Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0C02640gsingletonON54854825730.0
SAKL0C02662g1.83ON54852623240.0
SAKL0C02684gsingletonON58851419410.0
Smik_5.241.83ON59052218640.0
YEL063C (CAN1)1.83ON59052318460.0
Suva_5.41.83ON59052718390.0
Skud_5.261.83ON59051718380.0
KLTH0F02398g1.83ON55551318230.0
CAGL0J08184g1.83ON57251218110.0
NDAI0A006101.83ON56551418080.0
KLLA0C02343g1.83ON58151618080.0
TPHA0B044801.83ON60351418090.0
KNAG0C007901.83ON57951417980.0
TDEL0C061801.83ON58351417940.0
Kwal_33.134011.83ON55951017790.0
SAKL0C02728g1.84ON56252817560.0
NCAS0B085701.83ON53251317530.0
TPHA0B044701.84ON59952217590.0
NDAI0F042001.83ON56650817390.0
NDAI0F041901.84ON59951117390.0
CAGL0J08162g1.84ON59751217380.0
ZYRO0F16654g1.83ON58051417350.0
Kpol_2000.641.84ON61051117350.0
TBLA0A054601.84ON60851117250.0
NCAS0A006001.83ON54451417170.0
Ecym_10871.83ON57052717180.0
Kpol_2000.651.83ON59551417200.0
TDEL0C061701.84ON57351117150.0
KLTH0F02420g1.84ON62153217190.0
Kwal_33.134111.84ON56051417080.0
YNL268W (LYP1)1.84ON61152617130.0
Smik_14.681.84ON61150817100.0
KNAG0F004801.84ON59751617070.0
Ecym_10881.84ON56751817020.0
KLLA0C02365g1.84ON57951917030.0
Skud_14.711.84ON61251117020.0
KAFR0D007001.83ON57453216970.0
KNAG0C05920singletonON59951216910.0
NCAS0A006101.84ON60751116880.0
TBLA0A054501.83ON60651916850.0
Smik_14.671.83ON57351216800.0
Suva_14.751.84ON61151116820.0
YNL270C (ALP1)1.83ON57352716730.0
Skud_14.701.83ON57350916640.0
KAFR0D039401.83ON59751816630.0
ZYRO0F16632g1.84ON60752216560.0
Suva_14.731.83ON49747916420.0
AFR667C1.84ON56351616460.0
AFR668W1.83ON55650915240.0
SAKL0G14916gna 1ON5815308911e-112
Kpol_358.3na 1ON5755188851e-111
CAGL0A01199gna 1ON6135108881e-111
KAFR0B06430singletonON5935108811e-111
TBLA0A07060na 1ON6255168771e-110
TPHA0H028507.44ON6015378681e-109
Smik_6.473na 1ON6065178671e-108
TPHA0M00130singletonON6115138641e-108
Skud_16.12na 1ON6075318541e-106
KLLA0E16281gna 1ON6055298541e-106
YPL265W (DIP5)na 1ON6085178541e-106
TDEL0H040707.44ON5775298471e-106
Kwal_26.69407.44ON5705418451e-105
Kwal_33.15545na 1ON5765218421e-105
SAKL0F09790gsingletonON5585168401e-105
KNAG0L02460singletonON5885078411e-105
SAKL0B10956g7.44ON5725138381e-104
Suva_16.40na 1ON6065178381e-104
NCAS0D02260na 1ON5975108331e-103
NDAI0I02660na 1ON5945078231e-102
KLTH0D01474g7.44ON6245198231e-102
KNAG0L02470singletonON6385118221e-101
CAGL0E05632g7.44ON5985228181e-101
ZYRO0D03762g1.244ON6005068151e-101
SAKL0G14014g5.158ON6055078151e-101
TDEL0C065101.50ON6425448151e-100
KNAG0E003907.44ON5995298101e-100
AFR156W7.44ON5585328051e-100
TDEL0C00930singletonON5954998071e-100
SAKL0C01232gsingletonON6135238071e-99
KLTH0B01166gna 1ON5775008006e-99
KLLA0A11770g5.158ON5815087929e-98
ZYRO0D17908gna 1ON5184807871e-97
Ecym_80357.44ON5635307864e-97
KLTH0B02046g5.158ON5895337884e-97
Ecym_2480na 1ON5865127876e-97
Kwal_33.154075.158ON5875287842e-96
SAKL0D00836gna 2ON6015237843e-96
Skud_7.5255.158ON6035317843e-96
Ecym_47895.158ON5885017824e-96
KAFR0A011203.284ON5925247808e-96
NDAI0E038007.44ON6215307829e-96
Ecym_60211.244ON6005037791e-95
Kwal_27.126811.244ON5935037781e-95
NDAI0D021605.158ON5875237772e-95
YOR348C (PUT4)7.44ON6275317784e-95
TBLA0C01240singletonON6295107732e-94
KAFR0D005001.50ON6175287723e-94
CAGL0K05753g1.50ON6605107743e-94
Suva_7.4855.158ON6035197694e-94
SAKL0C01650g1.50ON6135237704e-94
Kpol_367.77.44ON5845447684e-94
Smik_15.5327.44ON6315317715e-94
Kpol_2000.921.50ON6375227715e-94
Suva_8.4027.44ON6835317747e-94
Suva_2.6881.50ON6615097711e-93
Smik_3.531.50ON6335077681e-93
YDR508C (GNP1)1.50ON6635097701e-93
TPHA0A002405.158ON6035077642e-93
KLTH0E15642g1.244ON5965167633e-93
Smik_16.1155.158ON6035067634e-93
Smik_4.7901.50ON6635097674e-93
KAFR0D00520na 3ON5985117616e-93
Kwal_33.14276na 2ON5965107582e-92
Skud_3.381.50ON6335077602e-92
Skud_4.7841.50ON6635237632e-92
CAGL0B01012g1.50ON6235087592e-92
Ecym_10561.50ON6065227582e-92
YCL025C (AGP1)1.50ON6335077593e-92
NDAI0G060301.368ON5995267563e-92
KNAG0C02140singletonON5985037564e-92
YGR191W (HIP1)5.158ON6035147555e-92
NCAS0A071105.158ON5925127546e-92
KAFR0E018505.158ON5605197509e-92
AGR319W5.158ON6265297551e-91
KLTH0F04048gsingletonON5835217511e-91
Suva_2.716singletonON6035227512e-91
TPHA0B010901.244ON6065037512e-91
Suva_3.1891.50ON6335117524e-91
CAGL0B03773g5.158ON6054997494e-91
Ecym_26643.285ON5755217465e-91
Skud_15.5157.44ON6265277497e-91
TDEL0A08030singletonON5145017408e-91
KAFR0D00510na 4ON6175457488e-91
AFR230C1.244ON6045057478e-91
YBR068C (BAP2)3.284ON6095177479e-91
Skud_11.2751.244ON6025037461e-90
KAFR0C051607.44ON5845197432e-90
KLTH0F01584g1.50ON5965237432e-90
TPHA0E036601.50ON6475027464e-90
NDAI0A006401.50ON6415007454e-90
Kpol_1010.325.158ON5995077416e-90
NCAS0B085801.50ON6275067436e-90
NCAS0D018705.158ON5955147398e-90
Suva_4.3073.284ON6095137391e-89
Kwal_33.132041.50ON6075177392e-89
NDAI0B052201.244ON6115137373e-89
SAKL0D04664g1.244ON5934967363e-89
KLLA0F23419g7.44ON5735237343e-89
NCAS0A089201.368ON5995267363e-89
YKR039W (GAP1)1.244ON6025227339e-89
Kwal_23.4026singletonON5344767271e-88
NDAI0C029505.158ON6095137303e-88
Smik_2.2013.284ON6095097303e-88
AFR698C1.50ON6095107303e-88
KNAG0H011503.284ON6175117286e-88
Kpol_543.78singletonON6055067277e-88
KNAG0G009005.158ON6135027252e-87
KAFR0D04120na 3ON6485087272e-87
ACL135Wna 1ON5885127232e-87
KAFR0C004003.284ON5825207213e-87
TBLA0C012101.368ON6005267215e-87
NDAI0A056203.284ON5715137196e-87
CAGL0L03267g1.244ON5975407206e-87
Skud_2.1913.284ON6095177207e-87
Kpol_543.791.244ON6055167191e-86
NCAS0E022607.44ON5935497172e-86
AGR038C3.284ON5805217144e-86
AGR040C3.285ON5735237125e-86
YOL020W (TAT2)1.368ON5925267145e-86
Suva_2.2033.284ON6045097145e-86
Smik_13.1singletonON5235057087e-86
SAKL0D02970g3.284ON6015297138e-86
Skud_15.1381.368ON5925267128e-86
Suva_11.2731.244ON6015037129e-86
TPHA0A047005.158ON5695047101e-85
KLLA0A06886gsingletonON5875007111e-85
CAGL0D02178g1.368ON5775227091e-85
NCAS0A106803.284ON5935307102e-85
SAKL0C13992gsingletonON5525037072e-85
TDEL0F02830na 5ON5615217072e-85
TBLA0A05190na 3ON6675087152e-85
Kwal_26.9612singletonON5435027062e-85
Kpol_534.221.368ON5925137092e-85
KLLA0C01606g1.50ON6205157113e-85
KLLA0B14685gna 6ON5715467047e-85
KLTH0B00154gna 7ON5565287038e-85
YDR046C (BAP3)3.284ON6045097068e-85
CAGL0H08393g3.284ON6125247079e-85
KNAG0J022103.285ON5815107022e-84
Kpol_2002.441.50ON6275117052e-84
Kwal_8.590na 7ON6295257052e-84
KLTH0H13398g1.368ON5875137022e-84
SAKL0D02948gna 8ON5945087023e-84
AEL030W1.368ON5825267004e-84
KLTH0C05170g3.284ON5985137014e-84
Suva_15.1481.368ON5925267005e-84
TBLA0B077605.158ON6585317046e-84
NCAS0A004201.50ON6795127056e-84
Smik_4.2843.284ON6045096998e-84
SAKL0D02926g3.285ON5835266971e-83
KNAG0J022003.284ON6075076991e-83
NCAS0B079001.244ON6195016991e-83
Ecym_27161.368ON5925266952e-83
Smik_15.1461.368ON5935266953e-83
ZYRO0F17446g1.50ON6335106983e-83
KLTH0F01606gna 3ON6045346946e-83
Skud_6.2na 9ON5585036906e-83
ZYRO0G12342g3.284ON6205146947e-83
KLLA0A10813g1.368ON5845136901e-82
Kwal_23.2817na 6ON5805386901e-82
TDEL0E05750singletonON5485116835e-82
Ecym_26623.284ON5895116865e-82
KAFR0D041401.50ON6375086895e-82
Smik_11.3021.244ON5534756836e-82
TBLA0A051801.50ON6765136917e-82
ZYRO0A00308gsingletonON5644946838e-82
TPHA0A025001.368ON5905266831e-81
Skud_4.3003.284ON6045096823e-81
TDEL0D00200singletonON5675416784e-81
YFL055W (AGP3)na 9ON5585016775e-81
AGR039Cna 8ON5865236761e-80
SAKL0F16544gsingletonON5675356751e-80
ZYRO0G07172gna 5ON5674996723e-80
NCAS0I015303.284ON5955076736e-80
Ecym_2663na 8ON5894986726e-80
KNAG0F002701.50ON6345266757e-80
Kpol_1065.133.284ON5965276711e-79
Smik_6.482na 10ON5585356681e-79
KLLA0A06930g1.244ON5875006692e-79
Sklu_YGOB_Anc_1.3681.368ON5414416652e-79
NDAI0A074903.284ON5965096683e-79
KLLA0F27093gsingletonON5634906654e-79
NDAI0F043901.50ON6675006714e-79
Smik_2.2023.285ON6175286675e-79
TBLA0G031203.284ON6735196707e-79
TBLA0I020103.285ON6284956661e-78
TPHA0B047501.50ON6395146652e-78
Kwal_27.105383.284ON6025046613e-78
Suva_13.517singletonON5475276574e-78
Suva_4.3083.285ON6185356614e-78
CAGL0L07546g3.284ON6345106625e-78
CAGL0M00154gsingletonON5505236566e-78
KAFR0F02250singletonON5545166566e-78
Kwal_33.13215na 3ON5985066596e-78
ZYRO0C18502g7.44ON5755116569e-78
Kwal_34.16254singletonOFF4814286481e-77
TDEL0C053403.397ON5755216542e-77
NDAI0A01340singletonON5545206532e-77
Kwal_YGOB_34.162541.368ON4914286482e-77
NCAS0J00140na 9ON5585086522e-77
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0C02640g
         (548 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   995   0.0  
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   899   0.0  
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   752   0.0  
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   722   0.0  
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   715   0.0  
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   712   0.0  
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   712   0.0  
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   706   0.0  
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   702   0.0  
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   701   0.0  
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   701   0.0  
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   701   0.0  
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              697   0.0  
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   695   0.0  
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   689   0.0  
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   681   0.0  
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            679   0.0  
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   682   0.0  
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            674   0.0  
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   674   0.0  
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   674   0.0  
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   672   0.0  
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   672   0.0  
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   669   0.0  
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   665   0.0  
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   666   0.0  
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   667   0.0  
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   665   0.0  
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   666   0.0  
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   662   0.0  
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   664   0.0  
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   663   0.0  
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                662   0.0  
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   660   0.0  
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   660   0.0  
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   660   0.0  
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   658   0.0  
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            655   0.0  
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              654   0.0  
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   653   0.0  
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   651   0.0  
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   652   0.0  
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   649   0.0  
