: 123 LGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYG 182
           +     ++Y L W     LEL      I +WT  V    ++ IF+V++T+ N F  K Y 
Sbjct: 201 MAFGVAWVYCLQWLCVMPLELVTASMTIDYWTTKVNSDVFVVIFFVLITLINTFGAKGYA 260

Query: 183 EVEFWIACIKVLAIVGFIIYAFIM-VCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRF 241
           E EF+    KVL + GF I A ++   GAG  G +G +YW NPG +       D +  RF
Sbjct: 261 EAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAF-----RGDKSIDRF 315

Query: 242 LGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXX 301
              +S+  +AAF +  +E + I A E +NPR+ +P A   +                   
Sbjct: 316 KDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLV 375

Query: 302 XXNDPKL--KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIA 359
             +  +L      +   +SP+VIA+ + G +V+PH  NAVIL +++S  NS  Y   RI 
Sbjct: 376 PYDSTELLGSGGSASSQASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAYYSSCRIL 435

Query: 360 YSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGF 419
           YS+A  G APK+  +  + G P  A+L T++ G +A+   S     VF WLL+I  ++  
Sbjct: 436 YSLAQQGYAPKWFEYIDREGRPARAMLVTTIFGVIAFCSCSDKEEDVFAWLLSIAGLSQL 495

Query: 420 FTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP- 478
           FTW  I +SHIRF +A+K QG S D++ FK++   WG+ YAA             + AP 
Sbjct: 496 FTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSGYAAIMMILALIAEFWVSIAPI 555

Query: 479 ---KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREID-DVVWEE 533
                   +FF  Y+++ +  V + G++I+ +   LFI+ +DIDL + R   D ++V +E
Sbjct: 556 GEDHLDAQNFFENYLAMPILIVLYFGYKIYKKDWKLFIRAKDIDLISHRTIFDGELVRQE 615

Query: 534 QK 535
           ++
Sbjct: 616 EE 617

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  286 bits (732), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 168/498 (33%), Positives = 257/498 (51%), Gaps = 14/498 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSL 98
           + ++K  +K RH++MI+LG  IGTGL ++    L   GP G LI Y+   T+ Y V Q+ 
Sbjct: 68  QQKLKHNIKTRHLTMISLGTGIGTGLLVASGKALHYGGPGGLLIGYLTTSTMLYCVVQAC 127

Query: 99  GEMAT-FIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAV 157
            E+   +  +  ++  +    +    G A   +Y L WAI   LEL      I++WT++V
Sbjct: 128 CELGVAYATLPGNYNAYPTFLVDRGFGFAVALVYGLQWAIVLPLELVTASMTIKYWTESV 187

Query: 158 PLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
               ++AIF++ +   + F  + Y E EF    +KVL + GFII    + CGA K G +G
Sbjct: 188 NPDVFVAIFYLFIVFIHFFGSRGYAESEFIFNTLKVLLMAGFIIMGISLNCGASKLGYIG 247

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
            +YW NPG +      + +N  +  G  S  + +AF Y G+E + +TA E ANPR++VP 
Sbjct: 248 AKYWSNPGTFAG---ERSINHLK--GICSVWVQSAFAYGGSEFIALTAAEQANPRESVPS 302

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKL--KSEDSYISSSPFVIAIENSGTKVLPHI 335
           A  +                         +L   S  S   +SPFVIA    G K++PHI
Sbjct: 303 ATKRWLYRVVVVFLIPIALICFLVPYTSDQLLSSSGASASHASPFVIAAAYHGVKIVPHI 362

Query: 336 FNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLA 395
            NA+IL+++IS GNS +Y   RI  S+A NGL PK  T+  ++G P A +L   V G L+
Sbjct: 363 INAIILTSVISVGNSGMYSAPRILLSLAENGLCPKIFTYVDRAGRPLATLLFVCVFGLLS 422

Query: 396 YLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++ +S    +VF WL  I  ++  FTW  I++SHIRF  A+K QG S  +L + +     
Sbjct: 423 FVAASKNQESVFTWLTAIAGLSQLFTWTSIALSHIRFRAAMKVQGRSLGELGYTSTTGAI 482

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-P 509
           G+YYA              A AP     +     FF  Y++  +  +F++G++IW+R   
Sbjct: 483 GSYYAVFFNIVVLVAQFWIAIAPIDKHGELDAESFFKNYLAFAVLVLFYVGYKIWYREVQ 542

Query: 510 LFIKTEDIDLDTDRREID 527
           L I  + IDL+T R+  D
Sbjct: 543 LLIPVDKIDLETHRQIFD 560

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  286 bits (733), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 179/551 (32%), Positives = 272/551 (49%), Gaps = 25/551 (4%)

Query: 13  KDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPL 72
           +D  H  +   +  +  +  S+ +  +T +K+A+K RH+ M+ LG  IGTGL ++ +  L
Sbjct: 64  EDNKHSEVDSDVERNGDAAYSVNT--DTHLKKAMKTRHVIMMTLGTGIGTGLLVANAKGL 121

Query: 73  SNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIP-VTSSFTVFTQRFLSPALGSANGYLY 131
              GP   +I Y  +  + Y + Q+ GEMA   P +  +F  +   F+S   G A  +L+
Sbjct: 122 HFGGPAALVIGYGLVSMVTYIMIQAAGEMAVAYPTLPGNFNTYASIFVSKPFGFATVWLF 181

Query: 132 WLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACI 191
            + W     LEL     II++WT+ V    ++ IF+V L   +   VK YGE EF     
Sbjct: 182 CIQWLTVLPLELITASLIIKYWTEKVNADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLC 241

Query: 192 KVLAIVGFIIYAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLIS 250
           K+L I GFII++ ++ CG AG  G +G +YW +PG +     ++     RF G    L+S
Sbjct: 242 KILMIAGFIIFSIVVNCGGAGHDGYIGGKYWHSPGAFAGTNAAE-----RFKGVCYVLVS 296

Query: 251 AAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK- 309
             F+Y GTEL  ++  E  NPRK+ P A  +                      ND +L  
Sbjct: 297 GYFSYGGTELYVLSVNEQENPRKSTPIAAKQSIYRILVIYLLTMILIGFTVPFNDDQLMG 356

Query: 310 SEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAP 369
           +  S   +SP+V+A    G +V+PHI NAVIL  +IS  NS++Y   R+  S+A  G AP
Sbjct: 357 AGGSATHASPYVLAASIHGVRVVPHIINAVILIAVISVANSSLYAAPRLLCSLAEQGYAP 416

Query: 370 KYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISH 429
           K++T+  + G P  A+L  +V G +A+   S     VF WL  I  ++  FTW  I +SH
Sbjct: 417 KFMTYVDREGRPLYALLACAVFGVIAFSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSH 476

Query: 430 IRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP---KFKVSDFF 486
           +RF QA+K QG   +++ + A    WG+ Y               A AP         FF
Sbjct: 477 VRFRQAMKLQGRDLNEVGYIANTGYWGSVYGVVFNILVFIAQFWVALAPPKSPITAQSFF 536

Query: 487 TAYISVMLFFVFWIGFQIWFRGPLFIKTED-IDLDTDRREIDDVVWE----EQKPR---- 537
            +Y++  ++  F+ G+ IW +   F+   D IDLD  RR  D  V +    E K R    
Sbjct: 537 ESYLAFPIWIAFYFGYMIWNKDYTFLNPLDKIDLDHHRRIYDPEVLKQEDMENKERVRNG 596

Query: 538 NLWEK---FWA 545
           N+W K   FW 
Sbjct: 597 NIWTKLKWFWC 607

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  287 bits (735), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 165/510 (32%), Positives = 272/510 (53%), Gaps = 19/510 (3%)

Query: 37  VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQ 96
           +K+ ++KR +  RH+  +A+G  +GTGL +  ++ L++AGP G LI Y  +GT  Y V Q
Sbjct: 112 IKKEELKRDINQRHMVFMAIGSGVGTGLLVGNASTLNSAGPAGLLIGYALMGTCVYCVIQ 171

Query: 97  SLGEMA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTD 155
           + GE+  T+  +   F  +    ++P+   + G++Y L W     LEL      I++WT 
Sbjct: 172 AAGELGVTYANLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLELVTASLTIKYWTT 231

Query: 156 AVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTG 214
            V    ++ IF++++ + N F  K Y E +F+  C+K+  I GF I   ++ CG AG  G
Sbjct: 232 KVDPDVFVVIFYLLILLINFFGSKGYAEADFFFNCMKLAMISGFFILGIVVACGGAGHDG 291

Query: 215 PVGFRYWRNPGPW-GPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
            +G +YW NPG + G   I        F G  S  +++AF + G+E V ++A E ANPRK
Sbjct: 292 YLGGKYWHNPGAFRGEKAID------HFKGVSSVFVTSAFAFGGSEFVALSASEQANPRK 345

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
           ++P A   +                     + P+L+       +SP+V+AI   G KV+P
Sbjct: 346 SIPSAAKLILYRIIWVYLTSITILGFLVPWDSPQLQPSSDGKKTSPYVVAIAMHGVKVVP 405

Query: 334 HIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGF 393
           H+ NAVIL  ++S  NS  +  SR+  S++  G APK+  +  + G P  A+L +++ G 
Sbjct: 406 HLINAVILMAVLSVSNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLISALFGV 465

Query: 394 LAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFM 453
           + +  +S   + VF+WLL I+ ++  FT+  I +SHIR   A+K QG S  +L F+++  
Sbjct: 466 ICFCATSKKETDVFSWLLAISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGELGFRSQVG 525

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIW---F 506
            +G++YA              A AP    K     FF  Y++  +  VF+ G+ IW   F
Sbjct: 526 TYGSFYACLLLVLSLMAEFWVALAPIGEGKLDAESFFENYLAAPIGIVFYFGYMIWKKDF 585

Query: 507 RGPLFIKTEDIDLDTDRREID-DVVWEEQK 535
           R  +FI+++DIDLD  R+  D D++ +E +
Sbjct: 586 R--IFIRSKDIDLDFKRQVFDEDLIKQEDE 613

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  285 bits (730), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 180/537 (33%), Positives = 278/537 (51%), Gaps = 28/537 (5%)

Query: 26  EDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYM 85
           EDA SME +   +E QV R LK RHI +IALGG IGTGLFI     LS  GP   LI+YM
Sbjct: 53  EDA-SMELIEG-QEHQVARKLKSRHIQLIALGGAIGTGLFIGSGGALSVCGPAPLLISYM 110

Query: 86  FIGTLAYSVTQSLGEMATFIPVTSSFTVF--TQRFLSPALGSANGYLYWLSWAITFALEL 143
            +    + +   L EM   +P++   ++F  T  +L+  L    G   + + ++    E+
Sbjct: 111 IMSFFVWCIMNFLTEMVCMMPISGETSMFAMTGTYLNKPLSFMCGINLFYAMSMIAPSEI 170

Query: 144 SVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYA 203
           +    +IQ+WTDA     +I+IF V+     + PV ++GE EFW++ IK+  I G +I  
Sbjct: 171 TATAILIQYWTDANS-AIFISIFIVVTVSLTMLPVHFFGESEFWVSIIKLFCITGLVILG 229

Query: 204 FIMVCGAG--KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGT-EL 260
            ++  G    +   +GF YW++PG + P ++    N G+FL   +++I + F+Y    E+
Sbjct: 230 IVIFFGGAPNQDKVLGFHYWKHPGAFNPHLVPG--NTGKFLACWTAIIKSGFSYVLVPEV 287

Query: 261 VGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL----KSEDSYIS 316
           V   A EA +PR+ +PR   +                      ++ +L     + +S  +
Sbjct: 288 VVSCAAEAKDPRRNMPRVAQRFVYRLALFYVCGSLTIGIMVGYDNSRLLNAIAAGESNAA 347

Query: 317 SSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTT 376
           +SPFVI I+  G +VLPHI NA IL++  S G S +Y  SR+ +SMA+NG  PK    T 
Sbjct: 348 ASPFVIGIQEVGIRVLPHIINACILTSAYSCGTSVLYGASRVLHSMAVNGAVPKIFATTN 407

Query: 377 KSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQAL 436
           + G PY +    SV   LAYL  S  +S VF WL NI  ++GF  W+L+ + ++RF + +
Sbjct: 408 RFGTPYYSTAAASVFCLLAYLNCSDSSSVVFTWLSNIATISGFVDWMLVCVVYLRFRKVI 467

Query: 437 KHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFKVSDFFTAYISVMLF 495
           +H  ++ D +PF+ +FM   AY +               F A  + VSDFF  Y ++ L 
Sbjct: 468 EHANLT-DKMPFRKRFMKPLAYLSCGFFAILSLTNGYAVFVADNWNVSDFFACYTTLGLA 526

Query: 496 FVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVW--EEQK------PRNLWEKFW 544
            V +IG  I+++    IK  D+D +     I  +    EE+K      P+N  EK W
Sbjct: 527 AVLYIGAAIYYKT---IKLRDLD-EVAAEIIPKIAMADEEEKGEVPIVPKNWLEKVW 579

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  286 bits (731), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 177/519 (34%), Positives = 278/519 (53%), Gaps = 14/519 (2%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           G  +  ++K+ L+ RH+SMIA+GG++GTGL I   + L  AGP   LIAY  +G + ++V
Sbjct: 52  GKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFTV 111

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
              LGEMA +IP+   FT +  R+  PALG A G+ Y   + +    +L+    +IQFW 
Sbjct: 112 MSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFWI 170

Query: 155 DAVPLT--AWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGK 212
            A  ++   WI +   ++ + N   V+++GE EFW++  KVL ++  +I   ++  G G 
Sbjct: 171 PAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGGP 230

Query: 213 TGP-VGFRYWRNPGPWGPGIISKDVN----EGRFLGWVSSLISAAFTYQGTELVGITAGE 267
           T   +GFRYW +PG +      KD +     G+F+ ++S  + A F Y GTEL GI A E
Sbjct: 231 THDRLGFRYWSDPGAFKE-YSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVAAE 289

Query: 268 AANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSS---PFVIAI 324
             +PR+ VPRAI                        NDP L    S   S+   P+V+AI
Sbjct: 290 CKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVVAI 349

Query: 325 ENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAA 384
           EN+   VLP++FNA +L+ + SA NS++YVGSR  Y +A++G APK    T K G+PY A
Sbjct: 350 ENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPYNA 409

Query: 385 VLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRD 444
           +   ++   LAY+  S  A   F + +N+T++ G  +W+ I I++I F +A + QGI + 
Sbjct: 410 LACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIPKS 469

Query: 445 DLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPK-FKVSDFFTAYISVMLFFVFWIGFQ 503
            L + A   P+  + A              AF  K   V  F T YI + ++   +IG++
Sbjct: 470 TLSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEVDVPTFITGYIGLPIYIFCFIGYK 529

Query: 504 IWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEK 542
           I  +   +I ++++DL T +  ID    E  + R L ++
Sbjct: 530 IVHKTK-WIPSKEVDLFTFKEAIDLEEEECIRERALMKE 567

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  284 bits (727), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 178/535 (33%), Positives = 268/535 (50%), Gaps = 24/535 (4%)

Query: 3   LSKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKE----TQVKRALKPRHISMIALGG 58
           + K YE    KD S        +++     ++ S ++    T VKRALK RHIS++ALGG
Sbjct: 1   MMKTYEVACFKDESRSDDLSKFSKEEPDTHNIKSFEQFDPNTGVKRALKNRHISLLALGG 60

Query: 59  TIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRF 118
            IG G  +     LS  GP+  L+ +  IG +A++V +S+GEM T  P  S F+  ++RF
Sbjct: 61  IIGPGCLVGAGNALSKGGPLSLLLGFGIIGIVAFAVMESIGEMITLYPSGSGFSTLSRRF 120

Query: 119 LSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPV 178
            S AL + +GY Y + +    A E + +  I+QFW   VPL  +I IF V   +  +  V
Sbjct: 121 HSDALSAVSGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYGYILIFSVAFQVFQMLGV 180

Query: 179 KYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPV-GFRYWRNPGPWGPGIISKDVN 237
             +GE E+W+A  K++ ++ + I++ I + G  K  P  GF YW NPG    G       
Sbjct: 181 GIFGEFEYWLAWFKIIGLIAYYIFSIIYISGGIKNRPAFGFHYWNNPGALADG------- 233

Query: 238 EGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXX 297
              F G     +  +  Y GTE V + A E+ NP K VP AI +                
Sbjct: 234 ---FKGIAVVFVFCSSFYSGTESVALAATESRNPGKAVPIAIKQTFWRIIIVYLGIAVFY 290

Query: 298 XXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSR 357
                 ND  L +    +  SP  IAI  +G +   H+ NA IL T +SA N ++Y+GSR
Sbjct: 291 GATVPYNDTSLGAHTKAL-KSPIAIAITRAGWEGGVHLVNAFILITCVSAINGSLYIGSR 349

Query: 358 IAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVA 417
               +A  GLAPK+L WT K G+P  A+   + LG ++ +  S GAS  +++++N++ V 
Sbjct: 350 TLIYLAHEGLAPKFLKWTDKRGVPIPAITLFNALGLVSLMNVSVGASNAYSYIVNLSGVG 409

Query: 418 GFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFA 477
            F  W +IS++H+RF +A   QG S  +LP+K+   PWG  ++             T F 
Sbjct: 410 VFIVWGIISLTHLRFRKAWDLQGRSASELPYKSLLFPWGPIFSLAANIFLGLIQGWTTFV 469

Query: 478 PKFKVSDFFTAYI----SVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDD 528
           P F   DF  AYI    +V+L+ V  +   +   G   +    +DL+  RRE  D
Sbjct: 470 P-FSAKDFVDAYILLPAAVILYIVISL---VKIGGFKLVDLRTVDLEEGRREDLD 520

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  287 bits (735), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 172/520 (33%), Positives = 265/520 (50%), Gaps = 21/520 (4%)

Query: 35  GSVKE---TQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLA 91
           G  KE    ++++ +KPRH+ M++LG  IGTGL +  + PL+ AGP   +I Y  +GT  
Sbjct: 149 GQKKEDSNAELRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLVIGYGIMGTCI 208

Query: 92  YSVTQSLGEMAT-FIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQII 150
           Y + Q+ GEMA  +  +T SF  F    + P    A  ++Y + W     LEL      I
Sbjct: 209 YCIIQACGEMAVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTASMTI 268

Query: 151 QFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGA 210
           Q+WT  V    ++ IF+V++ + N F  K Y E EF     KVL I GF I A  +  GA
Sbjct: 269 QYWTTKVDPDVFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFFILAICIDTGA 328

Query: 211 -GKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAA 269
            G  G +G +YW +PG +            RF G + + ++AAF +  TE + +TA E +
Sbjct: 329 AGTDGYIGAKYWNDPGAF-----RGQTKIERFKGVMDTFVTAAFAFGATEFIALTAAEQS 383

Query: 270 NPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVIAIENSG 328
           NPRK +P A  K+                     + D  L S  S   +SP+V+AI   G
Sbjct: 384 NPRKAIPSAAKKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGGSATKASPYVLAISLHG 443

Query: 329 TKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTT 388
            +V  H  NAVIL ++IS GNS  Y  SR+  S+A  G APK   +  + G P  A+  +
Sbjct: 444 VRVAQHFVNAVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIAMCCS 503

Query: 389 SVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPF 448
           +V+  +A+  +S   + VF WL+ I  ++  FTW  I +SH+RF +A+K QG S  ++ +
Sbjct: 504 AVIAVIAFCATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLGEMGY 563

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF----KVSDFFTAYISVMLFFVFWIGFQI 504
            ++    G+ YAA             A  P        + FF+ Y+++ +  VF+ G++I
Sbjct: 564 LSQTGILGSLYAAIMMILALIAQFWVALVPMGTHTPDANSFFSNYLAMPILIVFYFGYKI 623

Query: 505 WFRG-PLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKF 543
           W R   LFI+ +DIDL + R      +++E+  R   E++
Sbjct: 624 WKRDWRLFIRAKDIDLISHR-----TIYDEELLRQEDEEY 658

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  285 bits (729), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 167/520 (32%), Positives = 264/520 (50%), Gaps = 27/520 (5%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           GS     +K++LK RH+ MIA+GG+IGTGLFI     L+  GP+  +I +   G+     
Sbjct: 71  GSFHTGNLKKSLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAVAGSQIVGT 130

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
              LGE+    PV  +F  +T RFL P++      +Y L W     LE+      +Q+W 
Sbjct: 131 IHGLGEITVRFPVVGAFASYTTRFLDPSISFVVSTIYVLQWFFVLPLEIIASAITVQYWN 190

Query: 155 DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
           D++    ++AIF+ ++   NLF  + +GE EF  + +K++ I GFII   +++ G G   
Sbjct: 191 DSIDPVVFVAIFYCVIVSINLFGARGFGEAEFIFSTVKIITICGFIILCIVLIAGGGPDH 250

Query: 215 P-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
             +G +YW NPG    G          F G +S L+ A+++  GTE+  + +GE  +P K
Sbjct: 251 EYIGAKYWHNPGSLAHG----------FKGVLSVLVVASYSLGGTEMTCLASGE-TDP-K 298

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
            +P AI +V                      +P L    S + +SPFVIAI+    KVLP
Sbjct: 299 ELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNPNLLGGSS-VDNSPFVIAIKIHNIKVLP 357

Query: 334 HIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGF 393
            I NAVIL +I+S GNS ++  SR   SMA   L P +  +  ++G P   ++  S+ G 
Sbjct: 358 SIVNAVILVSILSVGNSCIFASSRTLCSMAHQHLIPWWFGYIDRAGRPLTGIIINSLFGL 417

Query: 394 LAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFM 453
           LA+L  SS  + VF+WL+ I  +A    W+ I+I H+RF  A+K Q  + D+L F +   
Sbjct: 418 LAFLVKSSSVTEVFDWLMAIAGLATCIVWLSINICHVRFRLAMKAQNRTLDELEFVSAVG 477

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP-------KFKVSDFFTAYISVMLFFVFWIGFQIWF 506
            WG+ Y+              A  P         +   FF  Y+  ++  V +IG +I++
Sbjct: 478 IWGSVYSGIVNALILVAQFYIALWPIGGWTDSGTRAKKFFQNYLCALILIVLFIGHKIYY 537

Query: 507 RGPL-----FIKTEDIDLDTDRREID-DVVWEEQKPRNLW 540
           R        +I  +DIDLDTDR+ +D +++ +E   + ++
Sbjct: 538 RVTTGHWWEYIALKDIDLDTDRKNVDIEIIKQEIHEKKMY 577

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  284 bits (726), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 172/533 (32%), Positives = 275/533 (51%), Gaps = 20/533 (3%)

Query: 21  KPSIAEDAVSMESLGS---VKETQ--VKRALKPRHISMIALGGTIGTGLFISISTPLSNA 75
           K +  + AV +E   +   + +TQ  +K  +K RH++MI+LG  IGTGL ++    L   
Sbjct: 42  KRAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHLTMISLGTGIGTGLLVASGKALHFG 101

Query: 76  GPVGALIAYMFIGTLAYSVTQSLGEMAT-FIPVTSSFTVFTQRFLSPALGSANGYLYWLS 134
           GP G +I Y+   T+ Y V Q+  E+   +  +  ++  +    +    G A   +Y L 
Sbjct: 102 GPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQ 161

Query: 135 WAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVL 194
           WA    LEL      +++WT +V    ++AIF+V L   + F  + Y E EF    +KVL
Sbjct: 162 WATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVL 221

Query: 195 AIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFT 254
            + GFII A  +  GA + G +G +YW +PG +G      D    RF G  S  + AAF 
Sbjct: 222 LMAGFIIMAISLTAGASEQGYIGGQYWHDPGAFG-----GDRAIDRFKGICSVWVQAAFA 276

Query: 255 YQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSED-- 312
           Y G+E + +TA E ANPR++VP+A  +                      N  +L S +  
Sbjct: 277 YGGSEFIALTAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGG 336

Query: 313 SYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYL 372
           S   +SPFVIA    G +V+PHI N +IL+++IS GNS +Y   RI  S+A +G+ PK  
Sbjct: 337 SGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIF 396

Query: 373 TWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRF 432
           T+  + G P   ++  S+ G +A++ +S+    VF WL  I  ++  FTW  I++SH+RF
Sbjct: 397 TYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRF 456

Query: 433 MQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFT 487
            +A++ QG S  +L ++A     G+YYA              A AP     +  V  FF 
Sbjct: 457 RRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQ 516

Query: 488 AYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREID-DVVWEEQKPRN 538
            Y++  +  VF++G+++W R   L I + ++DL + R+  D +V+ +E+  R 
Sbjct: 517 NYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERK 569

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  284 bits (727), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 174/542 (32%), Positives = 273/542 (50%), Gaps = 13/542 (2%)

Query: 2   SLSKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIG 61
           S  +  E     DG H   +    ED   +    S K   +K+ +KPRH+ MI+L   IG
Sbjct: 47  SFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIG 106

Query: 62  TGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMAT-FIPVTSSFTVFTQRFLS 120
           TG+ +     L N GP   LI Y  + T+ Y V QS  E+A  +  ++  F  +    + 
Sbjct: 107 TGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVD 166

Query: 121 PALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKY 180
            A   +  ++Y L W     LEL      I++W D++   A++ IF+V+L + N      
Sbjct: 167 KAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAFVVIFYVVLIVINFIGAAG 226

Query: 181 YGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEG 239
           Y E EF+    KVL ++GF I   I+ CG AG  G +G  YW +PG +     +  +N  
Sbjct: 227 YAEAEFFFNTCKVLMLIGFFILGIIVNCGGAGNDGYLGSVYWHDPGAFRG---NNGIN-- 281

Query: 240 RFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXX 299
           RF G V+ L++AAF Y G E   +TA E  NP+K++  A  K+                 
Sbjct: 282 RFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGF 341

Query: 300 XXXXNDPKL-KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRI 358
               N P+L  S  +   +SPFVIAI + G KV+PHI NAVIL +++S  NS +Y  SRI
Sbjct: 342 LVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHIINAVILLSVLSVANSALYSSSRI 401

Query: 359 AYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAG 418
             S++  G APK   +  + G P   +L + V G L ++ +S     VF WLL I+ ++ 
Sbjct: 402 LLSLSEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSE 461

Query: 419 FFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP 478
            FTW  IS+SH+RF +++  QG S D+L +++    WGAYYA              A +P
Sbjct: 462 LFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAMIMILLILIGQFWVAISP 521

Query: 479 ----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEE 533
               K   ++FF  Y+++ +    ++G+++W+R   + I   ++DL + R+  D  + + 
Sbjct: 522 VGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQS 581

Query: 534 QK 535
           ++
Sbjct: 582 EQ 583

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  283 bits (724), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 174/521 (33%), Positives = 259/521 (49%), Gaps = 30/521 (5%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           GS     +K++LK RH+ MIA+GG+IGTGLFI     L+  GP+  +I +   GT     
Sbjct: 66  GSFHSDNLKKSLKARHLIMIAIGGSIGTGLFIGSGKALAVGGPLALIIGWTVAGTQMVGT 125

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
              LGE+    PV  +F  +  RFL P++      +Y L W     LE+      +++W 
Sbjct: 126 IHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWG 185

Query: 155 DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KT 213
            +VP  AW+AIF+  + + NL  V+ +GE EF  + IKVL I+GFII   +++CG G K 
Sbjct: 186 SSVPPVAWVAIFYAFIALVNLLGVRGFGEAEFIFSLIKVLTIIGFIILCVVLICGGGPKH 245

Query: 214 GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
             VG +YW +PGP   G          F G  +  + A+++  GTE+  + +GE  +P K
Sbjct: 246 EFVGAKYWSDPGPLANG----------FKGVAAVFVIASYSLGGTEMACLASGE-TDP-K 293

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
            +P AI +V                      +  L    S + +SPFVIAI   G K LP
Sbjct: 294 ELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLMGGSS-VDNSPFVIAIRLHGIKALP 352

Query: 334 HIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGF 393
            + NAVIL +++S GNS ++  SR   SMA  GL P+   +  ++G P   +LT    G 
Sbjct: 353 SVVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRIFGYIDRAGRPLVGILTNLAFGL 412

Query: 394 LAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFM 453
           LA+L  SS +  VF WL+ I  +A    W+ I++SHIRF  A+K QG+S D+L F +   
Sbjct: 413 LAFLVKSSSSDDVFTWLMAIAGLATCVVWLSINVSHIRFRMAMKAQGVSLDELEFVSAVG 472

Query: 454 PWGAYYAAXXXXXXXXXXXXTAF-------APKFKVSDFFTAYISVMLFFVFWIGFQIWF 506
            +G+ Y+A             +        +P  +  +FF  Y+  ++  + + G +I++
Sbjct: 473 VYGSVYSATINVLILVAQFYVSLWPVGGWSSPSTRTENFFQNYLCSLILLLLFAGHKIYY 532

Query: 507 RGPL-----FIKTEDIDLDTDRREIDDVVWEEQKPRNLWEK 542
           R        F    DIDL TD R  D     E     L EK
Sbjct: 533 RISTGKWWGFKALRDIDLLTDMRVTD----TELSKHELHEK 569

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  283 bits (723), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 167/526 (31%), Positives = 266/526 (50%), Gaps = 29/526 (5%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           GS     +KR LK RH+ MIA+GG+IGTGLFI     L+  GP+  LI +   GT     
Sbjct: 61  GSFDPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVGT 120

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
              LGE+    PV  +F  ++ RFL P++      +Y L W     LE+      ++FWT
Sbjct: 121 IHGLGEVTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFWT 180

Query: 155 DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
            +V    W+A+F+ ++   NLF V+++G+ +F  + IK++ I GFII   +++ G G T 
Sbjct: 181 TSVDPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPTH 240

Query: 215 P-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
             +G RYW +PG    G          F G  + +++A+++  G+E+  + +GE  +P K
Sbjct: 241 EFIGARYWHDPGALANG----------FKGVAAVMVTASYSLGGSEMTCLASGE-TDP-K 288

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
            +P AI ++                      + +L    S +++SPFVIAI+    +VLP
Sbjct: 289 EIPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLG-GSNVNNSPFVIAIKMHNIRVLP 347

Query: 334 HIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGF 393
           HI N VIL +I+S GNS ++  SR   SMA  GL P+   +  ++G P   +LT S+ G 
Sbjct: 348 HIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNSLFGL 407

Query: 394 LAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFM 453
           LA+L  SS    VF WL+ +  +A    W+ I++SHIRF  A+K QG S D+L F +   
Sbjct: 408 LAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEFVSAVG 467

Query: 454 PWGAYYAAXXXXXXXXXXXXTAF-------APKFKVSDFFTAYISVMLFFVFWIGFQIWF 506
            WG+ Y+              +         P+ +   FF  Y+  ++    ++  +I++
Sbjct: 468 MWGSVYSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILLFMFVAHKIYY 527

Query: 507 RGPL-----FIKTEDIDLDTDRREID-DVVWEEQKPRNLW--EKFW 544
           R         +   +IDL++ R+ ID +VV  E   R  +  E+ W
Sbjct: 528 RSTTGQWWKILPLAEIDLESGRKNIDIEVVKHEVAARKKYISEQRW 573

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  283 bits (724), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 168/540 (31%), Positives = 269/540 (49%), Gaps = 19/540 (3%)

Query: 8   EATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFIS 67
           ++ +  +  HL     + +   SM+S       ++K+++K RH+ M++LG  IGTGL ++
Sbjct: 57  DSFKRAESQHLEDDNDLEDGTRSMKS-----NNRLKKSMKSRHVVMMSLGTGIGTGLLVA 111

Query: 68  ISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIP-VTSSFTVFTQRFLSPALGSA 126
            +  L  AGP   +I Y+ +  + Y + Q+ GEM    P +  +F  +   F+S + G A
Sbjct: 112 NAKGLKLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFA 171

Query: 127 NGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEF 186
             +++ + W     LEL      I++W D +    +I IF+V L   + F VK YGE EF
Sbjct: 172 TTWIFCIQWLTVLPLELITSSMTIKYWNDKINSDVFIVIFYVFLLFIHFFGVKAYGETEF 231

Query: 187 WIACIKVLAIVGFIIYAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWV 245
             +  K+L I GFII + ++ CG AG  G +G +YWR+PG +  G         RF G  
Sbjct: 232 IFSSCKILMIAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEG-----NGATRFKGIC 286

Query: 246 SSLISAAFTYQGTELVGITAGEAANPRKTVPRAINK-VXXXXXXXXXXXXXXXXXXXXXN 304
             L++A F++ G EL  ++  E +NPRK+ P A  + V                     N
Sbjct: 287 FILVTAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNN 346

Query: 305 DPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAM 364
           D  + S  +   +SP+V+A      +V+PHI NAVIL ++IS  NS +Y   R+  S+A 
Sbjct: 347 DQLMGSGSAATHASPYVLAASIHKVRVVPHIINAVILISVISVANSALYAAPRLMCSLAQ 406

Query: 365 NGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWIL 424
            G APK+L +  + G P  A+    ++G + ++  S      F WL  I  ++  FTW  
Sbjct: 407 QGYAPKFLDYIDREGRPLRALFVCCLVGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSG 466

Query: 425 ISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----K 479
           I +SHIRF +A+K QG S D++ +KA    WG+YY               A +P     K
Sbjct: 467 IMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGK 526

Query: 480 FKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTED-IDLDTDRREIDDVVWEEQKPRN 538
                FF +Y++  L+   ++G+ ++ R   F+   D IDLD  RR  D  +  ++   N
Sbjct: 527 CNAQAFFESYLAAPLWLCMYLGYMLYERDFTFLNPLDKIDLDYHRRVYDPEIIRQENEEN 586

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  281 bits (720), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 170/475 (35%), Positives = 246/475 (51%), Gaps = 11/475 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSL 98
           +T +K  LK RH+ MIA+GG IGTGL +   T L   GP   LI +   GT+ Y++  +L
Sbjct: 83  QTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMAL 142

Query: 99  GEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFW-TDAV 157
           GE+A   P++  FT +  RF+  + G AN + Y L W +   LE+      + FW TD  
Sbjct: 143 GELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPK 202

Query: 158 PLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
               ++A+FWV++ I N+F VK YGE EF  + IKV+ +VGFII   I+ CG G  G   
Sbjct: 203 YRDGFVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYI 262

Query: 218 F-RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
             +YW +PG +     + D    +F G  S  +++AF++ G+ELVG+ A E+  PRK+VP
Sbjct: 263 GGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTSAFSFAGSELVGLAASESVEPRKSVP 317

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPHI 335
           +A  +V                     ND  L    S   ++SPFVIAI+  G K LP +
Sbjct: 318 KAAKQVFWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAASPFVIAIKTHGIKGLPSV 377

Query: 336 FNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLA 395
            N VIL  ++S GNS +Y  SR   ++A     P+   +  + G P   +  TS  G +A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIGVTSAFGLIA 437

Query: 396 YLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++ +S     VFNWLL ++ ++  FTW  I I HIRF +AL  QG   D+L FK+    W
Sbjct: 438 FVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVW 497

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP---KFKVSDFFTAYISVMLFFVFWIGFQIWFR 507
           G+Y+               A  P         FF AY+S  L    +IG +I+ R
Sbjct: 498 GSYWGLFMVVIMFIAQFYVALFPVGGSPSAEGFFEAYLSFPLVMAMYIGHKIYKR 552

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  282 bits (721), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 168/530 (31%), Positives = 270/530 (50%), Gaps = 13/530 (2%)

Query: 4   SKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTG 63
           S D   + +  G  +    +I  D++   ++       + + L  RH+  +A+GG+IGTG
Sbjct: 40  SHDLGQSSKDSGYKISTGSAIDSDSLHGNNVAFEYGENLNKDLDIRHLLTLAIGGSIGTG 99

Query: 64  LFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPAL 123
           LF++  T L+  GP   +I ++ I +  ++V  +LGE+A   P+   F V+  RF+ P+ 
Sbjct: 100 LFVNSGTSLNTGGPASLIIGWVIISSALFTVINALGELAATFPIVGGFNVYMTRFVDPSF 159

Query: 124 GSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGE 183
             A    Y + W ++  LEL      I++W   +   AW+ IF+V + + N+  VK++ E
Sbjct: 160 AFAVNLNYLILWIVSLPLELVAASITIRYWNREINSDAWVTIFFVFIALLNMMDVKFFSE 219

Query: 184 VEFWIACIKVLAIVGFIIYAFIM-VCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFL 242
            EF ++ IK+LAIVGF I   ++ V G    G +G +YW +PG +       D    RF 
Sbjct: 220 AEFVMSIIKILAIVGFFILGIVLAVGGGPTGGYIGGKYWNDPGAF-----HGDSAGSRFK 274

Query: 243 GWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXX 302
           G  S  + AAF+Y G E+  ++A E+ NPRKT+P+A  +                     
Sbjct: 275 GLCSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPKATKRTFWVITFSYISILTLIGILVP 334

Query: 303 XNDPKLKSEDSYI--SSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAY 360
            ND +L S  S +  S+SP VIAIEN+G K LP + NA+IL  ++S  NS VYV SR+  
Sbjct: 335 YNDKRLLSGSSSVDASASPLVIAIENAGIKGLPSLMNAIILIALLSVANSCVYVCSRVMV 394

Query: 361 SMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFF 420
           SMA+    PK  +   K G P  ++  T  +G L+++ +S     VF WL  I  ++  F
Sbjct: 395 SMALTNTLPKVFSKVDKRGRPLYSIFATLFVGLLSFIAASDKQEEVFTWLSAICGLSTIF 454

Query: 421 TWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF 480
            WI I+++HIRF  ALK Q  S D+L + ++   WG++Y               +  P  
Sbjct: 455 CWIGINLAHIRFRAALKFQNRSLDELAYISQSGIWGSWYGVIILVLVLIASFWVSLFPVG 514

Query: 481 KVS----DFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRRE 525
           + S     FF  Y+S  +    +IG +++ +     I  E+ID+D  ++ 
Sbjct: 515 ESSADAEAFFEGYLSFPILIASYIGHKVYIKNWKWVIPLEEIDIDLGKKN 564

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  283 bits (723), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 185/547 (33%), Positives = 282/547 (51%), Gaps = 29/547 (5%)

Query: 27  DAVSMESLGSVKETQ------VKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGA 80
           D     SL   K+ Q      +K+ LK RH+ +IALGGTIGTGL +  S  L+  GP G 
Sbjct: 49  DYSETSSLDEEKQQQPEENGKLKQGLKSRHVQLIALGGTIGTGLLVGSSQTLATCGPAGL 108

Query: 81  LIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTV-----FTQRFLSPALGSANGYLYWLSW 135
             +Y+ I T  Y +  + GEM  ++P   S +        ++++  +LG A+ + Y+  +
Sbjct: 109 FTSYLIICTFIYPIMNAFGEMVCYLPGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCF 168

Query: 136 AITFALELSVVGQIIQFWTDA--VPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKV 193
            I  A E +    ++++W  A  VP  AWI IF   +   N+ PV +YGE EFW A IK+
Sbjct: 169 VILVATECTAAAGVVEYWAWALKVPKGAWITIFLFCVVALNMLPVNFYGESEFWFASIKI 228

Query: 194 LAIVGFIIYAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAA 252
           L I+G II +FI+  G G +   +GFRYW+ PG +   I   D   G FL   + +I   
Sbjct: 229 LCILGLIILSFILFWGGGPSHDRLGFRYWQRPGAFADHI--TDGTGGNFLDVYTGVIKGG 286

Query: 253 FTY-QGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKS- 310
           F +  G ELV +T+ E  + R+ + +A  +                      NDP L++ 
Sbjct: 287 FAFVLGPELVSLTSSECHDQRRNIAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNA 346

Query: 311 ---EDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGL 367
                    SSPFVI I+N+G KVLPHI N  I+++  SAGN+ ++  SR   +MA +G 
Sbjct: 347 LAQSKPGAGSSPFVIGIQNAGIKVLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHGH 406

Query: 368 APKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISI 427
           APK+ +   + G+PY AV  + +   LAYL  SS  + VFNW  NI+ ++GF  WI   +
Sbjct: 407 APKFFSKINRFGVPYVAVGFSFLFCCLAYLNVSSSTANVFNWFSNISTISGFIGWICACV 466

Query: 428 SHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF-KVSDFF 486
           ++IRF +A+    +  D LP+K     +  +Y+               F P+F    DF 
Sbjct: 467 AYIRFRKAIIFNDL-YDRLPYKGFAQKYLIWYSLFMVSLITLTNGYQIFIPRFWDYKDFI 525

Query: 487 TAYISVMLFFVFWIGFQIWFRG--PLFIKTEDIDLDTDRREIDDVVWE--EQK--PRNLW 540
            AYI++ +F V WIG ++  R     +I  + ID+ T   EI+++  E  E++  P N W
Sbjct: 526 AAYITLPVFIVLWIGHKLVTRSWRQWYIPVDKIDVFTGLEEIEELTNELDEKRVPPNNAW 585

Query: 541 EKFWAAI 547
           +KF  A+
Sbjct: 586 DKFLDAL 592

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  282 bits (722), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 176/532 (33%), Positives = 269/532 (50%), Gaps = 27/532 (5%)

Query: 25  AEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAY 84
           A D+      GS   + +K+ LK RH+ MIA+GG+IGTGLFI     L+  GP+  +I +
Sbjct: 69  AIDSFKPPEDGSFDTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGW 128

Query: 85  MFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELS 144
              G+        LGE+    PV  +F  ++ RFL P++      +Y + W     LE+ 
Sbjct: 129 AIAGSQIIGTIHGLGEITVRFPVVGAFANYSTRFLDPSISFVVSTIYVIQWFFVLPLEII 188

Query: 145 VVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAF 204
                +Q+W +++    W+AIF+V +   NLF V+ +GE EF  + IKV+ I GFI+   
Sbjct: 189 SSAMTVQYWNESIDPVVWVAIFYVTIVSINLFGVRGFGEAEFIFSTIKVITISGFILLCI 248

Query: 205 IMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGI 263
           I++ G G     VG RYW NPG    G          F G +S ++ A+++  GTE+  +
Sbjct: 249 ILIAGGGPDHVYVGSRYWHNPGCLANG----------FPGVLSVMVVASYSLGGTEMTCL 298

Query: 264 TAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIA 323
            +GE  +P K +P AI +V                      +  L    S + +SPFVIA
Sbjct: 299 ASGE-TDP-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSS-VDNSPFVIA 355

Query: 324 IENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYA 383
           I+    KVLP I NAVIL +I+S GNS ++  SR   SMA   L P +  +  ++G P  
Sbjct: 356 IKIHHIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQHLLPWWFGYIDRAGRPLV 415

Query: 384 AVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISR 443
            ++T S+ G LA+L  S   S VF+WL+ I  +A    W+ I++SHIRF  A+K QG S 
Sbjct: 416 GIITNSLFGLLAFLVKSGSMSEVFDWLMAIAGLATCIVWLSINVSHIRFRLAMKAQGRSL 475

Query: 444 DDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-------KFKVSDFFTAYISVMLFF 496
           ++L F +    WG+ Y+A             +  P       + +   FF +Y+  ++  
Sbjct: 476 NELEFVSAVGIWGSVYSAIINCLILVAQFYISLWPIGGWKNSEDRAKKFFQSYLCALIMV 535

Query: 497 VFWIGFQIWF---RGPL--FIKTEDIDLDTDRREID-DVVWEEQKPRNLWEK 542
             WIG +I++    G +  F    +IDLD  R+ ID DV+ +E   R ++ K
Sbjct: 536 CIWIGHKIYYWRQTGKIWAFTPLAEIDLDEGRKNIDLDVLKQEIHERKMYLK 587

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  282 bits (721), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 173/551 (31%), Positives = 276/551 (50%), Gaps = 31/551 (5%)

Query: 1   MSLSKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKET---QVKRALKPRHISMIALG 57
           +S+    +    KDG     KP I  + V +ES    KE+    +K  L+ RHI +IALG
Sbjct: 16  ISVYDKNDKNNIKDGVSFE-KPIIYSE-VDIES--GAKESSSRNLKHGLQSRHIQLIALG 71

Query: 58  GTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSS------- 110
           GTIGTGLF+  S+ L+N GP   +I+Y+ I T+ Y +    GEM  ++P           
Sbjct: 72  GTIGTGLFVGTSSTLANCGPAALVISYIVISTIVYPIMNMFGEMVCYLPGNDDDDESVGY 131

Query: 111 FTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVIL 170
                 +++  +LG A  + Y+  + +  A E +    I+++WT  +P    I +F  ++
Sbjct: 132 CAYLVSKYVDESLGFATSWNYYYCFIVLVATECTAASSIVEYWTSKIPKAVLIFLFLGVI 191

Query: 171 TISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGP----VGFRYWRNPGP 226
            + N  PVK+YGE EFW A IK+  I G II AF++ CG          VGF YW+NP  
Sbjct: 192 FLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGAPNNEDNSFVGFHYWKNPSS 251

Query: 227 WGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVGITAGEAANPRKTVPRAINKVXXX 285
           +   + +  +  G FL   ++LI  AF +  G ELV +T+ E  + R+ + +A  +    
Sbjct: 252 FRDYVTNGSL--GNFLDVYNALIKGAFAFILGPELVSLTSSECVDQRRNIAKASRRFVYR 309

Query: 286 XXXXXXXXXXXXXXXXXXNDPKLKSEDSY----ISSSPFVIAIENSGTKVLPHIFNAVIL 341
                             NDP L +  +       SSPFVI I+N+G  +LPHI N  IL
Sbjct: 310 LMFFYIFGALSISVIVPYNDPTLLNALALNKPGAGSSPFVIGIQNAGITILPHIINFCIL 369

Query: 342 STIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSS 401
           ++ +SAGN+ ++  +R   +M  NG AP+  +   + G+PY A+  + ++  LA+L  S+
Sbjct: 370 TSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRINRHGVPYVALSLSIMIACLAFLNCSA 429

Query: 402 GASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAA 461
            ++ VF W  NI+ ++GF  W    I+++RF + + + G+  D LPFK K   +  +Y+ 
Sbjct: 430 SSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRTIDYNGL-YDRLPFKTKGQVYLTWYSF 488

Query: 462 XXXXXXXXXXXXTAFAPKF-KVSDFFTAYISVMLFFVFWIGFQI----WFRGPLFIKTED 516
                           PKF    DF  AYI++ +F V + G  I    W +   +   ++
Sbjct: 489 VFVGILILTNGYMYIIPKFWNYQDFIAAYITLPVFLVLYFGHIIYSGRWRQRKWWKPVDE 548