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   645   0.0  
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   645   0.0  
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   642   0.0  
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   637   0.0  
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   638   0.0  
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   591   0.0  
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   347   e-112
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   345   e-111
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   346   e-111
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   343   e-111
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   342   e-110
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   338   e-109
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   338   e-108
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     337   e-108
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   333   e-106
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   333   e-106
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   333   e-106
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   330   e-106
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   330   e-105
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   328   e-105
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   328   e-105
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             328   e-105
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   327   e-104
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   327   e-104
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              325   e-103
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   321   e-102
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   321   e-102
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             321   e-101
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   319   e-101
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   318   e-101
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   318   e-101
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   318   e-100
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   316   e-100
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   314   e-100
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   315   e-100
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   315   1e-99
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   312   6e-99
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   309   9e-98
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   307   1e-97
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   307   4e-97
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   308   4e-97
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   307   6e-97
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   306   2e-96
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   306   3e-96
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   306   3e-96
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   305   4e-96
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   305   8e-96
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     305   9e-96
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   304   1e-95
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   304   1e-95
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    303   2e-95
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   304   4e-95
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   302   2e-94
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      301   3e-94
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   302   3e-94
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   300   4e-94
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   301   4e-94
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   300   4e-94
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   301   5e-94
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   301   5e-94
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   302   7e-94
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   301   1e-93
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   300   1e-93
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   301   1e-93
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   298   2e-93
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   298   3e-93
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   298   4e-93
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   300   4e-93
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   297   6e-93
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   296   2e-92
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   297   2e-92
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   298   2e-92
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   296   2e-92
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   296   2e-92
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   296   3e-92
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   295   3e-92
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   295   4e-92
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   295   5e-92
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   295   6e-92
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   293   9e-92
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   295   1e-91
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   293   1e-91
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   293   2e-91
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   293   2e-91
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   294   4e-91
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   293   4e-91
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   291   5e-91
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   293   7e-91
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            289   8e-91
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      292   8e-91
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   292   8e-91
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   292   9e-91
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   291   1e-90
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   290   2e-90
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   290   2e-90
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   291   4e-90
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   291   4e-90
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   290   6e-90
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   290   6e-90
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   289   8e-90
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   289   1e-89
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   289   2e-89
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   288   3e-89
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   288   3e-89
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   287   3e-89
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   288   3e-89
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   286   9e-89
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   284   1e-88
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    285   3e-88
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   285   3e-88
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   285   3e-88
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              285   6e-88
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   284   7e-88
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   283   2e-87
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   284   2e-87
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   283   2e-87
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                282   3e-87
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   282   5e-87
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            281   6e-87
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   281   6e-87
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   281   7e-87
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   281   1e-86
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     280   2e-86
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   279   4e-86
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   278   5e-86
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   279   5e-86
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   279   5e-86
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    277   7e-86
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   279   8e-86
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   278   8e-86
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   278   9e-86
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   278   1e-85
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   278   1e-85
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   277   1e-85
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   278   2e-85
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   276   2e-85
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   276   2e-85
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   280   2e-85
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   276   2e-85
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   277   2e-85
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   278   3e-85
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   275   7e-85
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   275   8e-85
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   276   8e-85
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   276   9e-85
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   275   2e-84
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   276   2e-84
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   276   2e-84
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   275   2e-84
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   275   3e-84
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   274   4e-84
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   274   4e-84
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   274   5e-84
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   275   6e-84
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   276   6e-84
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   273   8e-84
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   273   1e-83
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   273   1e-83
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   273   1e-83
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   272   2e-83
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   272   3e-83
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   273   3e-83
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   271   6e-83
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      270   6e-83
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   271   7e-83
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   270   1e-82
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   270   1e-82
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            267   5e-82
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   268   5e-82
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              270   5e-82
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   267   6e-82
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   270   7e-82
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   267   8e-82
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   267   1e-81
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   267   3e-81
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                265   4e-81
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   265   5e-81
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   265   1e-80
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   264   1e-80
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   263   3e-80
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              263   6e-80
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   263   6e-80
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   264   7e-80
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   263   1e-79
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   261   1e-79
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   262   2e-79
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   260   2e-79
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   261   3e-79
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   260   4e-79
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   263   4e-79
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   261   5e-79
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              262   7e-79
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   261   1e-78
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   260   2e-78
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   259   3e-78
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   257   4e-78
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   259   4e-78
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   259   5e-78
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   257   6e-78
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              257   6e-78
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   258   6e-78
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   257   9e-78
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   254   1e-77
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   256   2e-77
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              256   2e-77
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   254   2e-77
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      255   2e-77
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   254   2e-76
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   252   4e-76
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   251   4e-76
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   253   6e-76
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              254   7e-76
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   252   1e-75
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   249   3e-75
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   250   3e-75
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              251   6e-75
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   246   2e-74
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   247   1e-73
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   245   2e-73
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   243   5e-73
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   243   2e-72
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   243   2e-72
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   243   2e-72
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   243   2e-72
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              243   4e-72
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   241   6e-72
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              241   9e-72
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   241   1e-71
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   241   2e-71
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   240   3e-71
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   239   4e-71
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   239   6e-71
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   238   1e-70
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   238   2e-70
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   241   4e-70
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   236   4e-70
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   237   6e-70
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   236   1e-69
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   237   2e-69
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   233   2e-68
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   233   2e-68
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   232   2e-68
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   231   5e-68
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   229   2e-67
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   229   3e-67
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   229   5e-67
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   229   6e-67
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      228   1e-66
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   228   2e-66
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   227   3e-66
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    226   4e-66
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                226   6e-66
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   225   9e-66
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   225   2e-65
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   224   2e-65
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   223   6e-65
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   219   2e-64
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   221   4e-64
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   220   6e-64
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   223   2e-63
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   223   5e-63
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   217   1e-62
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   216   2e-62
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   216   2e-62
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                216   4e-62
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   215   7e-62
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   217   4e-61
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   216   8e-61
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   215   2e-60
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   215   2e-60
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   211   3e-60
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   209   4e-60
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   210   4e-60
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   213   8e-60
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   206   5e-59
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   207   2e-57
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   206   3e-57
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   202   4e-57
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   202   4e-57
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   205   7e-57
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   205   1e-56
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   204   3e-56
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   203   4e-56
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   199   7e-56
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   202   8e-56
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   202   2e-55
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   198   2e-54
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   191   2e-53
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   190   6e-53
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   193   1e-52
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   192   2e-52
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     175   2e-49
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     175   3e-49
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   181   1e-48
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)         115   7e-29
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         117   1e-28
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)     112   3e-27
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)    113   1e-26
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   107   7e-26
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    87   3e-19
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      80   5e-17
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      74   2e-15
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    67   5e-12
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          62   2e-10
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              57   5e-09
TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.1...    46   2e-04
NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON} Anc_1...    44   8e-04
SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {...    44   0.001
KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {...    41   0.006
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    41   0.009
Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {O...    40   0.020
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    40   0.021
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    38   0.072
Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {O...    37   0.11 
TBLA0C05740 Chr3 complement(1391698..1393677) [1980 bp, 659 aa] ...    36   0.21 
Smik_11.55 Chr11 complement(105857..107716) [1860 bp, 619 aa] {O...    36   0.23 
Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {...    36   0.26 
ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} simi...    35   0.52 
NDAI0A00890 Chr1 complement(181903..183828) [1926 bp, 641 aa] {O...    35   0.53 
ZYRO0F00242g Chr6 (26301..27908) [1608 bp, 535 aa] {ON} similar ...    34   0.84 
KAFR0G00390 Chr7 complement(115188..117011) [1824 bp, 607 aa] {O...    34   0.89 
KLLA0A06666g Chr1 complement(603169..604851) [1683 bp, 560 aa] {...    33   1.7  
TPHA0E02920 Chr5 (612901..614661) [1761 bp, 586 aa] {ON} Anc_6.2...    33   2.8  
YGL077C Chr7 complement(362225..363916) [1692 bp, 563 aa] {ON}  ...    32   5.1  
AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON} S...    32   5.4  
Skud_7.205 Chr7 complement(365478..367166) [1689 bp, 562 aa] {ON...    32   6.6  
Kpol_2002.70 s2002 complement(159457..161325) [1869 bp, 622 aa] ...    32   7.1  
Suva_7.193 Chr7 complement(355063..356754) [1692 bp, 563 aa] {ON...    31   7.6  