Query: 517 IDLDTDRREID 527
           ID+ T   EI+
Sbjct: 549 IDVVTGLEEIE 559

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  281 bits (720), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 165/511 (32%), Positives = 262/511 (51%), Gaps = 13/511 (2%)

Query: 33  SLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAY 92
            + S   T++++ ++ RH+ M++LG  IGTGL ++ +  L   GP G LI Y+ +  ++Y
Sbjct: 54  EINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSY 113

Query: 93  SVTQSLGEMATFIP-VTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQ 151
            +  + GEMA   P +  +F  ++  F+S   G A  +L+ L W   F LEL     +I+
Sbjct: 114 IMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIK 173

Query: 152 FWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGA- 210
           +W  +V    ++ IF++ +   + F  + YGE EF     KVL IVGF+I   ++  GA 
Sbjct: 174 YWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAI 233

Query: 211 GKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAAN 270
           G TG +G RYWRNPG +  G         +  G    L++A F++ G EL  ++  E  N
Sbjct: 234 GDTGYIGDRYWRNPGSFVSG-----TPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPN 288

Query: 271 PRKTVPRAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGT 329
           P+  +P A  K V                     +D  + S  + +  SP+V+AIE  G 
Sbjct: 289 PKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGV 348

Query: 330 KVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTS 389
           KVLPHI NAVIL ++IS GNS +Y   R+  ++A  G APK L +  + G P  +++  +
Sbjct: 349 KVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCA 408

Query: 390 VLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFK 449
           + G +A+  +S     +F WL  I  ++  FTW  I +SH RF QA+K QG S + L ++
Sbjct: 409 IFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYR 468

Query: 450 AKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIW 505
           A    WG+ YA              A  P    K  V  FF  Y++  L+ + ++G+ ++
Sbjct: 469 AITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVY 528

Query: 506 FRG-PLFIKTEDIDLDTDRREIDDVVWEEQK 535
            R   L    + +DLDT RR  D  V ++++
Sbjct: 529 SRNWTLLNPLDKMDLDTHRRVYDVEVLKQEE 559

>YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}
           AGP3Low-affinity amino acid permease, may act to supply
           the cell with amino acids as nitrogen source in
           nitrogen-poor conditions; transcription is induced under
           conditions of sulfur limitation; plays a role in
           regulating Ty1 transposition
          Length = 558

 Score =  281 bits (718), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 179/539 (33%), Positives = 270/539 (50%), Gaps = 27/539 (5%)

Query: 6   DYEATREKDGSHLIIKPSIAE--DAVSMESLGSVK----ETQVKRALKPRHISMIALGGT 59
           D E T +KD     IKP  A   +AV ++    V     +T VKRALK RHIS++ALGG 
Sbjct: 12  DIEETAKKD-----IKPYFASNVEAVDIDEDPDVSRYDPQTGVKRALKNRHISLLALGGV 66

Query: 60  IGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFL 119
           IG G  +     L+  GP+  L+ +  IG +A+SV +S+GEM T  P    FT   +RF 
Sbjct: 67  IGPGCLVGAGNALNKGGPLALLLGFSIIGIIAFSVMESIGEMITLYPSGGGFTTLARRFH 126

Query: 120 SPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVK 179
           S AL +  GY Y + +    A E + +  I+QFW   VPL  +I IFW    I  L  V 
Sbjct: 127 SDALPAVCGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYGYILIFWFAFEIFQLVGVG 186

Query: 180 YYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPV-GFRYWRNPGPWGPGIISKDVNE 238
            +GE E+W+A +K++ +V + I++ + + G  +  P  GF YW +PG    G        
Sbjct: 187 LFGETEYWLAWLKIVGLVAYYIFSIVYISGDIRNRPAFGFHYWNSPGALSHG-------- 238

Query: 239 GRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXX 298
             F G     +  +  Y GTE V + A E+ NP K VP A+ +                 
Sbjct: 239 --FKGIAIVFVFCSTFYSGTESVALAATESKNPGKAVPLAVRQTLWRILVVYIGIAVFYG 296

Query: 299 XXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRI 358
                +DP L S  + +  SP  IAI  +G     H+ NA IL T ISA N ++Y+GSR 
Sbjct: 297 ATVPFDDPNL-SASTKVLKSPIAIAISRAGWAGGAHLVNAFILITCISAINGSLYIGSRT 355

Query: 359 AYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAG 418
              +A  GLAPK L WT + G+P  A+   + LG ++ +  S GA+  +++++N++ V  
Sbjct: 356 LTHLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLMNVSVGAANAYSYIVNLSGVGV 415

Query: 419 FFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP 478
           F  W +IS +H+R  +A   QG S ++LP++A F PW    +             + F P
Sbjct: 416 FIVWGVISYTHLRIRKAWVAQGRSIEELPYEALFYPWTPVLSLAANIFLALIQGWSYFVP 475

Query: 479 KFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLF--IKTEDIDLDTDRREIDDVVWEEQK 535
            F   +F  AYI + +  + +IG  + F+   F  +    I+LD  RR+  +    +Q+
Sbjct: 476 -FDAGNFVDAYILLPVGILLYIGICV-FKSNHFRTVDLRSINLDEGRRKDMEADLSDQE 532

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  281 bits (719), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 167/520 (32%), Positives = 263/520 (50%), Gaps = 27/520 (5%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           GS   + +KR LKPRH+ MIA+GG+IGTGLF+     ++  GP+G +I +   G+     
Sbjct: 71  GSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGWAIAGSQIIGT 130

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
              LGE+    PV  +F  +  RFL P++      +Y L W     LE+      +Q+W 
Sbjct: 131 IHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWN 190

Query: 155 DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
            ++    W+AIF+ ++   NLF V+ +GE EF  + IK + + GFII   +++CG G   
Sbjct: 191 SSIDPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCVVLICGGGPDH 250

Query: 215 P-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
             +G +YW +PG    G          F G +S L+ A+++  G E+  + +GE  +P K
Sbjct: 251 EFIGAKYWHDPGCLANG----------FPGVLSVLVVASYSLGGIEMTCLASGE-TDP-K 298

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
            +P AI +V                      +  L    S + +SPFVIAI+    K LP
Sbjct: 299 GLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKALP 357

Query: 334 HIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGF 393
            I NAVIL +++S GNS ++  SR   SMA  GL P +  +  ++G P   ++  S+ G 
Sbjct: 358 SIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGL 417

Query: 394 LAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFM 453
           LA+L  S   S VFNWL+ I  +A    W+ I++SHIRF  A+K QG S D+L F +   
Sbjct: 418 LAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVG 477

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP-------KFKVSDFFTAYISVMLFFVFWIGFQIWF 506
            WG+ Y+A             +  P       K +   FF  Y+  ++    +I  +I++
Sbjct: 478 IWGSAYSALINCLILIAQFYCSLWPIGGWTSGKERAKIFFQNYLCALIMLFIFIVHKIYY 537

Query: 507 RGPL-----FIKTEDIDLDTDRREID-DVVWEEQKPRNLW 540
           +            +DIDL+TDR++ID ++V +E   + ++
Sbjct: 538 KCQTGKWWGVKALKDIDLETDRKDIDIEIVKQEIAEKKMY 577

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  281 bits (719), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 167/526 (31%), Positives = 268/526 (50%), Gaps = 29/526 (5%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           GS   + +KR LKPRH+ MIA+GG+IGTGLF+     ++  GP+G ++ +   G+     
Sbjct: 71  GSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGT 130

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
              LGE+    PV  +F  +  RFL P++      +Y L W     LE+      +Q+W 
Sbjct: 131 VHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWN 190

Query: 155 DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
            ++    W+AIF+ ++   NLF  + +GE EF  + +K + + GFII   +++CG G   
Sbjct: 191 SSIDPVIWVAIFYAVIVSINLFGARGFGEAEFAFSTVKAITVGGFIILCIVLICGGGPDH 250

Query: 215 P-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
             +G +YW +PG    G          F G +S L+ A+++  G E+  + +GE  +P K
Sbjct: 251 EFIGAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGIEMTCLASGE-TDP-K 298

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
            +P AI +V                      +  L    S + +SPFVIAI+    KVLP
Sbjct: 299 GLPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKVLP 357

Query: 334 HIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGF 393
            I NAVIL +++S GNS ++  SR   SMA  GL P +  +  ++G P   ++  S+ G 
Sbjct: 358 SIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGL 417

Query: 394 LAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFM 453
           LA+L  S   S VFNWL+ I  +A    W+ I++SH+RF  A+K QG S D+L F +   
Sbjct: 418 LAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHVRFRLAMKAQGKSLDELEFVSAVG 477

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP-------KFKVSDFFTAYISVMLFFVFWIGFQIWF 506
            WG+ Y+A             +  P       K +   FF  Y+  ++    ++  +I++
Sbjct: 478 IWGSVYSALINCLILIAQFYCSLWPIGGWTSSKERAKIFFQNYLCALIMVFIFVIHKIYY 537

Query: 507 RGPL-----FIKTEDIDLDTDRREID-DVVWEE--QKPRNLWEKFW 544
           R  +       + +DIDL+TDR++ID ++V +E  +K + L  + W
Sbjct: 538 RCQMGKWWGVKELKDIDLETDRKDIDIEIVKQEIAEKKKYLDSRPW 583

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  281 bits (720), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 169/541 (31%), Positives = 274/541 (50%), Gaps = 22/541 (4%)

Query: 6   DYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLF 65
           D+  T     + L + PS        +SL   K   +KR +KPRH+ M++L   IGTGL 
Sbjct: 74  DHINTNIHGNAELELNPS--------QSLLPEKGASLKRDIKPRHVVMMSLATGIGTGLL 125

Query: 66  ISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIP-VTSSFTVFTQRFLSPALG 124
           +     L+  GP G  I Y  +G+  YS+ Q+ GE+A   P +T +F  +    + PA+ 
Sbjct: 126 VGNGKALATGGPAGLTIGYAIMGSCLYSIIQAAGELAVAYPTLTGNFNNYPSFLVDPAMC 185

Query: 125 SANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEV 184
            A   LY + W   F LE+      I++W  ++    W  IF+V++   N+     Y E 
Sbjct: 186 FATAALYCIQWLCVFPLEVISAAITIKYWNTSINPNVWCVIFYVMIIGINMCGSAGYAEA 245

Query: 185 EFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLG 243
           +F+    K+L   GF I   I+ CG AG +  +G +YW +PG +     + D    RF  
Sbjct: 246 DFFFNTCKILMFAGFFILGIIINCGGAGDSVYIGGKYWNDPGAF-----NGDTGISRFKA 300

Query: 244 WVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXX 303
            VS+L++AAF +  +E V +TA E ANPRK +P A  +V                     
Sbjct: 301 IVSTLVTAAFAFGASEAVALTASEQANPRKAIPSAAKQVLYRIIAIYLASIILVGFLVPY 360

Query: 304 NDPKL-KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSM 362
           N P+L  S  S + SSP+VIA+ + G KV+P   NAVIL +++S GN + Y  SRI   +
Sbjct: 361 NSPELMGSGSSSVHSSPYVIAVASHGVKVVPSFINAVILISVLSVGNFSFYSSSRILLCL 420

Query: 363 AMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTW 422
           +  G APK+  +  + G P  A++  +++G + ++ +SS   +VF WL+ ++ ++  FTW
Sbjct: 421 SEIGYAPKFFQYVDRQGRPLYAMIVGALVGCICFVSASSAEESVFTWLMAVSGLSQLFTW 480

Query: 423 ILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP---- 478
             I ISH+RF +A++ Q  S  +L F+++   WG+YY               A  P    
Sbjct: 481 TNICISHVRFRKAMQVQNRSIGELGFRSQVGVWGSYYGIFMMILVFIGQFWVALFPVGGT 540

Query: 479 -KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQKP 536
                 +FF  Y+++ +F   + GF+IW +   L+I   +IDL + R+  D+ + +++  
Sbjct: 541 DGADAENFFANYLAMPVFLALYFGFKIWKKDWRLYIPASEIDLISHRKIFDEEILKQEDE 600

Query: 537 R 537
            
Sbjct: 601 E 601

>Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)
          Length = 558

 Score =  280 bits (715), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 167/500 (33%), Positives = 254/500 (50%), Gaps = 16/500 (3%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSL 98
            T VKRALK RHIS++ALGG IG G  +     L+  GP+  L+ +  IG +A++V +S+
Sbjct: 46  NTGVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGVIAFAVMESI 105

Query: 99  GEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVP 158
           GE+ T  P    FT   +RF   AL +  GY Y + +    A E + +  I+QFW   VP
Sbjct: 106 GEIITLYPSGGGFTTLARRFHGDALSAVCGYAYVVVFFAVLANEYNTLSSILQFWGPQVP 165

Query: 159 LTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPV-G 217
           L  +I IFW    I  L  V  +GE E+W++  K++ +V + I++ I + G  K  P  G
Sbjct: 166 LYGYILIFWFAFEIFQLIGVSLFGETEYWLSWFKIVGLVAYYIFSIIYISGGIKDRPAFG 225

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           F YW +PG    G          F G     +  +  Y GTE V + A E+ NP K VP 
Sbjct: 226 FHYWNSPGSLSHG----------FKGIAVVFVFCSTFYSGTECVALAATESKNPGKAVPL 275

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           A+ +                      +DP L S  + +  SP  IAI  +G     H+ N
Sbjct: 276 AVRQTLWRVLIVYIGIAVFYGATVPFDDPNL-SATTKVLKSPISIAISRAGWAGGAHLVN 334

Query: 338 AVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYL 397
           A IL T ISA N ++Y+GSR   ++A  GLAPK L WT + G+P  A+   + LG ++ +
Sbjct: 335 AFILVTCISAINGSLYIGSRTLTNLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLM 394

Query: 398 ESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
             S GAS  +++++N++ V  F  W +IS +H+R  +A   QG S ++LP+KA   PW  
Sbjct: 395 NVSVGASDAYSYIVNLSGVGVFIVWGVISYTHLRVRKAWVTQGRSLEELPYKALLYPWTP 454

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLF--IKTE 515
            ++             T+F P F   +F  AYI + +  V ++   + F+   F  +  +
Sbjct: 455 IFSLIANVFLALIQGWTSFVP-FDAGNFVDAYILLPVAIVLYVAICV-FKNHHFRIVDLK 512

Query: 516 DIDLDTDRREIDDVVWEEQK 535
            +DLD  RR+  D  + +Q+
Sbjct: 513 SVDLDEGRRKDIDADFSDQE 532

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  280 bits (716), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 170/526 (32%), Positives = 265/526 (50%), Gaps = 35/526 (6%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           GS   + +KR LK RH+ MIA+GG+IGTGLFI     L+  GP+  +I +   G+     
Sbjct: 56  GSFDTSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGSQIVGT 115

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
              LGE+    PV  +F  ++ RFL P++      +Y + W     LE+      IQ+W 
Sbjct: 116 IHGLGEITVRFPVVGAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAITIQYWN 175

Query: 155 DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
            ++    W+AIF+ ++   NLF  + +GE EF  + IK + I GFII   +++CG G   
Sbjct: 176 SSIDPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFIILCIVLICGGGPDH 235

Query: 215 P-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
             +G +YW +PG    G          F G +S L+ A+++  GTE+  + +GE  +P K
Sbjct: 236 EFIGAKYWHDPGALAHG----------FPGVLSVLVVASYSLGGTEMTCLASGE-TDP-K 283

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
            +P AI +V                      +  L    S + +SPFVIAI+    K LP
Sbjct: 284 ELPSAIKQVFWRILFFFLASLTLVGFLVPYTNENLLGGSS-VDNSPFVIAIKLHHIKALP 342

Query: 334 HIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGF 393
            I NAVIL +I+S GNS ++  SR   SMA  GL P++  +  ++G P A ++T S+ G 
Sbjct: 343 SIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVTNSLFGL 402

Query: 394 LAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFM 453
           LA+L  SS  S VF+WL+ I  +A    W+ I++SHIRF  A+K Q  + D+L F +   
Sbjct: 403 LAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELEFVSAVG 462

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP-------KFKVSDFFTAYISVMLFFVFWIGFQIWF 506
            WG+ Y+A             +  P         +   FF +Y+  ++  + +   ++++
Sbjct: 463 IWGSAYSALINVLILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLIFCIHKVYY 522

Query: 507 R---------GPLFIKTEDIDLDTDRREID-DVVWEEQKPRNLWEK 542
           R          PL    +DIDL+T R+ +D DV+  E   R ++ K
Sbjct: 523 RVSFGKWWDVKPL----KDIDLETGRKNVDIDVIKAEIAERKMYLK 564

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  281 bits (719), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 172/554 (31%), Positives = 285/554 (51%), Gaps = 17/554 (3%)

Query: 1   MSLSKDYEA-----TREKDGSHLIIKPSIAEDAVSMESLG-SVKETQVKRALKPRHISMI 54
           MS+S   EA     T  ++G    I   + ++  S +S   S++E   +R L PR +SMI
Sbjct: 70  MSVSGKKEAFELNVTSLEEGETATIDDFVLQNRDSPKSQSLSLEERIARRKLLPRQVSMI 129

Query: 55  ALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVF 114
            +GG IGT LF+SI T +   GP   LIA+     +   +++ +  M T++PVT SF  F
Sbjct: 130 GIGGAIGTALFVSIGTKIIQGGPGSLLIAFCLWSVVFIGLSKCMCVMVTYLPVTGSFVHF 189

Query: 115 TQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISN 174
           T+RF+  + G A G+ Y++  A     E++ V  ++++WTD +P  A I++  ++    N
Sbjct: 190 TERFVDQSCGFAVGWTYFVCQAANVCFEITAVCLVVEYWTDKIPKAALISMLIILFGSLN 249

Query: 175 LFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPV-GFRYWRNPGPWGPGIIS 233
           L+ V ++GE EF+++  KV+  +G II+  +++ G      V GF+ W NPG +   I  
Sbjct: 250 LYSVFFFGEGEFYLSIGKVVLAIGLIIFTVVVMAGGNPQHTVLGFKNWSNPGAFAEYI-- 307

Query: 234 KDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXX 293
            D + GRF G++S L+ A + + G + +G  A EA NPRK +P +  KV           
Sbjct: 308 SDGSVGRFHGFMSCLVFALYVFWGVDYLGNAASEAMNPRKVIPSSFRKVFGRLIIFYIGG 367

Query: 294 XXXXXXXXXXNDPKL----KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGN 349
                     NDP +    K       +SP+V A++  G +VLPHI N +IL++IISAGN
Sbjct: 368 AICVGILIPYNDPNMIRAIKEGAVGAGASPYVSAMKTLGIRVLPHIVNILILTSIISAGN 427

Query: 350 SNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNW 409
           S++Y  SR+ + +A++  AP+    TTK G+P    +   V+  LAYL  S+  + V  W
Sbjct: 428 SSLYSASRVLHRLALDNQAPRIFKVTTKKGVPVYCCIAVLVICGLAYLSVSNSTNNVLTW 487

Query: 410 LLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXX 469
            LN+   A    +I I +S+++F +    Q +    LP+ +  +P+ A+++         
Sbjct: 488 FLNVETAAMAIVYIFICVSYLQFRKGCLAQNVDLKSLPYYSSSLPYLAWHSLFWLVLMLL 547

Query: 470 XXXXTAFAP-KFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREI-- 526
               T F    +    F  +Y  +  F VF  G +++ +G   ++  ++DL T   E+  
Sbjct: 548 VNGYTVFLKGSWDTQSFVFSYFMIPFFLVFLFGHKLY-KGTKSVRPLEMDLFTGIEELAD 606

Query: 527 DDVVWEEQKPRNLW 540
           +D  W E  P   W
Sbjct: 607 EDRYWAENPPTLNW 620

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  280 bits (715), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 155/505 (30%), Positives = 261/505 (51%), Gaps = 21/505 (4%)

Query: 40  TQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLG 99
           T++K+++K RH+ MI+LG  IGTGL +     L+ AGP G +I Y     + Y + Q+ G
Sbjct: 68  TKMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGPAGLVIGYAVASIMLYCIIQAAG 127

Query: 100 EMA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVP 158
           E+   +  +  ++T ++   + PALG +  ++Y + W     L+L      +++WT+A P
Sbjct: 128 ELGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWMTVLPLQLVTAAMTVRYWTNANP 187

Query: 159 LTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPVG 217
              ++A+F+V++ + N+F  K Y E EF     KVL I GF+I    + CG AG +G +G
Sbjct: 188 -DIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKVLMIAGFVILGIAINCGGAGTSGYIG 246

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
            +YW +PG +  G          F G       AAF+Y G E++ +TA E  NPRK++P 
Sbjct: 247 AKYWHSPGSFAAG----------FKGVCYVFCYAAFSYGGIEVMVLTASEQENPRKSIPN 296

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKL--KSEDSYISSSPFVIAIENSGTKVLPHI 335
           A  KV                     N  +L   S +S   +SP VIA+ + G K++PHI
Sbjct: 297 ACKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGESASHASPLVIAVASHGVKIVPHI 356

Query: 336 FNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLA 395
            NAVIL ++IS GNS++Y   R+  S++  G APK+L +  + G P      T ++  +A
Sbjct: 357 INAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQGRPLICFAITLLVALIA 416

Query: 396 YLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++ +S     +F WLL I+ ++  F W  I +SH+RF  A+  QG+S   + +K++   W
Sbjct: 417 FVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDAMHAQGLSLGQIGYKSQTGYW 476

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-P 509
           G+++A              A AP     +     FF  Y++  +    + G++++ +   
Sbjct: 477 GSWFAIVISVLVLIAQFWVAIAPIGEEGRLNAETFFQNYLAFPILLGAYFGYKVYHKDWR 536

Query: 510 LFIKTEDIDLDTDRREIDDVVWEEQ 534
           L I   ++DL + R   D+ +  ++
Sbjct: 537 LCIPASEVDLSSHRNISDEEILRQE 561

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  282 bits (721), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 163/510 (31%), Positives = 268/510 (52%), Gaps = 17/510 (3%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97
           K  ++K+ +KPRH+ MI+LG  IGTGL + + + L  AGP G +I +  +G+  Y + Q+
Sbjct: 154 KSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQA 213

Query: 98  LGEMAT-FIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDA 156
           +GE+A  +  +   F  +    +  A   A  +LY + W     LEL      I++WT  
Sbjct: 214 VGELAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKYWTTK 273

Query: 157 VPLTAWIAIFWVILTISNLFP-VKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTG 214
           V    ++ IF++++   NL      Y E EF     K++ ++GF I    ++CG AG  G
Sbjct: 274 VDPDIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGGAGTDG 333

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
            +G +YW +PG      +  D +  RF G +++L++AAF +  +E +G+TA E +NPRK 
Sbjct: 334 YIGAKYWHDPGA-----LRGDTSIQRFKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKA 388

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVIAIENSGTKVLP 333
           +P A  K+                     N D  L S  S + +SP+V+AI   G +V+P
Sbjct: 389 IPSAAKKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKASPYVLAISTHGVRVVP 448

Query: 334 HIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGF 393
           H  NAVIL +++S  NS  Y  SR+  S+A  G APK  ++  + G P   + T ++ G 
Sbjct: 449 HFINAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAAIFGV 508

Query: 394 LAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFM 453
           +A+  +S     VF WLL I+ ++  FTW+ I ISHIRF +A+  QG S  +L F+++  
Sbjct: 509 IAFCATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFRSQVG 568