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  995 bits (2573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/548 (91%), Positives = 501/548 (91%)

Query: 1   MSAQQHHXXXXXXXXXXXXXXFSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTI 60
           MSAQQHH              FSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTI
Sbjct: 1   MSAQQHHSSEKEKNSEELVSEFSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTI 60

Query: 61  GTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLS 120
           GTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLS
Sbjct: 61  GTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLS 120

Query: 121 PALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKF 180
           PALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKF
Sbjct: 121 PALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKF 180

Query: 181 YGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGR 240
           YGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGR
Sbjct: 181 YGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGR 240

Query: 241 FLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXX 300
           FLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKV                  
Sbjct: 241 FLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLL 300

Query: 301 XXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLY 360
              NDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLY
Sbjct: 301 VPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLY 360

Query: 361 SMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFF 420
           SMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFF
Sbjct: 361 SMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFF 420

Query: 421 AWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF 480
           AWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAA            TAFAPKF
Sbjct: 421 AWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAPKF 480

Query: 481 NVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDIDLDTDRREIDNDVWEEDEPKNLW 540
           NVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDIDLDTDRREIDNDVWEEDEPKNLW
Sbjct: 481 NVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDIDLDTDRREIDNDVWEEDEPKNLW 540

Query: 541 EKFWSAVA 548
           EKFWSAVA
Sbjct: 541 EKFWSAVA 548

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  899 bits (2324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/526 (84%), Positives = 472/526 (89%)

Query: 23  SRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALI 82
           S ++D VS+ESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALI
Sbjct: 23  SIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALI 82

Query: 83  AYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALE 142
           AYMFIGTLAY V+QSLGEMATFIPVTSSF VFTQRFLSPALG+ANGY+Y+LSW+ITFALE
Sbjct: 83  AYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALE 142

Query: 143 LSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIY 202
           LSVVGQ+IQFWTDAVPLTAWI I WV+L  +NL PVK+YGEVEFWIACIKVLAIVGFIIY
Sbjct: 143 LSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIY 202

Query: 203 AFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVG 262
           AFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVG
Sbjct: 203 AFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVG 262

Query: 263 ITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVI 322
           ITAGEAANPRKTVPRAINKV                     NDPKLKSEDSYISSSPFVI
Sbjct: 263 ITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYISSSPFVI 322

Query: 323 AIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPY 382
           AIENSGTKVLPHIFNAVILSTIISAGNS+VY+ SR+ YSM +NGLAPKYLTWTTKSGIPY
Sbjct: 323 AIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPY 382

Query: 383 AAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGIS 442
           AAVLTTS++GFLAYLESS GAS VF+WLLNITAVAGFF W+LIS++HIRFMQALKHQGIS
Sbjct: 383 AAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGIS 442

Query: 443 RDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGF 502
           RDDLPFKAKFMPWGAYYAA            TAFAPKF VSDFFTAY+SV+LFF  WIGF
Sbjct: 443 RDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAPKFKVSDFFTAYISVMLFFVFWIGF 502

Query: 503 QIWFRGPLFKKTEDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           QIWFRGPLF KTEDIDLDTDRREID+ VWEE +P+NLWEKFW+A+A
Sbjct: 503 QIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/514 (73%), Positives = 425/514 (82%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G+V++ +VKRALKPRHISMIALGGTIGTGLFI IS+PL++AGPVGALIAYMF+GT+AY V
Sbjct: 75  GNVQDAEVKRALKPRHISMIALGGTIGTGLFIGISSPLADAGPVGALIAYMFMGTIAYFV 134

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
           +QSLGEMATFIPVTSSF VFTQRFLSPA G ANGY+Y+ SW ITFALELSVVGQ+IQFWT
Sbjct: 135 TQSLGEMATFIPVTSSFTVFTQRFLSPAFGVANGYLYWFSWCITFALELSVVGQIIQFWT 194

Query: 155 DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
            AVPL AWI I WV+L ++NL PVK+YGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG
Sbjct: 195 FAVPLGAWIAIFWVILTTSNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 254

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
           PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLI+AAFTYQGTELVGITAGE+ NPR+T
Sbjct: 255 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGESKNPRRT 314

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           VPRAINKV                     NDPKLKSEDSYISSSPFVIAIENSGTKVLPH
Sbjct: 315 VPRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 374

Query: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394
           IFNAVILSTIISAGNS++Y+ SRVLY +  N LAPK     TK G+PY +VL T+  GFL
Sbjct: 375 IFNAVILSTIISAGNSNIYVGSRVLYGLAKNKLAPKVFARATKDGVPYISVLGTAAFGFL 434

Query: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454
           AYL  S+ A  VFDWLLNITA+AGFFAW+ IS+AHIRFMQ LK + +SR+DLPFKAKFMP
Sbjct: 435 AYLNLSNSAQKVFDWLLNITAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLPFKAKFMP 494

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKT 514
           WGAYY+A            TAFAPKFNVS+FF AY+SV LF A+W+ FQI FR       
Sbjct: 495 WGAYYSAFFISLIIIIQGFTAFAPKFNVSNFFAAYISVFLFLAIWVVFQIRFRTRFILTK 554

Query: 515 EDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
            D+D+DTDRR+ID  VWEE+ PKN W+KFW+A+A
Sbjct: 555 NDVDIDTDRRDIDCIVWEEETPKNAWDKFWAAMA 588

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/522 (67%), Positives = 412/522 (78%)

Query: 27  DVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMF 86
           DV+  E  G V+  +VKR LK RHI MIALGGTIGTGLFI +S PL+NAGPVGALI+Y+F
Sbjct: 69  DVIRDEDQGEVRNAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLF 128

Query: 87  IGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVV 146
           +G+LAY V+QSLGEMATFIPVTSSF VF+QRFLSPA GAANGYMY+ SW+ITFALELSVV
Sbjct: 129 MGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVV 188

Query: 147 GQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIM 206
           GQVI+FWT+ VPL AWI I WV++   NL PVK+YGE EFW+A IKVLAI+GF+IY F M
Sbjct: 189 GQVIEFWTNKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCM 248

Query: 207 VCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAG 266
           VCGAG TGPVGFRYWRNPG WGPGIISKD NEGRFLGWVSSLI+AAFT+QGTELVGITAG
Sbjct: 249 VCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAG 308

Query: 267 EAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIEN 326
           EAANPRKTVPRAI KV                     NDPKL +  SY+S SPF+IAIEN
Sbjct: 309 EAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTTATSYVSVSPFIIAIEN 368

Query: 327 SGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVL 386
           SGTKVLPHIFNAVIL+TIISA NS++Y+ SR+L+ +  N LAPK+L+ TTK G+PY AV 
Sbjct: 369 SGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVF 428

Query: 387 TTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDL 446
            T++ G LAY+E+S G   VF+WLLNIT VAGFFAW+LIS++HIRFMQALK++GISRD+L
Sbjct: 429 ITAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDEL 488

Query: 447 PFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWF 506
           PFKAK MP  AY+AA            TAFAPKF+  DF  AY+S+ LF A+WI F+I F
Sbjct: 489 PFKAKLMPGLAYFAATFMIIIILIQGFTAFAPKFDGIDFLAAYISIFLFLAIWILFEIIF 548

Query: 507 RGPLFKKTEDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           R     K ED+D+D+DRR+I+  VWE+ EPK  W+KFW+ VA
Sbjct: 549 RCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/523 (67%), Positives = 407/523 (77%)

Query: 26  KDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYM 85
           +D +  E  G V+  +VKR LK RHI MIALGGTIGTGLFI +STPL+NAGPVGALI+Y+
Sbjct: 68  EDGIGDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYL 127

Query: 86  FIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSV 145
           F+G+LAY V+QSLGEMATFIPVTSSF VF+QRFLSPA GAANGYMY+ SW+ITFALELSV
Sbjct: 128 FMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSV 187

Query: 146 VGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFI 205
           VGQVIQFWT  VPL AWI I WV++   NL PVK+YGE EFW+A IKVLAI+GF+IY F 
Sbjct: 188 VGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFC 247

Query: 206 MVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITA 265
           MVCGAG TGPVGFRYWRNPG WGPGIISKD NEGRFLGWVSSLI+AAFT+QGTELVGITA
Sbjct: 248 MVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITA 307

Query: 266 GEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIE 325
           GEAANPRK+VPRAI KV                     NDPKL    SY+S+SPF+IAIE
Sbjct: 308 GEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIE 367

Query: 326 NSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAV 385
           NSGTKVLPHIFNAVIL+TIISA NS++Y+ SR+L+ +  N LAPK+L+ TTK G+PY AV
Sbjct: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAV 427

Query: 386 LTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDD 445
             T+  G LAY+E+S G   VF+WLLNIT VAGFFAW+ IS++HIRFMQALK++GISRD+
Sbjct: 428 FVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDE 487

Query: 446 LPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIW 505
           LPFKAK MP  AYYAA            TAFAPKFN   F  AY+S+ LF AVWI FQ  
Sbjct: 488 LPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCI 547

Query: 506 FRGPLFKKTEDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           FR     K  D+D+D+DRR+I+  VWE+ EPK  W+KFW+ VA
Sbjct: 548 FRCRFIWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/527 (66%), Positives = 410/527 (77%), Gaps = 1/527 (0%)

Query: 22  FSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGAL 81
           FS  +D+   E  G V+  +VKR LK RHI MIALGGTIGTGLFI +STPL+NAGPVGAL
Sbjct: 65  FSMEEDIQD-EDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGAL 123

Query: 82  IAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFAL 141
           I+Y+F+G+LAY V+QSLGEMATFIPVTSSF VF+QRFLSPA GAANGYMY+ SW++TFAL
Sbjct: 124 ISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFAL 183

Query: 142 ELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFII 201
           ELSVVGQVIQFWT AVPL AWI I WV++ + N+ PVK+YGE EFW+A IKV+AI+GF+I
Sbjct: 184 ELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLI 243

Query: 202 YAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELV 261
           Y F MVCGAG TGPVGFRYWRNPG WGPGIISK+ NE RFLGWVSSLI+AAFT+QGTELV
Sbjct: 244 YCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELV 303

Query: 262 GITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFV 321
           GITAGEAANPRKTVPRAI KV                     NDPKL S  SY+S+SPF+
Sbjct: 304 GITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFI 363

Query: 322 IAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIP 381
           IAIENSGTKVLPHIFNAVIL+TIISA NS++Y+ SRVL+ +  + LAPK+ + TTK G+P
Sbjct: 364 IAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVP 423