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP-------KFKVSDFFTAYISVMLFFVFWIGFQIWF 506
            +G+ YAA             A  P       K    +FF  Y+++ +   F+ G++IW 
Sbjct: 569 WYGSAYAAIMMFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAFYFGYKIWK 628

Query: 507 RG-PLFIKTEDIDLDTDRREIDDVVWEEQK 535
           +   LFI+ ++IDL + R   D+ + ++++
Sbjct: 629 KDWKLFIRAKNIDLISHRNIFDEELIKQEE 658

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  278 bits (712), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 179/529 (33%), Positives = 279/529 (52%), Gaps = 16/529 (3%)

Query: 25  AEDAVSMESLG-SVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIA 83
           AE   S+E    S++E   +R L PR +SMI +GG IGT LF+SI T + + GP   LIA
Sbjct: 27  AETIRSLEGQAPSLEERIARRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIA 86

Query: 84  YMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALEL 143
           +     +   ++Q +  M T++PVT SF  FT+RF+  + G + G+ Y++  A     E+
Sbjct: 87  FCLWSVVFIGLSQCMCVMVTYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEI 146

Query: 144 SVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYA 203
           + V  +++FWTD +P  A I+I   +    NLF V  +GE EF+++  KV+  +G I + 
Sbjct: 147 TAVCLVVEFWTDKIPKAALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFT 206

Query: 204 FIMVCGAGKTGPV-GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVG 262
            +++ G      V GF+ W NPG +    ISK  + G+F G++S LI A + + G + +G
Sbjct: 207 IVVMAGGNPQHKVLGFKNWSNPGAFAE-YISKG-SAGKFHGFMSCLIFALYVFWGVDYLG 264

Query: 263 ITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDP---KLKSEDSY-ISSS 318
             A EA NPRK +P +  KV                     ND    K  SE +    +S
Sbjct: 265 NAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGAS 324

Query: 319 PFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKS 378
           P+V A++  G  VLPHI N +IL++IISAGNS++Y  SR+ + +A+ G APK L   TK 
Sbjct: 325 PYVSAMKTLGIGVLPHIVNVLILTSIISAGNSSLYSASRVLHRLALEGQAPK-LFKITKR 383

Query: 379 GIP-YAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALK 437
           G+P Y  V    V G LAYL  S+  + V  W LN+   A    +I I IS+++F +  K
Sbjct: 384 GVPIYCCVAVLLVCG-LAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCK 442

Query: 438 HQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFKVSDFFTAYISVMLFF 496
            Q I    LP+ + F+P+  +++               F    + +  F  +Y  +  F 
Sbjct: 443 AQNIDLKTLPYSSSFLPYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFI 502

Query: 497 VFWIGFQIWFRGPLFIKTEDIDLDTDRREI--DDVVWEEQKPR-NLWEK 542
           V + G +++ +   F+K  ++DL +   E+  +D  WEE  P+ NL +K
Sbjct: 503 VLFAGHKLY-KKTRFVKPVEMDLFSGIAELAEEDAYWEENPPKMNLLDK 550

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  280 bits (717), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 162/505 (32%), Positives = 266/505 (52%), Gaps = 14/505 (2%)

Query: 40  TQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLG 99
           T + + L  RH+  +A+GG IGTGLF++  + L+  GP   +I ++ + T  ++V  SLG
Sbjct: 139 TDMNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTALFTVINSLG 198

Query: 100 EMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPL 159
           E+A   PV   F+V+  +F+ P+   A    Y L W +   LEL      I++W  ++  
Sbjct: 199 ELAAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITIRYWNSSINS 258

Query: 160 TAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGP-VGF 218
            AW++IF+V + ++N+  VK +GE EF ++ +K+LAI+GF I   ++ CG G +   +G 
Sbjct: 259 DAWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCGGGPSHEYIGG 318

Query: 219 RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRA 278
           +YW +PG +  G  S      +F G  S  ++AAF++ G E+  ++A E+ NPR+T+P+A
Sbjct: 319 KYWHDPGAF-VGTTSG----SKFKGLCSVFVTAAFSFSGIEMTAVSAAESRNPRETIPKA 373

Query: 279 INKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSPFVIAIENSGTKVLPHIF 336
             +                      NDP+L +  S +  +SSP VIAIEN     LP + 
Sbjct: 374 AKRTFWLITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASSPLVIAIENGHIHGLPSLM 433

Query: 337 NAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAY 396
           NA+IL  I+S  NS+VY  SR   SM+     PK      + G P  A+      G L++
Sbjct: 434 NAIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAICFVLFFGLLSF 493

Query: 397 LESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWG 456
           + +S   + VF WL  ++ ++  F W+ I++ HIRF Q +  Q IS D+LPF ++   WG
Sbjct: 494 VAASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDELPFLSQTGIWG 553

Query: 457 AYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLF 511
           + Y              T+  P    K   + FF  Y+S  +    +I  +++F+    +
Sbjct: 554 SIYGIVILFLVLVASFWTSLFPVGSSKANATSFFEGYLSFPILLGCYIAHKVYFKNWRWY 613

Query: 512 IKTEDIDLDTDRREID-DVVWEEQK 535
           I    +DL + R+++D +VV EE +
Sbjct: 614 IPASKMDLHSGRKQVDLEVVREELR 638

>ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {ON}
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046C BAP3 Amino acid permease involved in the uptake
           of cysteine leucine isoleucine and valine
          Length = 620

 Score =  279 bits (713), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 171/514 (33%), Positives = 265/514 (51%), Gaps = 17/514 (3%)

Query: 37  VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQ 96
           V    +K+ALK RH++M++LG  IGTGL I+    LSNAGP   LI Y  +    Y + Q
Sbjct: 94  VSNAGLKQALKTRHVAMMSLGTGIGTGLLIANGKGLSNAGPAPLLIGYGLVSVNTYFMVQ 153

Query: 97  SLGEMATFIP-VTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTD 155
           + GE+A   P +  SF  +T + +S   G A  +L+++ W   F +EL  +   ++FWT 
Sbjct: 154 AAGELAVAFPTIPGSFNAYTSQLVSRPFGFATTWLFFVQWLTMFPMELIAMTFAVRFWTT 213

Query: 156 AVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTG 214
            V    ++ IF+V L I +   V+ YGE EF++   KVL ++GF+I+A  +  G AG +G
Sbjct: 214 RVDADVFVLIFFVFLFIVHFIGVEAYGETEFFLNLFKVLMVIGFVIFAICVAAGGAGDSG 273

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
            +G +YW +PG +          EGRF G    L+SA F+Y GTEL  ++  E  NPRKT
Sbjct: 274 YIGAKYWHDPGAF-----VSHTAEGRFKGVCYVLVSAYFSYGGTELFVLSVNEQENPRKT 328

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK----SEDSYISSSPFVIAIENSGTK 330
           +P A                         N P+L     +++   S SP+V+A      +
Sbjct: 329 IPTATKTTIYRIIFIYLLTMVLVGFTVPNNHPRLMGSPYAKEGVQSVSPYVLAASYHHVR 388

Query: 331 VLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSV 390
           VLPH  NAV++  ++S  NS +Y   R+  S+A  G  PKY  +  + G P  A++   +
Sbjct: 389 VLPHFINAVVMLALVSMSNSAMYAAPRLICSLAQQGYCPKYFDYIDRRGRPTRALVLCFI 448

Query: 391 LGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKA 450
           +G +A+  SS     +F+WL  I  ++  FTW  I +SH+RF  A+K QG   ++L +K+
Sbjct: 449 IGVIAFASSSEKRETIFSWLSAIAGLSELFTWSSIMLSHVRFRAAIKVQGKDINELGYKS 508

Query: 451 KFMPWGAYYAAXXXXXXXXXXXXTAF-AP----KFKVSDFFTAYISVMLFFVFWIGFQIW 505
               WG+ Y               A  AP    K   SDFF +Y+++ ++  F++GF +W
Sbjct: 509 NTGVWGSAYGVFFSLLVFAAQFWVALSAPNSGGKCSASDFFQSYLALPIWLTFYVGFMLW 568

Query: 506 FRGPLF-IKTEDIDLDTDRREIDDVVWEEQKPRN 538
            R   F I    +DLD+ RR  D  +  ++   +
Sbjct: 569 TRDFTFLIPLNKVDLDSYRRYYDPELLRQEDEEH 602

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  277 bits (708), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 184/558 (32%), Positives = 286/558 (51%), Gaps = 28/558 (5%)

Query: 7   YEATREKDGSHLIIKPSIAE-DAVSMESLGSVKETQ-VKRALKPRHISMIALGGTIGTGL 64
           Y + R K+ +   +   I + D  S   + + K  Q + R LK RHI +IALG  IGTGL
Sbjct: 18  YISNRIKEQAFSSVNDVIGDSDQGSYSDIENFKPPQKIVRGLKTRHIQLIALGSAIGTGL 77

Query: 65  FISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFT--QRFLSPA 122
           FI     LS  GP   LIAY+ I    +S+   + EM   IP+    ++++  + +L+  
Sbjct: 78  FIGSGGALSVCGPAPLLIAYIIISFFVWSIMNQMTEMVCLIPLPGEASLYSLAKTYLNSP 137

Query: 123 LGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYG 182
           +    G+  + + A+    E++    ++Q+WTDA     +I+IF V+  +  + PVK +G
Sbjct: 138 ISFMCGWNLFYAMAMIVPAEITACALLVQYWTDANS-AIFISIFIVVSILLTMLPVKVFG 196

Query: 183 EVEFWIACIKVLAIVGFIIYAFIMVCGAG--KTGPVGFRYWRNPGPWGPGIISKDVNEGR 240
           E EFW++ IK+L IVG II   ++  G G  +   +GF YW+NPG + P +   + N GR
Sbjct: 197 ESEFWVSSIKILTIVGLIIVGIVIFFGGGPAQDHVLGFHYWKNPGAFNPHL--AEGNTGR 254

Query: 241 FLGWVSSLISAAFTYQGT-ELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXX 299
           FL   +++I + F++    E V   + E   PR+ +P+A  +                  
Sbjct: 255 FLAVWTAIIKSGFSFVLVPETVTSCSAECIAPRRNMPKACQRFIYRLAIFYIVGTLVVGV 314

Query: 300 XXXXNDPKL----KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVG 355
               N+ +L    +S  S  ++SPFVI I+ +G K+LPHI NA IL++  S G   +Y  
Sbjct: 315 IVGFNNDRLINAIQSGKSDAAASPFVIGIQEAGIKILPHIINACILTSAYSCGTGLLYGS 374

Query: 356 SRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITA 415
           SR  YSMA+ G APK      + G PY +    S+  FLAYL  S  AS VFNWL NI  
Sbjct: 375 SRTLYSMALRGDAPKIFAKVNRFGTPYYSTGLASLFSFLAYLNCSKSASVVFNWLSNIAT 434

Query: 416 VAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTA 475
           ++GF +WI +S+++IRF + +    ++ D +PF+  F    AY                 
Sbjct: 435 ISGFVSWIFVSMTYIRFRKVINALDLN-DRVPFRRPFQVPLAYLTCGFFFILSLTNGYAV 493

Query: 476 FAP-KFKVSDFFTAYISV-MLFFVFWIG---FQIW-FRGPLFIKTE---DIDLDTDRREI 526
           F    + VSDFF +Y+++  + F++ +G   ++ W FR    I+ E    ID+  D  E 
Sbjct: 494 FVKGNWNVSDFFASYVTIGFVIFLYLVGSFYYKQWTFRDFKEIEVEILPKIDI-ADEEER 552

Query: 527 DDVVWEEQKPRNLWEKFW 544
           +DV+     PRN  EK W
Sbjct: 553 NDVI---PVPRNFMEKVW 567

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  277 bits (708), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 181/493 (36%), Positives = 264/493 (53%), Gaps = 17/493 (3%)

Query: 42  VKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEM 101
           +KR LK RH+ MI +GG IGTGLF+     L+ AGP G LI +   GT+ Y +  ++GE+
Sbjct: 76  LKRTLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAMGEL 135

Query: 102 ATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFW-TDAVPLT 160
           A   PV   +T +  RF+  + G A   +Y + W IT  LE+      + +W T A    
Sbjct: 136 AVTFPVAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRD 195

Query: 161 AWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGF-R 219
           A++A+F+V++   NLF VK YGE EF  + IKV+A++GFII   I+VCG G  G     R
Sbjct: 196 AFVALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYIGGR 255

Query: 220 YWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAI 279
            W NPG +  G          F G  S  ++AAF++ G+ELVG+ A E ANPRK++P A 
Sbjct: 256 LWHNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSIPSAA 305

Query: 280 NKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPHIFNA 338
            +V                        +L  + S   ++SPFVI+I+N+G K LP + N 
Sbjct: 306 KQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINV 365

Query: 339 VILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLE 398
           VIL  ++S GN  V+  SR   ++A  G  PK   +  ++G P   ++ T V G L+++ 
Sbjct: 366 VILIAVLSVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLSFIA 425

Query: 399 SSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAY 458
           +S     VF+WLL ++ ++  FTW  I + HIR  +AL  Q  +  +L F A    WG+ 
Sbjct: 426 ASPKEGEVFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAPTDVWGSV 485

Query: 459 YAAXXXXXXXXXXXXTAFAP---KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKT 514
           Y+              A  P   K   + FF AY+S  ++ VF+IG +IW +   LFIK 
Sbjct: 486 YSLILIILILIAQFWIALFPIGGKPSAAAFFEAYLSFPIYIVFYIGHKIWKKNWKLFIKA 545

Query: 515 EDIDLDTDRREID 527
            DID+D+ RRE D
Sbjct: 546 SDIDIDSGRRETD 558

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  276 bits (705), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 173/550 (31%), Positives = 276/550 (50%), Gaps = 24/550 (4%)

Query: 5   KDYEATREK---DGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIG 61
           K    T+EK   D + + ++  +  D    + +     T++K+ LK RHI M+ L G  G
Sbjct: 6   KSSSLTKEKVAIDEAEVQLEEGVTLDETIKQGVLHNDRTKLKQGLKARHIKMLTLVGVFG 65

Query: 62  TGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSP 121
           TGLF+S    L   GPVG LIAY+ +G +      ++ E+A+F+P T +    +++F+  
Sbjct: 66  TGLFLSSGGTLKKTGPVGMLIAYVLVGIVVGCNQIAIAEVASFMPATGATIRHSEQFIDE 125

Query: 122 ALGSANGYLYWLS-WAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKY 180
           A+G   G   W+S ++     ELS    ++ +WTD  P   +I IF V+  ++N++ +++
Sbjct: 126 AVGFTFG---WISTYSSLMPGELSATAVVMTYWTDLSP-AIFITIFGVLFILTNIYTIRF 181

Query: 181 YGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGR 240
           YGE+E++   +K+  I   II   ++  G  K   +GF YWRNPGP+   ++  D   G+
Sbjct: 182 YGEIEYFFGWLKLALIAILIITGLVIDLGGTKQERLGFHYWRNPGPFAEYLVGGDT--GK 239

Query: 241 FLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXX 300
           F+G+ ++L S  ++Y G + + I AGE  N R  +      V                  
Sbjct: 240 FVGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFVRIILLYLITVFVLTLI 299

Query: 301 XXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAY 360
              ND  + +      SSPFVIA+E +G KVLPHI NA+IL++  SAGN  +  GSR  +
Sbjct: 300 VPYNDKLIATGSGNARSSPFVIAMERAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLF 359

Query: 361 SMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFF 420
            +A    APK    T+K GIP+  VL  S    LAY+  S  ++ VF+W   + +     
Sbjct: 360 CLATKNQAPKIFLKTSKRGIPWVGVLFISSFLPLAYMSCSESSATVFSWFQELVSSNTLL 419

Query: 421 TWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-K 479
            WILIS +HI   +AL+ QG SR DLP+     P+ A+++               F    
Sbjct: 420 RWILISANHIHMDRALRAQGYSRKDLPYSTTIAPYAAWFSGIMSFIFLLTGGFYNFIHGN 479

Query: 480 FKVSDFFTAYISVML---FFVFWIGFQIWFRGPLFIKTEDIDLDT---DRREIDDVVWEE 533
           F +  FF+ Y  + L    F FW      F+   +++  ++DL +   D RE  + +  E
Sbjct: 480 FDIESFFSRYFIIPLAIALFTFW----KLFKKTRYLRPHEVDLQSIFEDIRENPEYI-PE 534

Query: 534 QKPRNLWEKF 543
             P  LW++ 
Sbjct: 535 TTP--LWKRL 542

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  277 bits (708), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 161/519 (31%), Positives = 263/519 (50%), Gaps = 27/519 (5%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           GS   + +KR LKPRH+ MIA+GG+IGTGLF+     ++  GP+G ++ +   G+     
Sbjct: 72  GSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGT 131

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
              LGE+    PV  +F  +  RFL P++      +Y L W     LE+      +Q+W 
Sbjct: 132 IHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWN 191

Query: 155 DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
            ++    W+AIF+ ++   NLF  + +GE EF  + +K + + GFII + +++CG G   
Sbjct: 192 SSIDPVIWVAIFYAVIVCINLFGARGFGEAEFAFSTVKAITVCGFIILSIVLICGGGPDH 251

Query: 215 P-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
             +G +YW +PG    G          F G ++ L+ A+++  G E+  + +GE  +P K
Sbjct: 252 EFIGAKYWHDPGCLANG----------FPGVLAVLVVASYSLGGIEMTCLASGE-TDP-K 299

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
            +P AI +V                      +  L    S + +SPFVIA++    KVLP
Sbjct: 300 GLPGAIKQVFWRILFFFLASLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAMKLHHIKVLP 358

Query: 334 HIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGF 393
            I NAVIL +++S GNS ++  SR   SMA  GL P +  +  ++G P   ++  S+ G 
Sbjct: 359 TIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGL 418

Query: 394 LAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFM 453
           LA+L  S   + VFNWL+ I  +A    W+ I++SHIRF  A+K QG S D+L F +   
Sbjct: 419 LAFLVKSGSMADVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVG 478

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP-------KFKVSDFFTAYISVMLFFVFWIGFQIWF 506
            WG+ Y+A             +  P       K +   FF  Y+  ++    ++  +I++
Sbjct: 479 IWGSAYSALINCLILIAQFYCSLWPIGGWSSGKERAKLFFQNYLCALIMLFIFVVHKIYY 538

Query: 507 RGPL-----FIKTEDIDLDTDRREID-DVVWEEQKPRNL 539
           +            +DIDL+TDR++ID +++ +E   R +
Sbjct: 539 KCQTGKWWGVKSLKDIDLETDRKDIDIEIIKQEIMERKM 577

>TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.368
           YOL020W
          Length = 590

 Score =  277 bits (708), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 185/546 (33%), Positives = 277/546 (50%), Gaps = 33/546 (6%)

Query: 6   DYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLF 65
           DY  T  ++    +I      D+    + GS   + +KR+LK RH+ MIA+GG+IGTGLF
Sbjct: 46  DYTKTENRNIFQRVI------DSFKPPANGSFHTSNLKRSLKSRHLIMIAIGGSIGTGLF 99

Query: 66  ISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGS 125
           I     L+N GP+  ++ +   G+        LGE+    PV  +F  +  RFL P+L  
Sbjct: 100 IGSGQALANGGPLALVLGWSIAGSQIVGTIHGLGEITVRFPVVGAFANYQTRFLDPSLSF 159

Query: 126 ANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVE 185
               +Y L W     LE+      +Q+W D +    ++AIF+  +   NLF V+ +GE E
Sbjct: 160 VISTIYVLQWFFVLPLEILSSAITVQYWNDTIDPVVFVAIFYCAIVSINLFGVRGFGEAE 219

Query: 186 FWIACIKVLAIVGFIIYAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGW 244
           F  + IKV+ + GFII   I++CG G T   +G +YW +PG    G          F G+
Sbjct: 220 FVFSTIKVITVTGFIILCIILICGGGPTHEFIGAKYWHDPGCLANG----------FRGF 269

Query: 245 VSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXN 304
           +S LI+A+++  GTE+  + +GE  +P K +P AI +V                      
Sbjct: 270 LSVLITASYSLGGTEMTCLASGE-TDP-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYT 327

Query: 305 DPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAM 364
           +  L    S + +SPFVIAI+    KVLP I NAVIL +I+S GNS ++  SR   SMA 
Sbjct: 328 NENLLGGSS-VDNSPFVIAIKLHNIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAH 386

Query: 365 NGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWIL 424
            GL P +  +  ++G P   ++  S+ G LA+L  SS  S VF+WL+ I  +A    W+ 
Sbjct: 387 QGLIPWWFGYIDRAGRPLTGIVINSLFGLLAFLVKSSSVSEVFDWLMAIAGLATCIVWLS 446

Query: 425 ISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP------ 478
           I+I HIRF  A+K Q  + D+L F +    WG+ Y+A             +  P      
Sbjct: 447 INICHIRFRLAMKAQNKTIDELEFVSAVGVWGSVYSAIINSLILIVQFYVSLWPIGGWTD 506

Query: 479 -KFKVSDFFTAYISVMLFFVFWIGFQIWFRGPL-----FIKTEDIDLDTDRREID-DVVW 531
            K +   FF  Y+  ++  +F+I  +++FR         I  +DIDLDT R+ ID D+V 
Sbjct: 507 SKDRAGKFFQNYLCAIVSLIFFICHKLYFRYKTKKWWEIIPLKDIDLDTGRKNIDIDIVK 566

Query: 532 EEQKPR 537
           EE K R
Sbjct: 567 EEIKER 572

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  276 bits (707), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 178/554 (32%), Positives = 281/554 (50%), Gaps = 29/554 (5%)

Query: 1   MSLSKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTI 60
           MS   + +  +++D +  I++  I  D+      GS     +KR LK RH+ MIA+GG+I
Sbjct: 31  MSKETEIDLDKKEDKNKNIVRRMI--DSFKPPLDGSYHSDNLKRKLKSRHLIMIAIGGSI 88

Query: 61  GTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLS 120
           GTGLF+     L+  GP+  +I +   G+        LGE+    PV  +F  ++ R L 
Sbjct: 89  GTGLFVGSGKALATGGPLAMIIGWSIAGSQMVGTIHGLGEITMRFPVVGAFANYSTRLLD 148

Query: 121 PALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKY 180
           P++      +Y   W     +EL      +QFWT  V    W+AIF+VI+   NLF VK 
Sbjct: 149 PSISFMVSSIYICQWYFVLPIELIASAMTVQFWTTKVDPVVWVAIFYVIVVSVNLFGVKV 208

Query: 181 YGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNEG 239
           +GE EF  + +KV+ I+GFII + I++CG G     +G  YW +PG    G         
Sbjct: 209 FGEAEFAFSLVKVITIIGFIILSIILICGGGPDHRFIGTEYWHHPGALANG--------- 259

Query: 240 RFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXX 299
            F G  S  ++A+++  G+E+V + + E  +P K +P AI +V                 
Sbjct: 260 -FKGVASVFVTASYSLGGSEMVCLCSAE-TDP-KELPHAIKQVFWRIVFFFLVSLTLVGF 316

Query: 300 XXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIA 359
                +  L    S +++SPFVIAI+ SG +VLP I NAVIL +I+S GNS ++  SR  
Sbjct: 317 LVPYTNENLLGGSS-VNNSPFVIAIKLSGIRVLPSIINAVILISILSVGNSCIFASSRTL 375

Query: 360 YSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGF 419
            SMA  GL P+   +  ++G P   ++  S+ G LA+L  S+    VF+WL+ I  +A  
Sbjct: 376 CSMAHQGLIPRVFGYVDRAGRPLVGIIVNSLFGLLAFLVKSASMGVVFDWLMAIAGLATC 435

Query: 420 FTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP- 478
             W+ I+ISHIRF  A+K Q  S D+L FK+    +G+ Y+A             +  P 
Sbjct: 436 VVWLSINISHIRFRLAMKAQNRSLDELEFKSSVGVYGSIYSATVNILILIAQFYISLWPV 495

Query: 479 ------KFKVSDFFTAYISVMLFFVFWIGFQIWFRGPL-----FIKTEDIDLDTDRREID 527
                 + +   FF  Y+  ++    ++  +I+F+        F    +IDL+TDR+ ID
Sbjct: 496 GGWTSSQQRTESFFKNYLCALVLVFVFVTHKIYFKCSTGKWFDFKPLAEIDLETDRKNID 555

Query: 528 -DVVWEEQKPRNLW 540
            ++V +E + R ++
Sbjct: 556 IEIVKQEVREREMY 569

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  277 bits (709), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 168/522 (32%), Positives = 277/522 (53%), Gaps = 21/522 (4%)

Query: 34  LGSV--KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLA 91
           LG V  + + +K+ +K RH+ +I+LG  IGTGL +  +  L +AGP G +I Y  +G+  
Sbjct: 107 LGEVPGENSDLKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSIMGSCL 166

Query: 92  YSVTQSLGEMA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQII 150
           Y + Q+ GE+A  +  + S+F ++    +  A G A  ++Y L W     LEL      I
Sbjct: 167 YCIIQACGELAVCYSSLPSNFNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVTASMTI 226

Query: 151 QFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG- 209
           ++WT +V    +++IF+V++ + N F  + Y E EF+    KVL + GF I   I+ CG 
Sbjct: 227 KYWTTSVNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFFILGIIITCGG 286

Query: 210 AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAA 269
           AG +G +G +YW +PG +     ++ ++   F G +++  +AAF +  +E + +TA E +
Sbjct: 287 AGTSGYIGAKYWHSPGAFNG---NRPIDH--FKGVMATFTTAAFAFGASEFISLTAAEQS 341

Query: 270 NPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIAIENSG 328
           NPRK +P+A   +                     N P L  S      +SP+V+A+ + G
Sbjct: 342 NPRKAIPKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLGSGSDATKASPYVVAVASHG 401

Query: 329 TKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTT 388
            +V+PH  NAVIL +++S GNS  Y  SR+  S+A  G APK  T+  K G P  A++ +
Sbjct: 402 VRVVPHFINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRGRPLVAMVCS 461

Query: 389 SVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPF 448
           ++   +A+  +S     VF WLL I+ ++  FTW+ I ISH+RF +ALK QG S  ++ F
Sbjct: 462 TLFMTIAFCAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALKVQGHSLGEIGF 521

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQI 504
           K++   +G+ YAA             A AP         +FF  Y+++ +  V + G++I
Sbjct: 522 KSQVGIYGSLYAATMLILALIAQFWVALAPIGGNGLDARNFFQNYLAMPILLVLYFGYKI 581

Query: 505 WFRG-PLFIKTEDIDLDTDRREIDDVVWE------EQKPRNL 539
             R    +I    IDL + R+  D+ + +      EQ+ +NL
Sbjct: 582 RKRDWKFWIPAHRIDLVSHRKVFDEDILKQEVAEIEQEKKNL 623

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  275 bits (702), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 174/554 (31%), Positives = 275/554 (49%), Gaps = 28/554 (5%)

Query: 8   EATREKDGSHLIIKPSIAEDAVSME-SLGSVKET-----------QVKRALKPRHISMIA 55
           E   E   S   +KP I E+ V  E  + SV+ET           ++K+ LK RHI M+ 
Sbjct: 3   EIGDESTNSQEKVKPKIYEEDVDEEHDIVSVEETVKRGVLHNDRTKLKQGLKERHIKMLT 62

Query: 56  LGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFT 115
           L G  GTGLF+S    L   GPVG LIAY+F+G +      ++ E+A+F+P T +     
Sbjct: 63  LVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHA 122

Query: 116 QRFLSPALGSANGYLYWLS-WAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISN 174
           ++F+  ++G   G   W+S ++     ELS    I+++WTD  P   +I +F ++  ++N
Sbjct: 123 EQFIDESVGFTFG---WISTYSSLMPGELSATAVIMRYWTDVSP-AVFITVFGILFVVTN 178

Query: 175 LFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGK-TGPVGFRYWRNPGPWGPGIIS 233
           ++ +++YGE+E+    +K++ I   II   ++  G  K    +GF YWR PGP+   ++ 
Sbjct: 179 IYTIRFYGELEYIFGWLKLVLIFILIISGLVIDLGGTKGQERLGFHYWREPGPFANYLVG 238

Query: 234 KDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXX 293
             +  G+F+G+ +++ S  ++Y G + + I AGE  N R  +      V           
Sbjct: 239 GHI--GKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFLRIIVLYLVT 296

Query: 294 XXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVY 353
                     ND  + +      SSPFVIA+  +G KVLPHI NA+IL++  SAGN  + 
Sbjct: 297 VFILTLIVPYNDKLIATGTGTARSSPFVIAMNRAGIKVLPHIVNALILTSAWSAGNLAII 356

Query: 354 VGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNI 413
            GSR  + +A    APK    T+K GIPY  V+  S    LAY+  S  ++ VF W   +
Sbjct: 357 EGSRNLFCLATKNQAPKIFLRTSKRGIPYVGVIFISSFLPLAYMSCSKSSATVFGWFQEL 416

Query: 414 TAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXX 473
            +      WILIS +HI   +ALK QG SR DLP+     P+ A+++             
Sbjct: 417 VSSNTLLRWILISANHIHMDRALKAQGYSRSDLPYSTPMGPFAAWFSGIMSFIFLLTGGF 476

Query: 474 TAFAP-KFKVSDFFTAYISVML---FFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDV 529
             F    F +  FFT Y  + L    F FW      F+   +++  ++DL++   +I + 
Sbjct: 477 YNFIHGHFDIESFFTRYFIIPLAIGLFTFW----KLFKKTKYLRPHEVDLESIFDDIKEN 532

Query: 530 VWEEQKPRNLWEKF 543
                K +N W +F
Sbjct: 533 PEHIVKTKNAWARF 546

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  276 bits (705), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 172/543 (31%), Positives = 274/543 (50%), Gaps = 43/543 (7%)

Query: 33  SLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAY 92
            L S ++  + +++K RH+ MI+LG  IGTGL +     L  AGP G ++ Y     + Y
Sbjct: 81  ELESQEKNNLTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGVASIMLY 140

Query: 93  SVTQSLGEMA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQ 151
            + Q+ GE+   +  +T ++T +    + P+LG A   +Y + W     L+L      ++
Sbjct: 141 CIIQAAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVK 200

Query: 152 FWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-A 210
           +WT +V    ++A+ ++ + I NLF  + Y E EF     K+L ++GF+I A I+ CG A
Sbjct: 201 YWT-SVNSDIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVIGFVILAIIINCGGA 259

Query: 211 GKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAAN 270
           G    +G  YW NPGP+  G          F G  +    AAF+Y G E++ ++A E  N
Sbjct: 260 GDRKYIGTEYWHNPGPFAHG----------FKGVCTVFCYAAFSYGGIEVLLLSAAEQEN 309

Query: 271 PRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYIS-SSPFVIAIENSG 328
           P K++P A  KV                     N D  L S+DS  S +SPFVIA+ + G
Sbjct: 310 PTKSIPNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSDDSSGSHASPFVIAVASHG 369

Query: 329 TKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTT 388
            KV+PH  NAVIL ++IS  NS++Y G R+  S+A  G+ PK L +  + G P    L +
Sbjct: 370 VKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRRGRPLLCFLVS 429

Query: 389 SVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPF 448
              G + ++ +S     VF WLL I++++  F W+ +S+SHIRF  A+  QG S +++ +
Sbjct: 430 LAFGCIGFVATSDAEEEVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGY 489

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTAYISVMLFFVFWIGFQ 503
           KA+   WG++ A              A AP     K  V  FF  Y+++ +  V + G +
Sbjct: 490 KAQTGYWGSWLAVLIAVFFLVCQFWVAIAPVNDHGKLNVKVFFQNYLAMPIVLVAYFGHK 549

Query: 504 IWFRG-PLFIKTEDIDLDTDRR-----------EIDDVV--WEEQ---------KPRNLW 540
           I+F+    +I  + IDL++ R            + DD V  +E Q         + RNL+
Sbjct: 550 IYFKSWSFWIPADKIDLNSHRNIFVHSTLTEFDKADDDVKEYENQESLENLNNLRSRNLF 609

Query: 541 EKF 543
           +K 
Sbjct: 610 KKM 612

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  274 bits (700), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 176/530 (33%), Positives = 278/530 (52%), Gaps = 35/530 (6%)

Query: 23  SIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALI 82
           SI++    +E    ++E+ + R+L PRHI+MI++ G IGTGL++S +  L   GP    I
Sbjct: 39  SISDAVTDLEDHDKIRES-LNRSLSPRHINMISVAGVIGTGLYLSTAKSLHVGGPGSLFI 97

Query: 83  AYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALE 142
            Y  +G + Y     LGEM+TF+P++ SF  + ++F   +   A    YW + A++ A +
Sbjct: 98  NYTIMGGVVYLTMLCLGEMSTFMPISGSFCSYAKKFGCESFAFALMCNYWFNDAVSVASD 157

Query: 143 LSVVGQIIQFWTDA---VPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGF 199
           L+ +  ++ +W  +    P  A   +FWV L   N+  V+ YGE E+W+A +KV+AIV F
Sbjct: 158 LTALQLVLDYWKSSQHNFPYWAASLLFWVFLLGLNVIHVRVYGEAEYWLALLKVIAIVIF 217

Query: 200 IIYAFIMVCGAGKTGP-VGFRYWR-NPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQG 257
            I A ++  G       +GF+YW     P+  G          F G+V+  +S+AF+Y G
Sbjct: 218 FILAIVVNVGHNPDHEYIGFKYWSYKEAPFVNG----------FKGFVTIFVSSAFSYGG 267

Query: 258 TELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISS 317
           TE + +TAGEA NP +  PR +  V                     + P L ++   + +
Sbjct: 268 TESITLTAGEARNPIRNTPRIVKTVFWRILIFYVATMFFISMNIPYDYPNLSTKS--VMT 325

Query: 318 SPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLA-PKYLTWTT 376
           SPF I  + +GTK      NAVIL++I+SAGN  ++ GSR+ Y+M + G   PK +T T 
Sbjct: 326 SPFTIIFQMAGTKAAGSFMNAVILTSIVSAGNHALFAGSRVLYNMGLEGFVFPKLITKTN 385

Query: 377 KSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQAL 436
           +   PY AV+ T  +G L +  S  GA  ++ WL NI  V+    W+ I+++ IRF + L
Sbjct: 386 RYRAPYVAVILTWAVGGLCFGASFIGAGTLWTWLQNIVGVSNQVAWLSIAVTSIRFRKGL 445

Query: 437 KHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFF 496
             QG ++ +L FK    P+G Y+              +AF P +  SDFF+ Y+ + +F 
Sbjct: 446 AQQGKTQ-ELQFKNWTYPYGPYFLVIFVTLIILVQGWSAFDP-WSTSDFFSYYLELFVFP 503

Query: 497 VFWIGFQIW--FRGPLFIKTEDIDLDTDR-----REIDDVVWEEQKPRNL 539
             W+   IW  F+   F+K ED+D  TDR     +EI+    E ++  NL
Sbjct: 504 TCWL---IWWIFKRDRFVKPEDMDFITDRYIQSPQEIE----ENERLDNL 546

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  274 bits (701), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 165/520 (31%), Positives = 259/520 (49%), Gaps = 27/520 (5%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           GS   + +KR LKPRH+ MIA+GG+IGTGLF+     ++  GP+G ++ +   G+     
Sbjct: 71  GSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGT 130

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
              LGE+    PV  +F  +  RFL P++      +Y L W     LE+      +Q+W 
Sbjct: 131 IHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWN 190

Query: 155 DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
            ++    W+AIF+VI+   NLF V+ +GE EF  + IK + + GFII   +++ G G   
Sbjct: 191 SSIDPVVWVAIFYVIIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCIVLIFGGGPDH 250

Query: 215 P-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
             VG +YW +PG    G          F G +S L+ A+++  G E+  + +GE  +P K
Sbjct: 251 EYVGAKYWYDPGCLANG----------FPGILSVLVVASYSLGGIEMTCLASGE-TDP-K 298

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
            +P AI +V                      +  L    S + +SPFVIAI+    KVLP
Sbjct: 299 GLPSAIKQVFWRILFFFLVSLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKVLP 357

Query: 334 HIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGF 393
            I N VIL +++S GNS ++  SR   SMA  GL P +  +  ++G P   ++  S+ G 
Sbjct: 358 SIVNVVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGL 417

Query: 394 LAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFM 453
           LA+L  S     VFNWL+ I  +A    W+ I++SHIRF  A+K QG   D+L F +   
Sbjct: 418 LAFLVKSGSMGDVFNWLMAIAGLATCIVWLSINVSHIRFRMAMKAQGKKLDELEFVSAVG 477

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP-------KFKVSDFFTAYISVMLFFVFWIGFQIWF 506
            WG+ Y+A             +  P         +   FF  Y+  ++    +I  +I++
Sbjct: 478 IWGSAYSALINCLILLAQFYCSLWPIGGWKNSSDRAKIFFQNYLCALIVLFIFIAHKIYY 537

Query: 507 RGPL-----FIKTEDIDLDTDRREID-DVVWEEQKPRNLW 540
           +            +DIDL+TDR+ ID ++V +E   + ++
Sbjct: 538 KCQTGQWWGIKALKDIDLETDRKNIDIEIVKQEIAEKKMY 577

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  274 bits (701), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 164/505 (32%), Positives = 253/505 (50%), Gaps = 14/505 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSL 98
           +  +K+A+K RH+ M+ LG  IGTGL ++    L+ AGP   ++ Y  +  + Y + Q+ 
Sbjct: 75  DDHMKKAMKSRHVIMMTLGTGIGTGLLVANGKGLALAGPAPLVLGYGLVSFVTYFMIQAA 134

Query: 99  GEMATFIP-VTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAV 157
           GEMA   P + +SF  +   F+S   G A  +L+ + W     LEL      I++W D +
Sbjct: 135 GEMAVTYPTMPASFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDTI 194

Query: 158 PLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPV 216
               +I IF+V L   + F VK YGE EF     K+L I GFII + ++ CG AG+ G +
Sbjct: 195 NPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSIVINCGGAGRDGYI 254

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           G +YW NPG +     + +    RF G    L++  F+Y GTEL  ++  E  NPRK+ P
Sbjct: 255 GNKYWINPGAF-----ASESPAARFKGVAYILVTGYFSYGGTELFSLSVNEQKNPRKSTP 309

Query: 277 RAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHI 335
            A  + +                     +D  + +  S   +SP+V+A    G KV+PH 
Sbjct: 310 AAAKQSIYRILIIYLLTMILIGFNVPHDSDQLMGAGGSATHASPYVLAASLHGVKVVPHF 369

Query: 336 FNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLA 395
            NAVIL +++S  NS +Y   R+  S+A  G APK+  +  + G P  A+    + G + 
Sbjct: 370 INAVILISVVSVANSALYASPRLMRSLAEQGYAPKWFNYVDREGRPLRALCICGLFGVIG 429

Query: 396 YLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++  S      F WL  I  ++  FTW  I ISHIRF  A+K QG S ++L ++A    W
Sbjct: 430 FVACSPQEEQAFTWLAAIAGLSELFTWSSIFISHIRFRMAMKVQGKSLEELGYRATTGIW 489

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTAYISVMLFFVFWIGFQIWFRGPL 510
           G+ Y+              A +P     K+    FF +Y++  L+ VF+ G+ I+ R   
Sbjct: 490 GSVYSVFFNMLVFIAQFWVALSPPKSNGKYDAEGFFESYLAAPLWLVFYFGYMIYSRDFT 549

Query: 511 FIKTED-IDLDTDRREIDDVVWEEQ 534
           F+   D IDLD  RR  D  +  ++
Sbjct: 550 FLTPLDKIDLDFHRRIYDPELLRQE 574

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  273 bits (699), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 167/526 (31%), Positives = 259/526 (49%), Gaps = 29/526 (5%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           GS   + +KRALK RH+ MIA+G +IGTGLF+     L+  GP+  +I +   GT     
Sbjct: 71  GSFDPSNMKRALKSRHLIMIAIGSSIGTGLFVGSGKALATGGPLALIIGWTLAGTQMIGT 130

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
              LGE+   +PV  +F  ++ RFL P++      +Y + W     LE+      ++FWT
Sbjct: 131 IHGLGELTVRLPVVGAFADYSTRFLDPSVSFVISSIYVMQWFFVLPLEIIASCITMRFWT 190

Query: 155 DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
            +V    W+A+F+ ++   NL  V+ +GE EF  + +KV+ I GFII   +++ G G T 
Sbjct: 191 QSVDPIIWVALFYTMIVSINLLGVRGFGEAEFIFSSVKVITICGFIILCIVLILGGGPTH 250

Query: 215 P-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
             VG RYW +PGP   G          F G  + +++A+++  G+E+  + +GE  +P K
Sbjct: 251 QYVGSRYWHDPGPLANG----------FKGVAAVMVTASYSLGGSEMTCLASGE-TDP-K 298

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
            +P AI ++                      +  L    S   +SPFV+A+     KV+P
Sbjct: 299 ELPHAIKQIFWRILFFFLVSLTLVGFLVPYTNENLLGGSS-AENSPFVLALYLHHVKVVP 357

Query: 334 HIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGF 393
           HI N VIL +I+S GNS ++  SR   SMA  GL P    +  + G P   +L  S+ G 
Sbjct: 358 HIVNGVILVSILSVGNSCIFASSRTLCSMAHQGLIPHIFGYVDRGGRPLVGILANSIFGL 417

Query: 394 LAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFM 453
           LA+L   S  S VF+WL+ I  +A    W+ I++SH+RF  A+K Q  S D+L F +   
Sbjct: 418 LAFLVKFSSISNVFSWLMAIAGLATCVVWLSINVSHVRFRLAMKAQNKSLDELQFVSSVG 477

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP-------KFKVSDFFTAYISVMLFFVFWIGFQIWF 506
            WG+ YA              A  P       K +   FF  Y+  ++    +   + +F
Sbjct: 478 VWGSVYAGVLNFLTLVAQFYIALWPVEGWKDSKSRAEAFFKNYLCALILIAMFAAHKCYF 537

Query: 507 RGPL-----FIKTEDIDLDTDRREID-DVVWEE--QKPRNLWEKFW 544
           R          K  ++DLDT R  ID +++ EE  ++ + L  K W
Sbjct: 538 RITTGKWWGIKKLSEVDLDTGRVNIDIEIIKEEVAERKKFLRNKAW 583

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  273 bits (699), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 165/523 (31%), Positives = 264/523 (50%), Gaps = 25/523 (4%)

Query: 36  SVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVT 95
           S   T++K+ +K RH+ +++LG  IGTGL ++ ++ L   GP G LI Y F+  ++Y + 
Sbjct: 65  SAHSTKLKQNMKTRHVVLMSLGTGIGTGLLVANASSLHFGGPGGLLIGYFFVSIISYIMM 124

Query: 96  QSLGEMATFIP-VTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
           Q+ GEMA   P +  +F  ++  F+S   G A  +L+ + W     LEL     ++++WT
Sbjct: 125 QAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCIQWTTILPLELITSSIVVKYWT 184

Query: 155 DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGA-GKT 213
             +    ++ IF++ +   +    + YGE EF     KVL + GFII   ++ CGA G  
Sbjct: 185 TKINADIFVLIFYLFILCIHFCGARGYGETEFIFNSCKVLMVAGFIIVGILINCGAVGDD 244

Query: 214 GPVGFRYWRNPGPW--GPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271
           G +G +YW  PG +  G GI        RF G    L++A F+Y G EL  ++  E  NP
Sbjct: 245 GYIGGKYWHEPGAFAAGSGI-------DRFKGIAYVLVTAYFSYGGMELYALSVNELPNP 297

Query: 272 RKTVPRAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTK 330
           RK +P A  K V                     ++  L S  S +  SP+V+A+   G K
Sbjct: 298 RKAIPSACAKGVYRILIIYMLTMVIIGFLVPHDSNKLLGSGSSGVHPSPYVLALSLHGIK 357

Query: 331 VLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSV 390
           ++PHI NAVIL ++IS GNS +Y G R+  S+A  G APK L +  + G P  A++  SV
Sbjct: 358 IVPHIINAVILISVISVGNSAMYSGPRLLCSLAQQGYAPKILDYVDRQGRPLMALIICSV 417

Query: 391 LGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKA 450
            G +A++ +S     +F WL  I+ ++  FTW  I +SH RF +A+K QG S + L +++
Sbjct: 418 FGLIAFVAASKYEEDIFGWLAAISGLSELFTWTAICLSHFRFRRAMKLQGRSLETLGYRS 477

Query: 451 KFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTAYISVMLFFVFWIGFQIW 505
               WG+ YA              A  P     KF V   F + +++ L+    +G+ I 
Sbjct: 478 TTGEWGSLYAVVFNVFVLIAQLWVAMIPMDNGGKFSVKSLFKSCLALPLWLSMAVGYMIV 537

Query: 506 FRG-PLFIKTEDIDLDTDRREID-------DVVWEEQKPRNLW 540
            +   +      I +D+ RR  D       D+ ++++  R+ W
Sbjct: 538 TKNWTILNPLSSISVDSHRRSYDVEVMKQEDLEYKQKMKRSKW 580

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  273 bits (697), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 179/557 (32%), Positives = 284/557 (50%), Gaps = 22/557 (3%)

Query: 7   YEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQ--VKRALKPRHISMIALGGTIGTGL 64
           Y   R K+ +   I  +   D VS  S+  ++  +  + R LK RH+ +IALG  IGTGL
Sbjct: 16  YVTDRMKEKTQFSIHST--GDEVSQGSVLDIESQKPGIVRGLKSRHVQLIALGSAIGTGL 73

Query: 65  FISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFT--QRFLSPA 122
           FI     LS  GP   LIAY  +    +SV   + EM T IP+    T+++  + +++  
Sbjct: 74  FIGSGGALSICGPAPLLIAYAVMSLFVWSVMNQMTEMVTLIPLPGESTLYSLLKLYVNKP 133

Query: 123 LGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYG 182
           L    G+  + + A+    E++    ++Q+WTDA P   +I+IF V+     + PVK +G
Sbjct: 134 LSFMCGWNLFYAQAMIAPAEVTACALLVQYWTDANP-AIFISIFLVLSVAITMLPVKVFG 192

Query: 183 EVEFWIACIKVLAIVGFIIYAFIMVCGAG--KTGPVGFRYWRNPGPWGPGIISKDVNEGR 240
           E EFW++ IK+L IVG II   ++  G G  +   +GF YW+ PG + P ++  +   G+
Sbjct: 193 ESEFWVSSIKILTIVGLIIVGVVIFFGGGPAQEHVLGFHYWKKPGAFKPYLV--EGGTGK 250