Query: 382 YAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGI 441
           Y AV  TS+ G LAY+E+S G   VF WLLNIT VAGFFAW+ ISV+HIRFMQALK++GI
Sbjct: 424 YIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGI 483

Query: 442 SRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIG 501
           SRD+LPFKAK MP  AYYA             T+F P FN  +F  AY+SV LF A+WI 
Sbjct: 484 SRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWIL 543

Query: 502 FQIWFRGPLFKKTEDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           F++ FR     K ED+D+D+DRR+I+  VWEE EPK LW+KFW+ V 
Sbjct: 544 FELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/517 (66%), Positives = 407/517 (78%)

Query: 32  ESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLA 91
           E  G V+  +VKR LK RHI MIALGGTIGTGLFI +STPL+NAGPVGALIAY+F+G+LA
Sbjct: 74  EDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGALIAYLFMGSLA 133

Query: 92  YMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQ 151
           + V+QSLGEMATFIPVTSSF VF+QRFLSPA GAANGYMY+ SW+ITFALELSVVGQVIQ
Sbjct: 134 FSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQ 193

Query: 152 FWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG 211
           FWT  VPL AWI I WV++   NL PVK+YGE EFW+A IKV+AI+GF+IY F MVCGAG
Sbjct: 194 FWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAG 253

Query: 212 KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271
            TGPVGFRYWRNPG WGPGIISK+ NEGRFLGWVSSLI+AAFT+QGTELVGITAGEAANP
Sbjct: 254 VTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANP 313

Query: 272 RKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKV 331
           RKTVPRAI KV                     NDPKL    SY+S+SPF++AI+NSGTKV
Sbjct: 314 RKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKV 373

Query: 332 LPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLV 391
           LPHIFNAVIL+TIISA NS++Y+ SR+L+ +  N LAPK+L+ T+K G+PY AV  T++ 
Sbjct: 374 LPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVF 433

Query: 392 GFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAK 451
           G LAY+E+S G   VF+WLLNIT VAGFFAW+ IS++HIRFMQALK++GISRD+LPFKAK
Sbjct: 434 GALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAK 493

Query: 452 FMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLF 511
            MP  AYY++            TAFAPKFN S F  AY+S+ LF AVWI F+  FR    
Sbjct: 494 LMPGLAYYSSFFMIIIIIIQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFI 553

Query: 512 KKTEDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
            K ED+D+D+DRR+I+  VWE+ EPK  W+KFW+ VA
Sbjct: 554 WKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  706 bits (1823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/513 (66%), Positives = 403/513 (78%)

Query: 36  SVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVS 95
           S +E  ++RALKPRH+SMIALGGTIGTGLF+ I+ PL +AGPVG+LI+Y+F+G+LA+ V+
Sbjct: 43  SSQERGIQRALKPRHVSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVT 102

Query: 96  QSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTD 155
           QSLGEMATFIPV SSF VFT+RFLSPALGAANGYMY  SW ITFALELS+VG++IQ+WT 
Sbjct: 103 QSLGEMATFIPVASSFTVFTRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYWTL 162

Query: 156 AVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGP 215
            VP  AWIII WV +  +NL  VKFYGE +FWIA IKV+AIVGF+IY   MVCGAGKTGP
Sbjct: 163 GVPNAAWIIIFWVPISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVCGAGKTGP 222

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           VGFRYWRNPGPWG GIISK  +EGRFLGWVSSL++AAFTYQGTELVG++AGE+ANPRKTV
Sbjct: 223 VGFRYWRNPGPWGDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANPRKTV 282

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHI 335
           P+AI KV                     NDPKL S  +Y +SSPF+IAI+NSGT+ LP I
Sbjct: 283 PKAIRKVFLRILLFYVGSLFFIGLLVPFNDPKLDSTANYSASSPFIIAIQNSGTRALPDI 342

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
           FNAVIL+TIISA NS+VY+ SRVLY +   GLAPK +    + G+PY  V   SL GFL 
Sbjct: 343 FNAVILTTIISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLFGFLG 402

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           YL  S G++  FDWLLNITA+AGFFAW+ IS+ HIRFMQALK+QGISRDDLPFKAK MPW
Sbjct: 403 YLSVSSGSAKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAKLMPW 462

Query: 456 GAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTE 515
           GAYYAA            TAFAPKFNVS+FF AYVSV LF AVW+ FQ+ F+  L  K E
Sbjct: 463 GAYYAAFFILLIIIIQGFTAFAPKFNVSNFFAAYVSVFLFIAVWVIFQVIFKSRLIHKVE 522

Query: 516 DIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           D+D+D+DRREI+ +VWE+DEP NLW KFW+A+A
Sbjct: 523 DVDIDSDRREIEAEVWEDDEPTNLWGKFWAAMA 555

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/512 (66%), Positives = 400/512 (78%)

Query: 37  VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQ 96
           ++   VKR+LK RHI MIALGGTIGTGLFI I+TPL+NAGPVGAL+AY+F+GT+ + V+Q
Sbjct: 61  LEHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQ 120

Query: 97  SLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
           SLGEMATFIPVTSSF VF QRFLSPALGAANGYMYFLSW  TFALELSVVGQ+IQFWT  
Sbjct: 121 SLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK 180

Query: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPV 216
           VPL AWI I WV+L + N+ PVKFYGE EFWIA IKVLA++GF+IY+  +VCGAGKTGP+
Sbjct: 181 VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPI 240

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           GFRYWRNPG  GPGIIS +  E RFLGWVSSLI+AAFTYQGTELVGITAGEAANPRK VP
Sbjct: 241 GFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP 300

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIF 336
           RAI KV                     NDPKL S DSY+SSSPF+I I+N+GT+VLPHIF
Sbjct: 301 RAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIF 360

Query: 337 NAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAY 396
           NAVIL+TIISAGNS+VY+ SR+L+SM  NGLAPK+L  TT  G+PY +VL  S  G L+Y
Sbjct: 361 NAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSY 420

Query: 397 LESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWG 456
           +E S G +  F+WLLNIT VAGFFAW+LIS +H+RFMQALKH+GISRDDLP+KA +MPW 
Sbjct: 421 MELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWL 480

Query: 457 AYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTED 516
           AYYA             T+FAP F+  DF  AY+SV LF   W  FQI+FR  +  K ED
Sbjct: 481 AYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLED 540