Query: 241 FLGWVSSLISAAFTYQGT-ELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXX 299
           FL + +++I + F++    E+V   A EA  PR+ +PRA  +                  
Sbjct: 251 FLAFWTAIIKSGFSFVLVPEIVSSCAAEAVAPRRNMPRACKRFIYRLALFYVFGILVVGV 310

Query: 300 XXXXNDPKLKSEDSYISSS----PFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVG 355
               ++ +L +  +   SS    PFVI I+ +G +VLPHI NA IL++  S G   +Y  
Sbjct: 311 IVGYDNDRLLNAIASGQSSAAASPFVIGIKEAGIRVLPHIINAAILTSAYSCGTGLLYGA 370

Query: 356 SRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITA 415
           SR  +SMA  G AP+ LT   K G+PY     TS+   LAYL  S+ +S VFNWL NI  
Sbjct: 371 SRTLHSMACKGDAPRILTTVNKYGVPYYCTGITSLFCLLAYLNCSNSSSVVFNWLSNIAT 430

Query: 416 VAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTA 475
           ++GF +W+L+SI++IRF   +    ++ D +PF+  +    AY A               
Sbjct: 431 ISGFVSWVLVSIAYIRFRNVIDVLKLN-DRIPFRVPYQKPLAYLAMGFFSILTLTNGFAV 489

Query: 476 FAP-KFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRR----EIDDVV 530
           F    +  S+FF AYI++    V ++G  I+++        +I+ D   +    E ++  
Sbjct: 490 FIKGNWDTSNFFAAYITLGFVLVLFVGSTIYYKEWRCRDIAEIEQDILPKITLAEAEEYE 549

Query: 531 WEEQKPRNLWEKFWAAI 547
           ++   PRN  EK W  I
Sbjct: 550 YDIPVPRNWLEKIWMVI 566

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  274 bits (700), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 164/495 (33%), Positives = 250/495 (50%), Gaps = 24/495 (4%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSL 98
           ETQ+ + +KPRHI MI+LG  IGTGL +     LS +GP G +I Y     + Y V Q+ 
Sbjct: 103 ETQLNKTMKPRHIVMISLGTGIGTGLLVGNGQVLSKSGPAGLVIGYGVASIMIYCVVQAA 162

Query: 99  GEMA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAV 157
           GE+   +  +T ++T +    + PA+G A   LY L W     L+L      I++WT  V
Sbjct: 163 GELGLVYSRLTGNYTTYPTYLIDPAVGFAVSMLYTLQWLTVLPLQLVTAAMTIRYWTTNV 222

Query: 158 PLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPV 216
               ++A   V++   N+F  K Y E EF+  C K+L + GF+I   ++ CG AG    +
Sbjct: 223 NPDIFVAAILVLVIAINMFGAKGYAEAEFFCNCCKLLMMAGFVILGIVINCGGAGDKEYI 282

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           G +YW+ PG +  G          F G  +    AAF+Y G E++ +TA E ANPRK +P
Sbjct: 283 GVKYWQTPGAFANG----------FKGVAAVFCYAAFSYGGIEVLVLTANEQANPRKAIP 332

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL---KSEDSYISSSPFVIAIENSGTKVLP 333
            A  KV                     N P L    ++ S   +SPFVIA+ + G +V+P
Sbjct: 333 DACRKVVYRVLFLYMLTTIIVCFLVPYNSPALLGSNNDGSGSDASPFVIAVASHGVQVVP 392

Query: 334 HIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGF 393
           HI NA IL ++IS  NS++Y G R+  S++  G APK   +  + G P   VL +  +G 
Sbjct: 393 HIINAAILISVISVANSSLYSGPRLLLSLSQQGYAPKCFNYIDRRGRPIICVLVSVAMGL 452

Query: 394 LAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQ--GI-SRDDLPFKA 450
           +A+L +      VF WLL ++ ++  F W+ I+ISH+RF  A++ Q  G+ +RD + + A
Sbjct: 453 IAFLAAIPAREEVFTWLLAVSGLSQIFIWMSITISHLRFRDAIRSQLGGLRARDVVEYTA 512

Query: 451 KFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTAYISVMLFFVFWIGFQIW 505
           +    G+  A              A AP     +  V  FF  Y++  +    ++ ++IW
Sbjct: 513 QTGYVGSLVALAISIFILVCQFWVAIAPLGHNGQLDVQIFFENYLAAPVLLGGYLAYKIW 572

Query: 506 FRG-PLFIKTEDIDL 519
            R   L I   +IDL
Sbjct: 573 HRDWRLCIPANEIDL 587

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  273 bits (697), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 165/510 (32%), Positives = 253/510 (49%), Gaps = 21/510 (4%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97
            E  + +A++ RH+ MI+LG  IGTGL +   + LS +GP+G +I Y+    + + + Q+
Sbjct: 80  DENDLNKAIRSRHLIMISLGTGIGTGLLVGTGSVLSQSGPLGLIIGYIVSSLMVFLIIQA 139

Query: 98  LGEMA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDA 156
            GE+   +  V  +FT +    + PA G A  +LY + W I   L+L      IQFW   
Sbjct: 140 AGELGIVYSNVVGNFTRYPTILVDPAFGFAISFLYTIQWMIVLPLQLVTAAMTIQFWNVG 199

Query: 157 VPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPV 216
           V L  ++   +V++ + NL   + Y E EF+    K++ + GF+I   I+  G    GP 
Sbjct: 200 VNLDVFVLASFVVVVLINLGGARGYVEAEFFCNLCKIVMLTGFVILGIIITAGGIPNGPD 259

Query: 217 GF---RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
           G+   +YWRNPG +  G          F G  S    AAF+Y G E + ++A E  NP K
Sbjct: 260 GYIGGKYWRNPGLFANG----------FKGVCSVFCYAAFSYGGVETLVLSAAEQKNPLK 309

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIAIENSGTKVL 332
           ++P A  KV                       P L  S  S   SSPFVIAI + G  V+
Sbjct: 310 SIPSATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMGSSGSGSHSSPFVIAIASHGVSVV 369

Query: 333 PHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLG 392
           PH+ NAVIL +++S  NS +YV  R+  S+A  G APK+L +  K G P    L   + G
Sbjct: 370 PHLINAVILISVLSVANSALYVAPRLLLSLAQGGSAPKFLNYIDKRGRPTTCTLVVVLFG 429

Query: 393 FLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKF 452
            + ++ +S     VF WLL+I+ +   F WI I +SHIRF  A++ QG    ++ +KA+ 
Sbjct: 430 MIGFVAASDKREVVFTWLLSISGLGQIFIWISICVSHIRFRDAMRVQGHPLTEIAYKAQT 489

Query: 453 MPWGAYYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTAYISVMLFFVFWIGFQIWFR 507
             WG+Y A              A AP     K   ++FF  Y++  +    ++GF+++++
Sbjct: 490 GYWGSYVAIALALFVLVCQFWVAIAPVGAHGKLDATNFFQNYLAFPVVLCAYLGFKVYYK 549

Query: 508 G-PLFIKTEDIDLDTDRREIDDVVWEEQKP 536
              L I  + I+LD +R         E KP
Sbjct: 550 QWQLLIPADKIELDNNRNVYVPEEALEDKP 579

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  273 bits (697), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 175/561 (31%), Positives = 286/561 (50%), Gaps = 31/561 (5%)

Query: 4   SKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVK-ETQVKRALKPRHISMIALGGTIGT 62
           S+D+   ++KD     ++  I     S+  + ++K  T+V R LK RH+  IALGG IGT
Sbjct: 27  SRDHSTNQKKDAIITAVEQDIERG--SLSDIDTIKPSTEVSRGLKSRHVQFIALGGAIGT 84

Query: 63  GLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVT--SSFTVFTQRFLS 120
           GLFI   T LS+ GP   LI+Y  +    +++   + EM   IP++  SS       +L+
Sbjct: 85  GLFIGSGTALSSCGPAPLLISYSVMSFFVWAIMNQMTEMVVLIPLSGESSMASLAGTYLN 144

Query: 121 PALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKY 180
                  G+  + + ++    E++    +I++WTDA     ++ IF ++ T+ +L PVK 
Sbjct: 145 RPSSFMCGWNCFYAMSMVVPTEITACALLIEYWTDA-NAAIFVTIFMILATLLSLLPVKI 203

Query: 181 YGEVEFWIACIKVLAIVGFIIYAFIMVCGAG--KTGPVGFRYWRNPGPWGPGIISKDVNE 238
           +GE EF ++ IK+L I+G I+   ++  G G  +   +GF YW  PG +   ++    + 
Sbjct: 204 FGESEFCVSIIKILTILGLILVGVVIFFGGGPAQHKVLGFHYWNTPGAFNSYLVKG--ST 261

Query: 239 GRFLGWVSSLISAAFTY-QGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXX 297
           G FL    ++I + F +    E+    + EAA PRK +PRA  +                
Sbjct: 262 GAFLAVWKAIIKSGFAFVMIPEITSSCSAEAAFPRKNMPRACQRFVYRLAVFYVLGCLVI 321

Query: 298 XXXXXXNDPKLK----SEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVY 353
                 ++  L     S  +  ++SPFVI I+ +G ++LPHI NA IL++  S   S +Y
Sbjct: 322 GVIVGYDNKTLNEAISSGKANAAASPFVIGIQEAGIRILPHIINACILTSAYSCSTSELY 381

Query: 354 VGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNI 413
             SR+ +S+A+ G APK+ +   K G+PY +V  TS+ G LAYL  S  +  VFNWL NI
Sbjct: 382 GASRVLHSLALRGDAPKFFSKVNKYGVPYYSVAATSLFGVLAYLNCSKSSLVVFNWLSNI 441

Query: 414 TAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXX 473
             ++GF  W+ +SI+++RF +   +  I+ D +P++ +     AY +A            
Sbjct: 442 ATISGFVNWVFVSITYLRFRKITDYLKIN-DRVPYRRRGQRALAYASAIFFALLAITNGF 500

Query: 474 TAF-APKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRRE----IDD 528
             F A  + VSDFFT Y+++    V +IG  I+++   F      D+D   RE    ID 
Sbjct: 501 YVFIAGNWNVSDFFTCYVTIGFVGVLFIGSSIYYKEWTF-----RDMDVVGREIMPKIDQ 555

Query: 529 VVWEEQK-----PRNLWEKFW 544
              EE++     P+N  E+ W
Sbjct: 556 ADQEEKEEYLPPPKNWVERVW 576

>ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON}
           similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 564

 Score =  272 bits (695), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 167/490 (34%), Positives = 246/490 (50%), Gaps = 18/490 (3%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSL 98
           +T VKRALK RHIS++ALGG IG G  +     L+  GP+  L+ +  IG +A+++ +S+
Sbjct: 48  KTGVKRALKDRHISLLALGGIIGPGCLVGAGNALAKGGPLALLLGFSIIGIIAFTIMESI 107

Query: 99  GEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVP 158
           GEM T  P    FT   +RF S +L +  GY Y + +    A E + +  I QFW   VP
Sbjct: 108 GEMITLYPSGGGFTTLARRFHSDSLSAVCGYAYIVVFFAVMANEYNTLSSIFQFWGPQVP 167

Query: 159 LTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPV-G 217
           L  +I IFW       +  V  +GE+E+W++  K+L +V F I++ I + G  K  P  G
Sbjct: 168 LYGYILIFWAAFQAFQMAGVGAFGEIEYWLSWFKILGLVAFYIFSTIYISGGIKDRPAFG 227

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           F YW NPG    G          F G     +  +  Y GTE V  +A E+ NP + +P 
Sbjct: 228 FHYWNNPGALSHG----------FKGIAEVFVFCSTFYSGTESVAYSASESKNPNRAIPL 277

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           AI +                      ND  L +    +  SP  IAI  +G +   H+ N
Sbjct: 278 AIRQTFWRILVVYIGIGFFYGVTVPYNDHNLNAGTKAL-KSPISIAITRAGWEGGTHLVN 336

Query: 338 AVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYL 397
           A IL T ISA N ++++GSR   ++A  GLAPK+L WT + G+P  A+   + LG ++ +
Sbjct: 337 AFILVTCISAINGSLFIGSRTITNLAHEGLAPKFLAWTDRRGVPIPAITLFNALGLVSLM 396

Query: 398 ESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
             S GAS  +++++N++ V  F  W  I ++H+RF +A   QG +  +LP+KA F P+  
Sbjct: 397 NVSVGASTAYSYIVNLSGVGVFIVWGTIGLTHLRFRKAWIKQGRTVKELPYKALFYPYTQ 456

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTED- 516
                           T+F P FK  DF  AY+ +    V +IG  +        KT D 
Sbjct: 457 IIGIAANIFLALIQGWTSFVP-FKAGDFVDAYVLLPAAAVLYIGISLLKTHSF--KTVDL 513

Query: 517 --IDLDTDRR 524
             IDLD  RR
Sbjct: 514 LTIDLDEGRR 523

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  273 bits (698), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 160/509 (31%), Positives = 255/509 (50%), Gaps = 14/509 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSL 98
              +K+++K RH+ M++LG  IGTGL ++ +  L  AGP   +I Y+ +  + Y + Q+ 
Sbjct: 83  NNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFITYFMVQAA 142

Query: 99  GEMAT-FIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAV 157
           GEM   +  +  +F  +   F+S + G A  +L+ + W     LEL      I++W D++
Sbjct: 143 GEMGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWNDSI 202

Query: 158 PLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPV 216
               +I IF+V L   + F VK YGE EF     K+L + GFII + ++ CG AG  G +
Sbjct: 203 NADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYI 262

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           G +YWR+PG +  G      N  RF G    L++A F++ G EL  ++  E +N RK+ P
Sbjct: 263 GGKYWRDPGSFADG-----SNATRFKGICFILVTAYFSFGGIELFVLSINEQSNARKSTP 317

Query: 277 RAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHI 335
            A  + V                     ND  + S  +   +SP+V+A      +V+PHI
Sbjct: 318 LAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHASPYVLAASIHKVRVIPHI 377

Query: 336 FNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLA 395
            NAVIL ++IS  NS +Y   R+  S+A  G AP++L +  + G P  A+   +++G + 
Sbjct: 378 INAVILISVISVANSALYAAPRLMCSLAQQGYAPRFLNYIDREGRPLRALAVCALVGVVG 437

Query: 396 YLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++  S      F WL  I  ++  FTW  I +SHIRF +A+K QG S  +L +KA    W
Sbjct: 438 FVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLGELGYKANTGIW 497

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-P 509
           G+YY               A +P     K  V  FF  Y++  L+   ++G+ ++ +   
Sbjct: 498 GSYYGVFFNILVFMAQFWVALSPIGNGGKCDVQAFFEGYLAAPLWIFMYLGYMLYNKDFT 557

Query: 510 LFIKTEDIDLDTDRREIDDVVWEEQKPRN 538
           L    + IDLD  RR  D  +  ++   N
Sbjct: 558 LLNPLDKIDLDFHRRVYDPEIMRQEDEEN 586

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  272 bits (695), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 165/490 (33%), Positives = 245/490 (50%), Gaps = 20/490 (4%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSL 98
           ++ VKR LK RHIS++ALGG IG G  I     L+  GP+  L+ +  IG LA+ + +S+
Sbjct: 53  DSGVKRQLKDRHISLLALGGIIGPGCLIGAGNALAIGGPLALLLGFGIIGILAFIMMESI 112

Query: 99  GEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVP 158
           GEM T  P    FT  T+RF S AL +  GY Y + +    A E + +  I+QFW   VP
Sbjct: 113 GEMITLYPSGGGFTTLTRRFHSDALSAVCGYAYAVVFFAVLANEYNTLSSIMQFWGPQVP 172

Query: 159 LTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPV-G 217
           L  +I IFW    +  L  V  +GE E+W+A  K+L ++ + I++ + + G  K  P  G
Sbjct: 173 LYGYILIFWAAFQVFQLLGVGAFGETEYWLAWFKILGLLTYYIFSIVYISGGVKNRPAFG 232

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           F+YW +PG    G          F G  +  +  +  Y GTE V + A E+ NPR+ VP 
Sbjct: 233 FQYWNDPGALSNG----------FKGIANVFVFCSTFYSGTESVALAATESKNPRRAVPI 282

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           AI +                      ND  L    + +  SP  IAI  +G     H+ N
Sbjct: 283 AIRQTFWRILIVYLGISIFYGVTVPYNDENLNFA-TKVLKSPIAIAISRAGWPAGVHLVN 341

Query: 338 AVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYL 397
           A IL T ISA N ++Y+GSR    +A  GLAPK L WT + G+P  A+   + LG ++ +
Sbjct: 342 AFILITCISAINGSLYIGSRTLTHLANEGLAPKLLAWTDRRGVPIPAITVFNALGLISLM 401

Query: 398 ESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
             S  A   +N+++N++ V  F  W +IS++H+RF +A K QG +RD+LP+KAK  P   
Sbjct: 402 NVSVTAVDAYNYIVNLSGVGVFIVWGIISLTHLRFRKAWKLQGHTRDELPYKAKLFPVFP 461

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDI 517
             +             + F P F   +F  AYI +    + ++G   W       KT+  
Sbjct: 462 IVSIIANIFLGLVQGWSYFKP-FDAKNFVDAYILIPAGIILYLGVSYW-------KTKGF 513

Query: 518 DLDTDRREID 527
               D  E++
Sbjct: 514 LTAVDLSEVN 523

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  272 bits (696), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 164/504 (32%), Positives = 256/504 (50%), Gaps = 16/504 (3%)

Query: 42  VKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEM 101
           +KR++KPRH++M+++   IGTGL ++    L   GP G +I Y  +  +AY + Q+ GEM
Sbjct: 83  LKRSIKPRHVAMMSICTGIGTGLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQAAGEM 142

Query: 102 ATFIP-VTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLT 160
           A   P +  +F  ++ + +S   G A  +LY + W     LEL      I++W D++   
Sbjct: 143 AVAYPSLPGNFNAYSSQLISRPFGFATVWLYCIQWLTVLPLELITASLTIKYWNDSINAD 202

Query: 161 AWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPVGFR 219
            +IAIF+V +   + F  + YGE EF     KVL I+GF+I + ++ CG AG    +G +
Sbjct: 203 VFIAIFYVFILFIHFFGSRGYGESEFIFGICKVLMIIGFVILSIVINCGGAGDRKYIGAK 262

Query: 220 YWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAI 279
           YW +PG +  G         +F G    L++  F+Y GTEL  +T  E +NPR+ +    
Sbjct: 263 YWYDPGAFAVG-----SGATKFKGVAYVLVTGYFSYGGTELYAMTVNEQSNPRRAIQSIT 317

Query: 280 NKVXXXXXXXXXXXXXXXXXXXXXNDPKL--KSEDSYISSSPFVIAIENSGTKVLPHIFN 337
            +                         +L   S  S   +SP+V+A+   G K++PHI N
Sbjct: 318 KQCIYRILLIYMLTMILIGFLVPHTSSELMGSSGKSATHASPYVLAVSLHGVKIVPHIIN 377

Query: 338 AVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYL 397
           AVIL  +IS GNS +Y G RI  ++A  G AP++L +  ++G P  A++  SV G LA++
Sbjct: 378 AVILIAVISVGNSAMYSGPRILNTLAEQGYAPRFLAYVDRAGRPLVALIACSVFGLLAFV 437

Query: 398 ESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
            +S     VF WL  I  ++  FTW  I +SH+RF QA+++      +L +KA     G+
Sbjct: 438 AASDCEEDVFTWLAAIAGLSELFTWSAIMLSHVRFRQAMRYNNRPLSELGYKANTGVLGS 497

Query: 458 YYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFI 512
                            + AP     K  V  FF +Y++  L+ V + G+ I FR    I
Sbjct: 498 VLGLSFNILVFIAQFWVSIAPFGKDGKLDVLSFFQSYLAFPLWVVLFFGYMIVFRNWEII 557

Query: 513 K-TEDIDLDTDRREID-DVVWEEQ 534
           K  +DIDLD  R   D D +++E 
Sbjct: 558 KPLKDIDLDHYRSIYDQDRLYQED 581

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  272 bits (695), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 158/502 (31%), Positives = 258/502 (51%), Gaps = 21/502 (4%)

Query: 33  SLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAY 92
            L S ++  +++++K RH+ MI+LG  IGTGL +     L  AGP G ++ Y     + Y
Sbjct: 81  ELESQEKNNLRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLY 140

Query: 93  SVTQSLGEMA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQ 151
            + Q+ GE+   +  +T ++T ++   + P+LG A   +Y + W     L+L      ++
Sbjct: 141 CIIQAAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVK 200

Query: 152 FWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-A 210
           +WT+ V    ++A+ ++ + I NLF  + Y E EF     K+L + GF+I A ++ CG A
Sbjct: 201 YWTN-VNADIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFVILAIVINCGGA 259

Query: 211 GKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAAN 270
           G    +G  YW NPGP+  G          F G  +    AAF+Y G E++ ++A E  N
Sbjct: 260 GDRRYIGTEYWHNPGPFAHG----------FKGVCTVFCYAAFSYGGIEVLLLSAAEQEN 309

Query: 271 PRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL--KSEDSYISSSPFVIAIENSG 328
           P +++P A  KV                     N  +L      S   +SPFVIA+ + G
Sbjct: 310 PTESIPNACKKVVYRILLIYMLTTILIGFLVPYNSDELLGSGSSSGSHASPFVIAVSSHG 369

Query: 329 TKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTT 388
            KV+PH  NAVIL ++IS  NS++Y G R+  S+A  G+ PK L +  ++G P    L +
Sbjct: 370 VKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFLVS 429

Query: 389 SVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPF 448
              G + ++ +S+    VF WLL I++++  F W+ + +SHIRF  A+  QG S D++ +
Sbjct: 430 LAFGCIGFVATSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQGRSMDEVGY 489

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTAYISVMLFFVFWIGFQ 503
           KA+   WG++ A              A AP     K  V  FF  Y+++ +  + + G +
Sbjct: 490 KAQTGYWGSWIAVLIAVFFLVCQFWVAIAPVSEHGKLDVKVFFQNYLAMPIVLLAYFGHK 549

Query: 504 IWFRGPLF-IKTEDIDLDTDRR 524
           ++F+   F I  E IDLD+ R 
Sbjct: 550 MYFKSWRFWIPAEKIDLDSHRN 571

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  270 bits (690), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 164/532 (30%), Positives = 262/532 (49%), Gaps = 20/532 (3%)

Query: 21  KPSIAEDAVSMES-LGSVK-ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPV 78
           +  +  + + +E    S++ +  +K+A+K RH+ M++LG  IGTGL ++ +  L  AGP 
Sbjct: 54  RAEVNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPA 113

Query: 79  GALIAYMFIGTLAYSVTQSLGEMATFIP-VTSSFTVFTQRFLSPALGSANGYLYWLSWAI 137
             +I Y  +  + Y V Q+ GEMA   P +   F  +   F+S   G A  +L+ + W  
Sbjct: 114 SLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLT 173

Query: 138 TFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIV 197
              LEL      I++W D +    ++ I +V L   + F V+ YGE EF     K+L I 
Sbjct: 174 VLPLELITASMTIKYWNDKINADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIG 233

Query: 198 GFIIYAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQ 256
           GF+I + ++ CG AG  G +G +YWR+PG +     + D    RF G    L++A F+Y 
Sbjct: 234 GFVILSIVVNCGGAGVDGYIGGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFSYG 288

Query: 257 GTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYI 315
           G EL  ++  E  NPR++ P A  +                      N D  + +  S  
Sbjct: 289 GVELFALSVNEQENPRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSAT 348

Query: 316 SSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWT 375
            +SP+V+A+   G KV+PHI NAVIL ++ S  NS +Y   R+  S+A  G APKY  + 
Sbjct: 349 HASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYV 408

Query: 376 TKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQA 435
            + G P  A++  S+ G +A+   S     +F WL  I  ++  FTW  I +SH+RF  A
Sbjct: 409 DREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLA 468

Query: 436 LKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPK-----FKVSDFFTAYI 490
           +K QG S ++L + +    WG+ Y               A +P      +    FF +Y+
Sbjct: 469 MKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYL 528

Query: 491 SVMLFFVFWIGFQIWFRGPLFI-KTEDIDLDTDRREIDDVVW----EEQKPR 537
           +  ++  F++G+ ++ R   F+   + IDLD  RR  D  +     EE K R
Sbjct: 529 AFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKER 580

>Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON}
           YBR069C (REAL)
          Length = 618

 Score =  270 bits (690), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 160/501 (31%), Positives = 254/501 (50%), Gaps = 21/501 (4%)

Query: 33  SLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAY 92
            L S +   + R++K RH+ MI+LG  IGTGL +     L  AGP G ++ Y     + Y
Sbjct: 81  ELESQERNNLTRSIKSRHLIMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLY 140

Query: 93  SVTQSLGEMA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQ 151
            + Q+ GE+   +  +T ++T ++   + P+LG A   +Y + W     L+L      I+
Sbjct: 141 CIIQAAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTIK 200

Query: 152 FWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-A 210
           +WT+ V    ++A  ++ + I NLF  K Y E EF     K+L ++GF+I A ++ CG A
Sbjct: 201 YWTN-VNADIFVAAVFIFVIIINLFGSKGYAEAEFMFNICKILMVIGFVILAIVINCGGA 259

Query: 211 GKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAAN 270
           G    +G +YW NPGP+  G          F G  +    AAF+Y G E++ ++A E  N
Sbjct: 260 GDRKFIGTKYWHNPGPFAHG----------FKGVCTVFCYAAFSYGGIEVLLLSAAEQEN 309

Query: 271 PRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL--KSEDSYISSSPFVIAIENSG 328
           P K++P A  KV                     N  +L      S   +SPFVIA+ + G
Sbjct: 310 PTKSIPNACKKVVYRILFIYMLTTILICFLVPYNSDELLGSGSSSGSHASPFVIAVASHG 369

Query: 329 TKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTT 388
            KV+PH  NAVIL ++IS  NS++Y   R+  S+A  G  PK L +  ++G P    L +
Sbjct: 370 VKVVPHFINAVILISVISVANSSLYSAPRLLLSLAEQGFLPKCLAYVDRNGRPLLCFLVS 429

Query: 389 SVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPF 448
            + G + ++ +S     VF WLL I++++  F W+ +S+SHIRF  A+  QG S D++ +
Sbjct: 430 IIFGCIGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMDEVGY 489

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTAYISVMLFFVFWIGFQ 503
           KA+   WG++ A              A AP     K   + FF  Y+++ +    + G +
Sbjct: 490 KAQTGYWGSWLAVLIALFFLVCQFWVAIAPVSKHGKLDANVFFQNYLAMPIVLFAYFGHK 549

Query: 504 IWFRG-PLFIKTEDIDLDTDR 523
           I+ +    +I  E IDLD+ R
Sbjct: 550 IYTKSWKFWIPAEKIDLDSHR 570

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  271 bits (693), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 164/526 (31%), Positives = 266/526 (50%), Gaps = 16/526 (3%)

Query: 26  EDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYM 85
           ED  +  S+ + ++   K  +K RH+ M+ L   IGTGL ++ +  L  +GP G ++ Y 
Sbjct: 140 EDGTT--SIAASEDMPKKGGMKARHVIMMTLATGIGTGLLVANAKSLHFSGPAGLVVGYF 197

Query: 86  FIGTLAYSVTQSLGEMATFIP-VTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELS 144
            +  + Y V Q+ GEMA   P +   F  +   F+S   G A  +++ L+W     LEL 
Sbjct: 198 MVSFVTYFVVQAAGEMAIAYPTLPGGFNTYQSLFISKPFGFATVWIFALNWLTILPLELI 257

Query: 145 VVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAF 204
                +++WT ++    ++ IF++ L   +   ++ Y E EF+    K+L I GFII++ 
Sbjct: 258 TSSITVKYWTTSINPDIFVLIFYLFLLFVHFIGLRLYAEAEFFFNSCKILMITGFIIFSI 317

Query: 205 IMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGI 263
           ++ CG AG  G +G +YW +PGP+     + D    RF      LI+A F+Y GTEL  +
Sbjct: 318 VVNCGGAGHDGYIGGKYWHDPGPF-----ASDNGAARFKEVCYVLINAYFSYGGTELYVL 372

Query: 264 TAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIA 323
           +  E  NPRK VP A                         N P L    +   +SP+V+A
Sbjct: 373 SVNEQENPRKAVPVAAKTSVYRVAIIYLLTMILIGFNVPYNSPDLMGNANSKDASPYVLA 432

Query: 324 IENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYA 383
            +  G K++PH  NAVIL ++IS  NS ++ G R+  ++A  G APK+LT+  ++G P  
Sbjct: 433 AQIHGVKIVPHFINAVILLSVISVANSALFAGPRLLATLAEQGFAPKFLTYVDRAGRPLL 492

Query: 384 AVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISR 443
           A+   S+ G +A+  +S     VF WL  I  ++  F W  I +SHIRF  A+K+ G S 
Sbjct: 493 ALCVCSLFGVIAFAATSKKEDEVFTWLAAIAGLSELFAWSGILLSHIRFRWAMKYHGKSM 552

Query: 444 DDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAF-AP----KFKVSDFFTAYISVMLFFVF 498
           D++ +KA    WG+YY               A  AP    +     FF +Y++ +++  F
Sbjct: 553 DEVGYKAITGIWGSYYGLFFNLLVLIAQFWVALSAPGSGGQVTAISFFESYLAFVIWVFF 612

Query: 499 WIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKF 543
           ++ + I+ +   + I  +DID+D  RR I D  +  Q+    +EK+
Sbjct: 613 YLCYMIYNKDWTILIPLKDIDVDYQRR-IYDADFLRQEKEESYEKY 657

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  268 bits (684), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 157/428 (36%), Positives = 226/428 (52%), Gaps = 14/428 (3%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           GS     +KR+LK RH+ MIA+GG+IGTGLF+     L+  GP+  +I ++  GT     
Sbjct: 70  GSFDPDSLKRSLKSRHLIMIAIGGSIGTGLFVGSGKALAIGGPLAVIIGWLIAGTQMVGT 129

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
              LGE+    PV  +F  +  RFL P+L      +Y L W     LE+      IQFW 
Sbjct: 130 IHGLGEITVRFPVVGAFADYGTRFLDPSLSFVVSSIYVLQWFFVLPLEIIASAMTIQFWN 189

Query: 155 DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
            ++    W+AIF+V +   NLF V+ +GE EF  + IKV+ I GFII   +++ G G T 
Sbjct: 190 TSIDPVVWVAIFYVTIVAINLFGVRGFGEAEFLFSSIKVITISGFIILCIVLIVGGGPTH 249

Query: 215 P-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
             VG RYW +PG    G          F G  S  ++A+++  G+E+  + +GE  +P K
Sbjct: 250 EYVGARYWHDPGALAHG----------FKGVASVFVTASYSLGGSEMACLASGE-TDP-K 297

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
            +P AI +V                      +  L    S +++SPFVIA      KVLP
Sbjct: 298 ELPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSS-VNNSPFVIACNLYHIKVLP 356

Query: 334 HIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGF 393
            I NAVIL +I+S GNS ++  SR   SMA  GL P+   +  ++G P   ++T S+ G 
Sbjct: 357 SIINAVILVSIMSVGNSCIFASSRTLCSMAHQGLIPQIFGYVDRAGRPLVGIITNSLFGL 416

Query: 394 LAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFM 453
           LA+L  SS  S VFNWL+ I  +A    W+ I++SHIRF  A+K Q  + D+L F +   
Sbjct: 417 LAFLVKSSSMSEVFNWLMAIAGLATCVVWLSINVSHIRFRMAMKAQDKTLDELEFVSAVG 476

Query: 454 PWGAYYAA 461
            WG+ Y+A
Sbjct: 477 IWGSVYSA 484

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  270 bits (690), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 174/528 (32%), Positives = 280/528 (53%), Gaps = 21/528 (3%)

Query: 26  EDAVSMESLGSVKETQV--------KRALKPRHISMIALGGTIGTGLFISISTPLSNAGP 77
           ED   M+S+ S +  +V        ++ +KPRH+ MI+LG  IGTGL +  S+ LS AGP
Sbjct: 98  EDDEIMQSVASAEHRKVNNTESDDLQKTIKPRHVIMISLGTGIGTGLLVGNSSVLSAAGP 157

Query: 78  VGALIAYMFIGTLAYSVTQSLGEMAT-FIPVTSSFTVFTQRFLSPALGSANGYLYWLSWA 136
              +I Y  +G+  Y + Q+ GEMA  +  +   F  +    L PALG +  ++Y L W 
Sbjct: 158 APLVIGYSIMGSCLYCIIQAAGEMAVVYSDLNGGFNNYPSFLLDPALGFSVAWVYCLQWL 217

Query: 137 ITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAI 196
               LEL      I++WT  V    ++ IF+V++   N+F  + Y E EF+    KVL +
Sbjct: 218 CVCPLELVTASLTIKYWTTKVDPDVFVIIFYVLIISINVFGARGYAEAEFFFNVCKVLMM 277

Query: 197 VGFIIYAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY 255
           +GF I   I+  G AG  G +G +YW  PG +  G  + D    RF G + + ++AAF +
Sbjct: 278 IGFFILGIIITAGGAGNDGYLGAKYWHEPGAF-RGEHAVD----RFKGVMDTFVAAAFAF 332

Query: 256 QGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSY 314
             TE + +TA E +NPRK +P A  KV                     + D  L S  S 
Sbjct: 333 GATEFIALTAAEQSNPRKAIPSAAKKVLYRIVLIFLVSIIMLGFLVPYDSDQLLGSSGSG 392

Query: 315 ISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTW 374
           + +SP+V+A+   G +V+PH  NAVIL +++S GNS  Y  SR+  S++  G APK+  +
Sbjct: 393 VKASPYVLAVSLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSQQGYAPKWFDY 452

Query: 375 TTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQ 434
             + G P  A+L +++ G +A+  +S   + VFNWLL I+ ++  FTW  I +SH+RF  
Sbjct: 453 VDRQGRPARAMLMSALFGVIAFCATSPKETDVFNWLLAISGLSQLFTWFAICMSHVRFRY 512

Query: 435 ALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYI 490
           A+K QG S  ++ F ++   +G+ YAA             A AP    K    +FF +Y+
Sbjct: 513 AMKVQGRSIGEVGFHSQTGVYGSLYAATMMILALMAQFWVAIAPLNEGKLDAQNFFQSYL 572

Query: 491 SVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQKPR 537
           ++ +    + G+++++R   L+IK + IDL + R+  D+ + +++   
Sbjct: 573 AMPILIALYFGYKLYYRDWKLYIKADKIDLISHRQIFDENILKQEDEE 620

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score =  266 bits (679), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 179/549 (32%), Positives = 277/549 (50%), Gaps = 27/549 (4%)

Query: 6   DYEATREKDGSHLIIKPSIAEDAVSMESLGSVKET---QVKRALKPRHISMIALGGTIGT 62
           D EA +   G   I + S + D   + S    ++     + RAL PRHI+MI++ G IGT
Sbjct: 7   DREAVKVDSGKQEIYEVSSSLDIDELRSDFDPEQNIREDLTRALSPRHINMISIAGIIGT 66

Query: 63  GLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPA 122
           GL++S +  L N GP    + Y  IG + Y     LGEM+TF+P++ SF  + ++F S +
Sbjct: 67  GLYLSTAKSLHNGGPASLFMNYTIIGGVVYLTMLCLGEMSTFMPISGSFCSYARKFGSES 126

Query: 123 LGSANGYLYWLSWAITFALELSVVGQIIQFWTDA---VPLTAWIAIFWVILTISNLFPVK 179
              A  + YW + A++ A +L+ +  ++ +W  A    P      IFW  +   N+  V+
Sbjct: 127 FACALMWNYWFNDAVSVASDLTALQLVLDYWHTADHHFPYWGASLIFWFFVLFLNVIHVR 186

Query: 180 YYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGP-VGFRYW-RNPGPWGPGIISKDVN 237
            YGE E+W+A +KV+AIV F I + I+  G       +GF+ W     P+  G       
Sbjct: 187 IYGEAEYWLAMLKVIAIVIFFIMSIIVNVGKNPQHEYIGFKNWTHGEAPFVNG------- 239

Query: 238 EGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXX 297
              F G+ S  +SA F Y GTE + +T GEA+NP +  P+ +  V               
Sbjct: 240 ---FKGFASLFVSACFAYGGTESITLTGGEASNPVRNTPKIVKTVFWRILIFYVLSTFFI 296

Query: 298 XXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSR 357
                 + P L ++   + +SPF +  + +GT+      NAVIL+++ISA N  ++ GSR
Sbjct: 297 GMNIPYDYPGLSTKS--VMTSPFTLVFQMAGTRGAGSFMNAVILTSVISACNHALFAGSR 354

Query: 358 IAYSMAMNGLAPKYLT-WTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAV 416
           I Y+MA++G  PK +   T +   PY AVL T  +G L    S  GA  ++ WL NI  V
Sbjct: 355 IMYNMALDGYLPKKIVGRTNRYKAPYVAVLITWAVGGLCLGASFIGAGTLWTWLQNIVGV 414

Query: 417 AGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAF 476
           +    W+ I I+ IRF + L+ QG   D L FK    P+G Y+               AF
Sbjct: 415 SNQIAWLCIGITSIRFRKGLEVQG-KTDLLQFKNWTYPFGPYFLVIFTVFIILIQGWQAF 473

Query: 477 APKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRR-EIDDVVWEEQK 535
            P + V+DFF+ Y+ + +F   +I + +W R   F+K ED+D  TDR     ++V   ++
Sbjct: 474 DP-WSVTDFFSVYLELFVFPFVYIIWWLWKR-DWFVKYEDMDFVTDRYIPTKEIVELNER 531

Query: 536 PRNL--WEK 542
             NL  W+K
Sbjct: 532 LDNLKGWKK 540

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score =  267 bits (682), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 171/506 (33%), Positives = 260/506 (51%), Gaps = 14/506 (2%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97
           K   +K+ ++PRH+ MI+L   IGTG+ +     L N GP   +I Y  + ++ Y V QS
Sbjct: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136

Query: 98  LGEMAT-FIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDA 156
             E+A  +  +   F  +    +  A G +  ++Y L W     LEL      I++W   
Sbjct: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196

Query: 157 VPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGP 215
           +   A++ IF+V+L   N      Y E EF+  C KVL I+GF I   I+ CG AG  G 
Sbjct: 197 INPDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKVLMIIGFFILGIIINCGGAGNDGY 256

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G RYW +PG +     S  +N  RF G V+ L++AAF Y G E   +TA E  NP+K++
Sbjct: 257 LGARYWHDPGAFRG---SDSIN--RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 311

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
             A  K+                     N D  L S  S   +SPFVIA+ + G +V+PH
Sbjct: 312 RSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPH 371

Query: 335 IFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFL 394
             NAVIL +++S  NS +Y  SRI  S++  G AP++L +  + G P   +L + V G L
Sbjct: 372 FINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431

Query: 395 AYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMP 454
           +++ +S     VF WLL I+ ++  FTW  IS+SH+R  +A+  QG S D+L + A    
Sbjct: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-P 509
           WGAYYA              A +P    K   ++FF  Y+++ +    ++G++IW R   
Sbjct: 492 WGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR 551

Query: 510 LFIKTEDIDLDTDRREID-DVVWEEQ 534
           L I + ++DL   R+  D +V+  EQ
Sbjct: 552 LLIPSSEVDLVAHRKIFDAEVLRHEQ 577

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  268 bits (685), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 160/516 (31%), Positives = 265/516 (51%), Gaps = 15/516 (2%)

Query: 20  IKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVG 79
           +  +I E  V++ S    ++  ++++++PRH+ M +L   +GTGL +   + L  AGP G
Sbjct: 107 LSAAIKEHDVAITS--KEEDAHLRKSIQPRHVLMSSLATGVGTGLLVGNGSALHKAGPAG 164

Query: 80  ALIAYMFIGTLAYSVTQSLGEMA-TFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAIT 138
            +I Y  +GT  Y + Q+ GEMA ++  +  +F  +    +    G A  ++Y + W   
Sbjct: 165 LVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCV 224

Query: 139 FALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVG 198
             LEL      I +WT  V    ++ IF+V++ + N+F  K Y E +F+    KVL I G
Sbjct: 225 MPLELVTASMTIDYWTTKVNNDIFVVIFYVLIILINVFGAKGYAEADFFFNTCKVLMITG 284

Query: 199 FIIYAFIM-VCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQG 257
           F I A I+   GAG +G +G +YW +PG +       D +  RF   +++  +AAF +  
Sbjct: 285 FFILAIIINAGGAGTSGYIGAKYWHDPGAF-----RGDRSIDRFKDVMATFTTAAFAFGA 339

Query: 258 TELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-IS 316
           +E + I A E +NPR+ +P A   +                     +  +L    S    
Sbjct: 340 SEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTK 399

Query: 317 SSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTT 376
           +SP+V+AI + G +V+PH  NAVIL  ++S  NS  Y   RI +S++  G AP++  +  
Sbjct: 400 ASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYID 459

Query: 377 KSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQAL 436
           + G P  A++ + + G +A+   SS    VF WLL I+ ++  FTW+ I +SHIRF +A+
Sbjct: 460 REGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAM 519

Query: 437 KHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISV 492
             QG S  +L F+++   WG+ YAA             + AP          FF  Y+++
Sbjct: 520 HVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAM 579

Query: 493 MLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREID 527
            +  VF+ G++I+ R   LFI+ ++IDL T R   D
Sbjct: 580 PILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFD 615

>Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL020W
           (TAT2) - Tryptophan permease, high affinity [contig 265]
           PARTIAL
          Length = 481

 Score =  263 bits (672), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 153/428 (35%), Positives = 224/428 (52%), Gaps = 14/428 (3%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           GS     +K++LK RH+ MIA+GG+IGTGLFI     L+  GP+  +I +   GT     
Sbjct: 66  GSFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVGT 125

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
              LGE+    PV  +F  +  RFL P++      +Y L W     LE+      +++W 
Sbjct: 126 IHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWD 185

Query: 155 DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KT 213
            +V    W+AIF+ I+ + NL  V+ +GE EF  + IKV+ IVGFII   +++CG G K 
Sbjct: 186 TSVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGPKK 245

Query: 214 GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
             VG +YW +PGP   G          F G    L+ A+++  GTE+  + +GE  +P K
Sbjct: 246 EFVGAKYWHDPGPLANG----------FKGVAGVLVIASYSLGGTEMACLASGE-TDP-K 293

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
            +P AI +V                      +  L    S + +SPFVIAI   G   LP
Sbjct: 294 ELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMGGSS-VDNSPFVIAIRLHGINALP 352

Query: 334 HIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGF 393
            I NAVIL +++S GNS ++  SR   SMA  GL P+   +  ++G P   +LT  + G 
Sbjct: 353 SIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGL 412

Query: 394 LAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFM 453
           LA+L  S  A  VF WL+ I  +A    W+ I+ISHIRF  A+K QG+  ++L F +   
Sbjct: 413 LAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEFVSGVG 472

Query: 454 PWGAYYAA 461
            +G+ Y+A
Sbjct: 473 IYGSVYSA 480

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  267 bits (683), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 167/534 (31%), Positives = 268/534 (50%), Gaps = 22/534 (4%)

Query: 21  KPSIAEDAVSMESLGS---VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGP 77
           K    ED++ +E       +  T +K+A+K RH+ M++LG  IGTGL ++ +  L   GP
Sbjct: 91  KGGFEEDSLDLEGSDHDSIITNTHLKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGP 150

Query: 78  VGALIAYMFIGTLAYSVTQSLGEMATFIP-VTSSFTVFTQRFLSPALGSANGYLYWLSWA 136
              +I Y+ +  + Y + Q+ GEMA   P +  +F  ++  F+S A G A  +++ + W 
Sbjct: 151 AALVIGYVLVSFVTYFMIQAAGEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWL 210

Query: 137 ITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFP-VKYYGEVEFWIACIKVLA 195
               LEL      I++W D +    +I IF+V L   +LF  V  YGE EF     K+L 
Sbjct: 211 TVLPLELITASLTIKYWNDKINADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKILM 270

Query: 196 IVGFIIYAFIM-VCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFT 254
           ++GFII + ++   GAG    +G ++W +PG +     +      RF G    L+S  F+
Sbjct: 271 VIGFIIMSIVINAGGAGNREYIGGKFWHDPGAF-----AGKTAGSRFKGICYVLVSGYFS 325

Query: 255 YQGTELVGITAGEAANPRKTVPRA-INKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDS 313
           Y GTEL  ++  E +NPR++ P+A  + +                     +D  + S  S
Sbjct: 326 YGGTELFALSVNEQSNPRRSTPQASKSSLYRILIIYLLTMILIGFNVPYDSDELMGSGGS 385

Query: 314 YISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLT 373
              +SP+V+A   +G K+ PH  NAVIL ++IS  NS++Y   R+  S+A  G APK+L 
Sbjct: 386 ATHASPYVLAASLNGVKIAPHFINAVILISVISVANSSLYAAPRLMCSLAQQGYAPKFLD 445

Query: 374 WTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFM 433
           +  + G P  A++   ++G + ++ +S     VF WL  I  ++  FTW  I +SH+RF 
Sbjct: 446 YVDRQGRPLLALIACLLVGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVRFR 505

Query: 434 QALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTA 488
            A+K Q  S ++L +KA    +G+ Y              TA  P     K   + FF  
Sbjct: 506 MAMKLQNRSLEELGYKATTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKANANSFFAN 565

Query: 489 YISVMLFFVFWIGFQIWFRGPLFIKTED-IDLDTDRREIDDVVW----EEQKPR 537
           Y+++ ++ VF+ G+ +W R    +K  D IDLD  RR  D  +     EE K R
Sbjct: 566 YLAMPIWLVFYFGYMLWTRDFQLLKPLDKIDLDFHRRIYDPELMRQEDEESKER 619

>Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON}
           ANNOTATED BY YGOB - YOL020W (TAT2) - Tryptophan
           permease, high affinity [contig 265] PARTIAL
          Length = 491

 Score =  263 bits (672), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 153/428 (35%), Positives = 224/428 (52%), Gaps = 14/428 (3%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94
           GS     +K++LK RH+ MIA+GG+IGTGLFI     L+  GP+  +I +   GT     
Sbjct: 66  GSFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVGT 125

Query: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154
              LGE+    PV  +F  +  RFL P++      +Y L W     LE+      +++W 
Sbjct: 126 IHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWD 185