Query: 517 IDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           +D+DTDRREI++ VWE+D PK LW+KFW  VA
Sbjct: 541 VDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/514 (64%), Positives = 406/514 (78%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G ++E +VKR LK RHI MIALGGTIGTGLFI +STPL+NAGPVGALIAY+F+GTL Y V
Sbjct: 52  GQIREAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIAYLFMGTLVYSV 111

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
           +QSLGEMATFIPVTSSF VF+QRFLSP+ GAANGYMY+ SW+ITFALELSVVGQ+IQFWT
Sbjct: 112 TQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWT 171

Query: 155 DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
            AVP+ AWI I WV+LV+ N+ PV+FYGE EFW+A IKVLAI+GF+IY   MVCGAG TG
Sbjct: 172 SAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTG 231

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
           PVGFRYWRNPGP GPGII+K++NE +FLGWVSSLI+AAFTYQGTELVGITAGEAANPRK+
Sbjct: 232 PVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 291

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           VPRAI KV                     NDPKL S+DSY+++SPF+I+I+NSGT +LPH
Sbjct: 292 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPH 351

Query: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394
           IFNAVILSTIISA NS+VY+ SR+++ +  + LAP+ L+ T K+G+P+ +V+ T L G L
Sbjct: 352 IFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGAL 411

Query: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454
           AY+E+S G    F+WLLNIT VAGFF+W+ IS++H+RFMQAL+++GISRDDLPFKAKFMP
Sbjct: 412 AYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMP 471

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKT 514
             AYYA             T+F P F+  DF  AY+S  LF A+WI FQ+WFR  L  K 
Sbjct: 472 GLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKI 531

Query: 515 EDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           ED+D+DTDRR+I+  VWE+  P   W+KFW+ VA
Sbjct: 532 EDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/516 (68%), Positives = 413/516 (80%), Gaps = 2/516 (0%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           GS+ + +VKRALKPRH+SMIALGGTIGTGLFISIS PL NAGPVG+LIA+M IGTLAY V
Sbjct: 66  GSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSV 125

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
           +QSLGEMATFIPVTSSF VF+QRF+SPA+GAANGYMY+ SW+ITFALELS+VGQ+IQ+WT
Sbjct: 126 TQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWT 185

Query: 155 DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
           DAVPL AWI I WV+LVS N+ PVK+YGE EFW+A IKV+AI+GF+IY+  MVCGAG  G
Sbjct: 186 DAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEG 245

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
           P+GFRYWR PGPWG GII+K+VN+ RFLGWVSSLISAAFTYQGTELVGITAGE  NPRK 
Sbjct: 246 PIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKA 305

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSED--SYISSSPFVIAIENSGTKVL 332
           VPRAINKV                     NDPKL+  D  SYI+ SPF+IAI N  T VL
Sbjct: 306 VPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVL 365

Query: 333 PHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVG 392
           PHIFNAVIL+TIISAGNS+VY+ SR+L+ +  N LAPK+ + TTK G+P+ AVL T++ G
Sbjct: 366 PHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFG 425

Query: 393 FLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKF 452
           FLAYL  S+ A  VFDWLLNITA+AGF  W+LIS++HIRFMQ LKH+GISRDDLP+KAKF
Sbjct: 426 FLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKF 485

Query: 453 MPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFK 512
           MP+ AYYAA            TAFAP FNVSDFF AY+SV LFF VW  FQ  +R  LF+
Sbjct: 486 MPYAAYYAAFFITVIIIIQGFTAFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFR 545

Query: 513 KTEDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
             +++D+D+DRR+ID  +WEE+EPKNLWEKFW+  A
Sbjct: 546 TLDEVDIDSDRRDIDVIIWEEEEPKNLWEKFWAVAA 581

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/514 (67%), Positives = 407/514 (79%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G VKE +VKR LK RHI MIALGGTIGTGLFI I+TPL NAGPVGALIAY+F+ T+ + V
Sbjct: 90  GVVKEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFSV 149

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
           +QSLGEMATFIPVTSSF VF+ RFLSPA+GAANGYMY+ SW++TFALELSVVGQ+IQFWT
Sbjct: 150 TQSLGEMATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFWT 209

Query: 155 DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
            AVPL+AWI+I WV+L   NL PVKFYGE EFW+A IKVLAI+GF+IY   MVCGAG TG
Sbjct: 210 HAVPLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVTG 269

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
           PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLI+AAFTYQGTELVGITAGEAANPRKT
Sbjct: 270 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 329

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           VPRAI KV                     +D KL S DSYIS+SPF+IAIENSGTK+LPH
Sbjct: 330 VPRAIKKVTFRILIFYILSLFFIGLLVPYDDEKLTSTDSYISASPFIIAIENSGTKILPH 389

Query: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394
           IFNAVILSTIISAGNS+VY+ SR+L+ +    LAPK+  +T++ G+PY +V  TS  G L
Sbjct: 390 IFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGAL 449

Query: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454
           A+LE S G +  F+WLLNI +VAGFFAW+LIS+AH+RFMQALKH+GISRDDLPFKA+FMP
Sbjct: 450 AFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKARFMP 509

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKT 514
             AYY+             TAFAP FN SDF  AY+S+ LFF +W+ FQ++FR  L    
Sbjct: 510 HLAYYSIFFMTIIIIIQGFTAFAPTFNGSDFVAAYISIFLFFFLWLCFQLYFRSKLLWTV 569

Query: 515 EDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           E++D+DTDRR++D  +WE+  PK  W+KFW  VA
Sbjct: 570 EEVDIDTDRRDVDAIIWEDSGPKTFWDKFWDVVA 603

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/514 (65%), Positives = 399/514 (77%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G V + +VKR LK RHI MIALG TIGTGLFI +STPL  AGPVGALI+Y+F+GTL Y V
Sbjct: 66  GYVHDAEVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSV 125

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
           +QSLGEMATFIPVTSSF VF QRFLSP++GAA GYMY+ SW++TFALELSV+GQVIQ+WT
Sbjct: 126 TQSLGEMATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWT 185

Query: 155 DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
            AVPL AWI I WVV+ + N+ PVK+YGEVEFWIA IKV+AIVGF++Y   MVCGAG TG
Sbjct: 186 YAVPLAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVTG 245

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
           PVGFRYWRNPGPWGPGIISKD NE RFLGWVSSLI+ AFTYQGTELVGI+AGEAANPRK 
Sbjct: 246 PVGFRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKA 305

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           VPRAI KV                     ND  L + DSY++SSPF+IAI+NSGT VLPH
Sbjct: 306 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDDALNNTDSYVASSPFIIAIKNSGTPVLPH 365