Query: 155 DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KT 213
            +V    W+AIF+ I+ + NL  V+ +GE EF  + IKV+ IVGFII   +++CG G K 
Sbjct: 186 TSVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGPKK 245

Query: 214 GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
             VG +YW +PGP   G          F G    L+ A+++  GTE+  + +GE  +P K
Sbjct: 246 EFVGAKYWHDPGPLANG----------FKGVAGVLVIASYSLGGTEMACLASGE-TDP-K 293

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
            +P AI +V                      +  L    S + +SPFVIAI   G   LP
Sbjct: 294 ELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMGGSS-VDNSPFVIAIRLHGINALP 352

Query: 334 HIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGF 393
            I NAVIL +++S GNS ++  SR   SMA  GL P+   +  ++G P   +LT  + G 
Sbjct: 353 SIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGL 412

Query: 394 LAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFM 453
           LA+L  S  A  VF WL+ I  +A    W+ I+ISHIRF  A+K QG+  ++L F +   
Sbjct: 413 LAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEFVSGVG 472

Query: 454 PWGAYYAA 461
            +G+ Y+A
Sbjct: 473 IYGSVYSA 480

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  268 bits (684), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 166/500 (33%), Positives = 260/500 (52%), Gaps = 16/500 (3%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQS 97
           K  ++K+ +KPRH+ MI+LG  IGTGL + + + L  AGP G L+ +  +GT  Y + Q+
Sbjct: 145 KSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCIIQA 204

Query: 98  LGEMAT-FIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDA 156
           +GEMA  +  +   F  +    + PA G +  ++Y L W     LEL      I++WT  
Sbjct: 205 VGEMAVAYSDLVGGFNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWTTK 264

Query: 157 VPLTAWIAIFWV-ILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KTG 214
           V    ++ IF+V IL I+ +     Y E EF     K+L ++GF I   I++CG     G
Sbjct: 265 VDPDVFVIIFYVLILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGNDG 324

Query: 215 PVGFRYWRNPGPW-GPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
            +G +YW  PG + G   I       RF G +++L++AAF +  +E +G+TA E +NPRK
Sbjct: 325 YIGGKYWHEPGAFRGEHAID------RFKGVMATLVNAAFAFGMSEFIGVTASEQSNPRK 378

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVIAIENSGTKVL 332
            +P A  K+                     + D  L S    + +SP+V+A+   G KV+
Sbjct: 379 AIPSAAKKMLYRIVCMFLASITIVGFLVPYDSDQLLGSSGGGVKASPYVLAVSTHGVKVV 438

Query: 333 PHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLG 392
           PH  NAVIL +++S  NS  Y  SR+  S+A  G APK   +  + G P   +   S+ G
Sbjct: 439 PHFINAVILISVLSVANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASLFG 498

Query: 393 FLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKF 452
            +A+  +S     VF WLL I+ ++  FTWI I +SH+RF +A+  QG S  +L F+++ 
Sbjct: 499 VIAFCATSPKEDEVFVWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRSQV 558

Query: 453 MPWGAYYAAXXXXXXXXXXXXTAFAP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG 508
             WG+ YAA             A AP    K    +FF  Y+++ +    + G++I+ + 
Sbjct: 559 GAWGSSYAAIMMVCILIAQFWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIYTKN 618

Query: 509 -PLFIKTEDIDLDTDRREID 527
             +FI+ +DIDL + R   D
Sbjct: 619 WTIFIRAKDIDLVSHRNIFD 638

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  264 bits (675), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 175/550 (31%), Positives = 273/550 (49%), Gaps = 23/550 (4%)

Query: 4   SKDYEATR----EKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGT 59
           S+D E  +    E D     I+ +   D    + +     T++K+ LK RHI M+ L G 
Sbjct: 5   SQDKEKVKATAYEADVEDCDIRST---DETLKQGVLHNDRTKLKQGLKERHIKMLTLVGV 61

Query: 60  IGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFL 119
            GTGLF+S    L   GPVG LIAY+F+G +      ++ E+A+F+P T +     ++F+
Sbjct: 62  FGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQFI 121

Query: 120 SPALGSANGYLYWLS-WAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPV 178
             ++G   G   W+S ++     ELS    I+++WTD  P   +I IF V+  ++N++ +
Sbjct: 122 DESVGFTFG---WISTYSSLMPGELSATAVIMRYWTDISP-AVFITIFGVLFVVTNIYTI 177

Query: 179 KYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGK-TGPVGFRYWRNPGPWGPGIISKDVN 237
           ++YGEVE+    +K++ I   II   ++  G  K    +GF YWR+PGP+   I+   + 
Sbjct: 178 RFYGEVEYVFGWLKLILIFILIISGLVIDLGGVKGQERLGFHYWRDPGPFAEYIVGGSI- 236

Query: 238 EGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXX 297
            G+F+G+ S+L S  ++Y G + + I AGE  N R  +      V               
Sbjct: 237 -GKFVGFWSALSSVVYSYSGIQNIAILAGETKNSRHAIYHGAKNVFLRIIVLYLVTVFVL 295

Query: 298 XXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSR 357
                 ND  + S      SSPFVIA+  +G KVLPHI NA++L++  SAGN  +  GSR
Sbjct: 296 TLIVPYNDALIASGTGTAKSSPFVIAMNRAGIKVLPHIVNALVLTSAWSAGNLAIIEGSR 355

Query: 358 IAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVA 417
             + +A    APK    T+K GIPY  V+  S    LAY+  S  +S VF W   + +  
Sbjct: 356 NLFCLATKNQAPKIFLKTSKRGIPYVGVIFISCFLPLAYMSCSESSSTVFGWFQELVSSN 415

Query: 418 GFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFA 477
               WILIS +HI   +ALK QG SR DLP+     P+ A+++               F 
Sbjct: 416 TLLRWILISANHIYMDRALKAQGYSRSDLPYSTPIAPYAAWFSGIMSFIFLLTGGFYNFI 475

Query: 478 P-KFKVSDFFTAYISVML---FFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEE 533
              F +  FFT Y  + L    F FW      F+   +++ E++DL +   +I +     
Sbjct: 476 HGHFDIESFFTRYFIIPLAIGLFTFW----KLFKKTRYLRPEEVDLASIFDDIRENPEHI 531

Query: 534 QKPRNLWEKF 543
           +K + +W + 
Sbjct: 532 EKSKPIWARL 541

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  263 bits (671), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 173/535 (32%), Positives = 275/535 (51%), Gaps = 27/535 (5%)

Query: 20  IKPSIAEDAVSMESLGSVKET----QVKRALKPRHISMIALGGTIGTGLFISISTPLSNA 75
           +  SI ED +   S+  + +     Q++R LK RH+ +IALG  IGTGLFI     LS  
Sbjct: 33  VTESIQEDDLERGSIDVLIDEKPSHQMQRGLKSRHMQLIALGCAIGTGLFIGTGGALSTC 92

Query: 76  GPVGALIAYMFIGTLAYSVTQSLGEMATFIPV--TSSFTVFTQRFLSPALGSANGYLYWL 133
           GP   LI+Y+ +    +++   L EM    P+   +S     + +L+  L    G+  + 
Sbjct: 93  GPAPLLISYIIMSFFVWTIMHQLTEMVVLTPIPGEASMYALARAYLNRPLSFMCGWNLFY 152

Query: 134 SWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKV 193
           + A+    E++    +IQ+WTDA     +++IF VI       PVK +GE EFW++ IK+
Sbjct: 153 AQAMIAPSEITASTLLIQYWTDANS-AIFVSIFIVITIAVTALPVKVFGESEFWVSMIKL 211

Query: 194 LAIVGFIIYAFIMVCGAG--KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISA 251
           + I G II   ++  G G  +   +GF YW++PG + P I +   N G+FL   +++I +
Sbjct: 212 ITITGLIILGVVIFFGGGPNQHHVLGFHYWKHPGAFKPHISTG--NTGKFLAVWTAIIKS 269

Query: 252 AFTY-QGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-- 308
            F +    E +   + EA  PR+ +PRA N+                      ++  L  
Sbjct: 270 GFAFILSPETLTSCSAEADRPRRNMPRAANRFVWRLMLFYIGGALVVGVTVGYDNQNLLS 329

Query: 309 --KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNG 366
              S  S  ++SPFVI I+  G KVLPHI NA IL+   SAG + +Y  SR+ +SMA+ G
Sbjct: 330 AIASGQSNAAASPFVIGIKEVGIKVLPHIINAAILTGAYSAGTAEMYGASRMLHSMALKG 389

Query: 367 LAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILIS 426
            APK      + G+PY +++  S   FLAYL  S+ AS VF WL NI+ ++GF +W+ +S
Sbjct: 390 NAPKIFARVNRYGVPYYSIIVPSCFCFLAYLNCSNSASQVFTWLTNISTISGFISWVFVS 449

Query: 427 ISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-KFKVSDF 485
           I+++RF + + +  ++ D + F+  F    AY++               F    + VSDF
Sbjct: 450 ITYVRFRRVIDYLDLN-DRIKFRKPFQRIFAYFSGCFFVILSLTNGYAVFTKGNWSVSDF 508

Query: 486 FTAYIS----VMLFFVFWIGFQIW-FRGPLFIKTE---DIDLDTDRREIDDVVWE 532
           F  YI+    V+LF +    ++ W FR    I++E    ID+  D  E +++V E
Sbjct: 509 FANYITIGFVVVLFIMGTAYYKEWRFRDMEEIRSELIPKIDM-ADEEESNEIVIE 562

>TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  261 bits (668), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 172/551 (31%), Positives = 273/551 (49%), Gaps = 32/551 (5%)

Query: 20  IKPSIAEDAVSMESLGSVKETQVK------RALKPRHISMIALGGTIGTGLFISISTPLS 73
           +K S+ E  V  E  GS+ E +VK      R LK RHI +IALG  IGTGLFI     LS
Sbjct: 25  MKASVNE--VIDEEQGSISELEVKPQNEMVRGLKSRHIQLIALGDAIGTGLFIGSGGALS 82

Query: 74  NAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFT--QRFLSPALGSANGYLY 131
             GP   LI+Y+ +    +++   L EM   IP+    ++++  + ++   L    G+  
Sbjct: 83  TCGPAPILISYIVMSFFVWTIVNQLTEMVALIPLPGEASMYSLARMYVGRPLAFMCGWNL 142

Query: 132 WLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACI 191
           + + A+    E++    +IQ+WTDA     +I+IF V      + PV+ +GE EF ++ I
Sbjct: 143 FYAMAMIAPSEITACAMLIQYWTDANS-AIFISIFIVFSVAITMLPVRVFGESEFCVSSI 201

Query: 192 KVLAIVGFIIYAFIMVCGAGKTGP--VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLI 249
           K+L IVG II   ++  G G +    +GF YW+ PG +   ++    + G+FL   +++I
Sbjct: 202 KLLTIVGLIIVGIVIFFGGGPSQDHILGFHYWKKPGAFKEHLVPG--STGKFLAVWTAII 259

Query: 250 SAAFTYQGT-ELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL 308
            + F++    E V   + E+A+PR+ +PRA  +                      +D  L
Sbjct: 260 KSGFSFVLVPETVASCSAESASPRRNMPRACQRFVYRLALFYVAGVLVVTVVVGSDDANL 319

Query: 309 ----KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAM 364
                S  S  ++SP+VI I+ +G KVLPHI NA IL++  S G + +Y  SRI +SMAM
Sbjct: 320 LNAIHSGASNAAASPYVIGIKEAGIKVLPHIINACILTSAYSCGTAELYGCSRILHSMAM 379

Query: 365 NGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWIL 424
            G AP+      + G+PY +     +   LAYL  S  +S VFNWL NI  ++GF +W+ 
Sbjct: 380 KGDAPQIFAKVNRFGVPYYSTAVACLFTLLAYLNCSKSSSLVFNWLSNIATISGFISWVF 439

Query: 425 ISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-KFKVS 483
           +S+++ RF   +    ++ D +PF+ +F    AY                 F    +  S
Sbjct: 440 VSVTYTRFRTVIDKLDLN-DRIPFRRRFQKGFAYACIAFFVLLSLTNGYAVFIKGNWNTS 498

Query: 484 DFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLD-------TDRREIDDVVWEEQKP 536
           DFF +Y+++    V +IG  I+++   F    +I  +        D  E +DV      P
Sbjct: 499 DFFASYVTIGFVAVLFIGSTIYYKELRFRDVSEIGREIIPKIDIADEDERNDV---PVVP 555

Query: 537 RNLWEKFWAAI 547
           +N  EK W  I
Sbjct: 556 KNWGEKIWYTI 566

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score =  261 bits (668), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 151/510 (29%), Positives = 258/510 (50%), Gaps = 19/510 (3%)

Query: 25  AEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAY 84
             DA  + S GS +   +++++KPRH+ MI++   IGTGL +     ++ AG  G LI Y
Sbjct: 9   CSDAEKLSSEGS-EPASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLIGY 67

Query: 85  MFIGTLAYSVTQSLGEMATFIP-VTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALEL 143
           + IG +     QS+GE+    P +   F  + ++F+ P+LG    +L+ L W +   LEL
Sbjct: 68  LIIGVMVVCCMQSVGELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPLEL 127

Query: 144 SVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYA 203
                 I++W   +  + +++ F++++ I N F    Y E EF   C+KV+ +  FI+  
Sbjct: 128 VTASMTIKYWNSNLSPSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFIVLG 187

Query: 204 FIMVCGA-GKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVG 262
            +++ G  G +GP+GF+Y + PG +       + N   F     +L++AAF+  G E + 
Sbjct: 188 IVIITGGLGNSGPIGFQYLKTPGAF-------NTNYNVFKATAGTLVNAAFSCGGVEFLA 240

Query: 263 ITAGEAA--NPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYIS-SSP 319
           ++A E    N  K++ RA  +V                     + P L    S  + +SP
Sbjct: 241 LSAAEQNRDNMPKSIRRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTTHTSP 300

Query: 320 FVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSG 379
           +V AI   G +++PHI NAVIL  ++S  NS +Y  SR  +S+A    AP+Y     K G
Sbjct: 301 YVAAIALHGVRIVPHIINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNKHG 360

Query: 380 IPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQ 439
            P   ++ ++++G ++++       AVF WLL+I+ ++  FTW  I I+HIRF  ALK Q
Sbjct: 361 QPMRCLVVSAIVGLISFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALKLQ 420

Query: 440 GISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFKVSDFFTAYISVML 494
           G S D L +++     G+Y A              +  P     K     FF  Y++V +
Sbjct: 421 GQSLDTLGYRSNTGVIGSYIATAINVVVIIVQFWVSLFPLENNGKPDAVKFFQNYMAVPV 480

Query: 495 FFVFWIGFQIWFRG-PLFIKTEDIDLDTDR 523
             + ++G +++      +I+T  +D++TDR
Sbjct: 481 AVLLYLGHKLYTNDWTPWIRTHCVDINTDR 510

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  261 bits (666), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 164/512 (32%), Positives = 276/512 (53%), Gaps = 27/512 (5%)

Query: 20  IKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVG 79
           + PS+  +    +   +++E  ++RALKPRHI+MI++ G IGTGL++S +  L   GP  
Sbjct: 34  LDPSLTTEE-DYDPEANIRE-DLQRALKPRHINMISIAGVIGTGLYLSTAKSLYQGGPAS 91

Query: 80  ALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITF 139
             + Y  +G + Y     LGEM+T++P++ SF  + ++F S +   A  + YW + A++ 
Sbjct: 92  LFMNYTIMGGVVYLTLLCLGEMSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSV 151

Query: 140 ALELSVVGQIIQFW-TDAVPLTAWIA--IFWVILTISNLFPVKYYGEVEFWIACIKVLAI 196
           A +++ +  ++ +W T+A     W A  +FW ++ + N+  V++YGE E+W+A +KV+AI
Sbjct: 152 ASDMTALQLVMDYWDTEASGFPYWAASLLFWFLVVLLNVIHVRFYGEAEYWLAMLKVIAI 211

Query: 197 VGFIIYAFIMVCGAGKTGP-VGFRYWRN-PGPWGPGIISKDVNEGRFLGWVSSLISAAFT 254
           + F I + ++  G       +GF+ W +   P+  G          F G+ S  +SA+F 
Sbjct: 212 IIFFILSIVVNVGHNPQHEYIGFKNWNHGEAPFVDG----------FKGFASLFVSASFA 261

Query: 255 YQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY 314
           Y GTE + +T GEAANP +  P+ +  V                     + P L ++   
Sbjct: 262 YGGTESITLTNGEAANPLRNTPKIVKTVFWRILVFYVGSTFFIAMNIPYDYPGLDTKS-- 319

Query: 315 ISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYL-T 373
           + +SPF +  + +GTK      NAVI++++ISA N  ++ GSR+ Y+M + G  PK + +
Sbjct: 320 VVTSPFTLVFQMAGTKAAGSFMNAVIMTSVISACNHALFAGSRVMYNMGLEGFLPKKIVS 379

Query: 374 WTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFM 433
            T +  +PY +VL TS +G L +  S  GA  V+ WL NI  V+    W+ I I+ IRF 
Sbjct: 380 RTNRYKVPYVSVLITSSIGLLCFGASFIGAGTVWTWLQNIVGVSNQIAWLCIGITSIRFR 439

Query: 434 QALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFKVSDFFTAYISVM 493
           + L+ QG +  +L +K    P+G Y+              +AF P + V++FF+ Y+ + 
Sbjct: 440 KGLEKQGKTH-ELRYKNWTYPYGPYFLVIFVTFIILVQGWSAFDP-WDVTNFFSYYLDL- 496

Query: 494 LFFVFWIGFQIW--FRGPLFIKTEDIDLDTDR 523
             FVF   F IW  ++   F+K ED+D  TDR
Sbjct: 497 --FVFPFCFIIWWLYKRDRFVKLEDMDFVTDR 526

>NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON} 
          Length = 614

 Score =  261 bits (668), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 174/533 (32%), Positives = 269/533 (50%), Gaps = 25/533 (4%)

Query: 1   MSLSKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTI 60
           +S SK    T  +D  H     S       ++S    ++TQ+ + +K RH+ MI+LG  I
Sbjct: 65  VSTSKCNAKTYFQDFCH-----SFKRKDSDLDSDVEAQDTQLSKTIKSRHLLMISLGTGI 119

Query: 61  GTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMA-TFIPVTSSFTVFTQRFL 119
            TGL +     L+ AGP G +I Y     + Y +  + GE+   +  +  +FT +    +
Sbjct: 120 ATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILI 179

Query: 120 SPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVK 179
            P+LG A   LY L W     L+L      I FWTD  P    + +F V++ I NLF  +
Sbjct: 180 DPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTDVNPDIFVLCVFIVVI-IVNLFGAR 238

Query: 180 YYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNE 238
            Y E EF+  C K+L I GFII + +++ G AGK G +G +YW +PGP+  G        
Sbjct: 239 GYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGPFAHG-------- 290

Query: 239 GRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXX 298
             F G  +    AAF+Y G E+V ++  E  +P   VP A  KV                
Sbjct: 291 --FKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKVVYRILLIYLLTTILVC 348

Query: 299 XXXXXNDPKL-KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSR 357
                + P L  S  S   +SPFVIAIE+ G KV+PH  NAVIL ++IS  NS++Y  SR
Sbjct: 349 FLVPYDSPNLLGSSHSGSHASPFVIAIESHGVKVVPHFINAVILISVISVANSSLYSSSR 408

Query: 358 IAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVA 417
           +  S++  G  P++L +   +G P    + + + G + ++ +S     VF WLL I+ ++
Sbjct: 409 LLLSLSEQGSLPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLS 468

Query: 418 GFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFA 477
             F W+ +S+SHIR   A+K QG S D++ +KA+   WG++ A              A A
Sbjct: 469 QLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIA 528

Query: 478 P-----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRR 524
           P     +  V +FF  Y++  +  V ++G +I+++   L+I  + IDLD+ RR
Sbjct: 529 PVEKHGELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRR 581

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  260 bits (664), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 164/545 (30%), Positives = 275/545 (50%), Gaps = 20/545 (3%)

Query: 9   ATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISI 68
             ++  G+      S+AED  +   +   KE  ++++++PRH+ MI++   IGTGL +  
Sbjct: 9   CKKDASGAEADSVESVAEDVEAGAGVQGKKEV-LRQSIRPRHVFMISMATGIGTGLLVGN 67

Query: 69  STPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIP-VTSSFTVFTQRFLSPALGSAN 127
              ++ AG  G LI Y  IG +     QS+GE+    P ++  F  + +RF+ P+LG + 
Sbjct: 68  GKSIACAGIGGTLIGYGIIGVMLVCCMQSVGELVVAFPSLSGGFNSYGKRFIDPSLGFSV 127

Query: 128 GYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFW 187
            +L+ L W I   LEL      I++W  ++  + ++++F+ ++ + N F    Y E EF 
Sbjct: 128 SWLFCLQWMIVLPLELVTGSMTIKYWNASLSPSLFVSVFYALICVVNSFGSGGYAEAEFI 187

Query: 188 IACIKVLAIVGFIIYAFIMVCGA-GKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVS 246
              +KV+ I+GFII   ++  G  G +G +GFRY  +PG +       + N         
Sbjct: 188 FNSLKVVVIIGFIILGVLIDTGCVGTSGTIGFRYLIDPGMF-------NKNYNIIKATAG 240

Query: 247 SLISAAFTYQGTELVGITAGEAA--NPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXN 304
           +L++AAF+  G E + ++A E    N  K++ RA N+V                     N
Sbjct: 241 TLVNAAFSCGGVEFLALSAAEQNRDNMPKSIGRACNQVSIRIFVFYLLSISVVGLLVPHN 300

Query: 305 DPKLK-SEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMA 363
            P L  S  + I SSP+V A+  +G  V+PHI NAVIL  +IS  NS +Y  SR  +S+A
Sbjct: 301 SPILMGSGSNMIHSSPYVAAVAMNGITVVPHIINAVILIAVISVANSAMYSSSRTLHSLA 360

Query: 364 MNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWI 423
               APKY T   K G P   +  +++ G ++++       A+F WLL+I+ ++  FTW 
Sbjct: 361 EQNFAPKYFTKLNKHGQPMRCLFISALFGLISFVAEYRDQEAIFIWLLSISGLSTIFTWT 420

Query: 424 LISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----- 478
            I I+HIRF  A+K +G S + L +K+     G+Y A              +  P     
Sbjct: 421 TICIAHIRFRDAIKSRGQSLETLGYKSITGVAGSYIATVINLVILVVQFWVSLFPLESNG 480

Query: 479 KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQKPR 537
           K  +  FF  Y++V +  +F+IG +++ +   L I+  ++D+ TD R+I     E+ K +
Sbjct: 481 KPNIVQFFQNYMAVPVALLFYIGHKVYTKNWSLLIRASNVDITTD-RDIYCPTIEDPKIK 539

Query: 538 NLWEK 542
            L + 
Sbjct: 540 VLMQN 544

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,803,591
Number of extensions: 1961839
Number of successful extensions: 6436
Number of sequences better than 10.0: 411
Number of HSP's gapped: 5029
Number of HSP's successfully gapped: 431
Length of query: 548
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 433
Effective length of database: 40,294,809
Effective search space: 17447652297
Effective search space used: 17447652297
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 68 (30.8 bits)