Query: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394
           IFNAVI  TI+SAGNS+VY+ SR+L+ +  N LAPK L+ TTK G+P+ AVL TS+VG L
Sbjct: 366 IFNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGAL 425

Query: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454
           AY+E+S G    F+WLLNITAVAGFF W+ IS++HIRFMQALK++GISRDDLPFKA  MP
Sbjct: 426 AYMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALMP 485

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKT 514
             AYYA+            TAFAPKF+ SDF  AY+S+ LF  +W  FQI FR     K 
Sbjct: 486 GLAYYASFLMFVIIIIQGFTAFAPKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFIHKV 545

Query: 515 EDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           ED+D+DTDRR+I+  VWE+ EPK +W+KFW+ +A
Sbjct: 546 EDVDIDTDRRDIEAVVWEDAEPKTVWDKFWNIIA 579

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/514 (68%), Positives = 402/514 (78%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G V E +VKRALK RHI MIALGGTIGTGLFI ISTPLSNAGPVG LIAY+F+ TL Y V
Sbjct: 70  GQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYSV 129

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
            QSLGEMATFIPVTS+F VF+ RFLSPA GAA+GYMY+ SW+ITFALELSVVGQ+I+FWT
Sbjct: 130 VQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWT 189

Query: 155 DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
            AVP+ AWI I WV+L  +NL PVK+YGE EFWIA IKV+A+VGFIIY   MVCGAG TG
Sbjct: 190 TAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITG 249

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
           PVGFRYWRNPG WGPGIISKD NEGRFLGWVSSLI+AAFTYQGTELVGITAGEAANPRK+
Sbjct: 250 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 309

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           VPRAI KV                     NDPKL S DSY+SSSPF+IAIENSGTKVLPH
Sbjct: 310 VPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPH 369

Query: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394
           IFNAV+L+TIISAGNS+VY+ SR++Y +    LAP +   T  +G+PY AV  TS  G L
Sbjct: 370 IFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGAL 429

Query: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454
           AY+E S G +  F+WLLNIT VAGFF W+LIS  HIRFMQALK++GISRDDLPFKAKFMP
Sbjct: 430 AYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMP 489

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKT 514
           W AYYA             TAFAP F+  DF  AYVSV LF A+W+G QIWFR  +F + 
Sbjct: 490 WLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRL 549

Query: 515 EDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           +++D+DTDRR+I+  VW+++ PK LW+KFW+ VA
Sbjct: 550 DEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/510 (64%), Positives = 392/510 (76%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
              V+R LKPRH+SMIALGGTIGTGLFI I +PL NAGPVGALI+Y+F+G++AY V+QSL
Sbjct: 50  RNAVQRQLKPRHVSMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSL 109

Query: 99  GEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVP 158
           GEMATFIPVTSSF VFT+RFLS  LGAANGYMY  SWS+T+ALELS+VGQ+I++WT AVP
Sbjct: 110 GEMATFIPVTSSFTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTSAVP 169

Query: 159 LTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGF 218
             AWI I WV +  +NL PVKFYGE +FWIA IKV+AI+GF++Y   MVCGAGKTGPVGF
Sbjct: 170 NAAWIAIFWVPITLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAGKTGPVGF 229

Query: 219 RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRA 278
           RYWRNPGPWG GIIS D++EGRFLGWVSSL++AAFTYQGTELVGI+AGE+ANPRKTVP+A
Sbjct: 230 RYWRNPGPWGDGIISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTVPKA 289

Query: 279 INKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNA 338
           INKV                     ND KL S DSY + SPF+IAI+NSGTK+LP IFNA
Sbjct: 290 INKVFFRILLFYVGSLFFIGLLVPFNDEKLTSSDSYSAGSPFIIAIQNSGTKILPDIFNA 349

Query: 339 VILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLE 398
           VIL+TIISA NS+VY+ SRVLY +    LAP++   T + G+P  AVL  +  GFL YL 
Sbjct: 350 VILATIISAANSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYLS 409

Query: 399 SSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAY 458
            S+GAS  FDWLLNITA+AGFF+W+ IS+ H+RFMQALK QGISRDDLPFKAK MPWGAY
Sbjct: 410 VSNGASKAFDWLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAY 469

Query: 459 YAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDID 518
           Y+A            T+ AP FNVS+FF AY+SV +F  +W  FQ W+R  +  + E +D
Sbjct: 470 YSAFFITLIIIIQGFTSLAPTFNVSNFFAAYISVFMFLVIWAVFQCWYRTRIIHRIEHVD 529

Query: 519 LDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           +D+DRRE+D   W+  EP  LW KFW+A+A
Sbjct: 530 IDSDRREVDAQQWDNTEPTTLWGKFWAAMA 559

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/528 (63%), Positives = 415/528 (78%), Gaps = 1/528 (0%)

Query: 22  FSRSKDVVSLES-LGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGA 80
           +S S D    E   G  +ET+VKRALKPRHISMIALGGTIGTGLF+ I++PLS +GPVGA
Sbjct: 35  YSHSGDNAPCEKGEGDCRETEVKRALKPRHISMIALGGTIGTGLFVGIASPLSESGPVGA 94

Query: 81  LIAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFA 140
           LIAY+FIG++ Y V+QSLGEMATFIPVTSS  VF++RFLSPA G ANGYMY+ +W+IT+A
Sbjct: 95  LIAYIFIGSIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYA 154

Query: 141 LELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFI 200
           +E++VVGQVIQ+WTDAVPL AWI I WV++  AN  PVKFYGEVEFW+A +KV+AIVG++
Sbjct: 155 VEIAVVGQVIQYWTDAVPLAAWIAIFWVLVTLANFFPVKFYGEVEFWVASVKVIAIVGYL 214

Query: 201 IYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTEL 260
           IYA ++VCG    GP+GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLI+AAFTYQGTEL
Sbjct: 215 IYALVIVCGGSHQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTEL 274

Query: 261 VGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPF 320
           VGITAGEAANPRKTVPRAINKV                     +D +L +  + I+SSPF
Sbjct: 275 VGITAGEAANPRKTVPRAINKVFFRILFFYILSLFFIGLLVPYDDLRLSNTTAVIASSPF 334

Query: 321 VIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGI 380
           VI+I+N+GTKVLPHIFNA+++ TIISA NS+VY+ SRVLYS+ L+G APK   + TK G+
Sbjct: 335 VISIQNAGTKVLPHIFNAIVMITIISAANSNVYVGSRVLYSLALSGNAPKQFGYVTKQGV 394

Query: 381 PYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQG 440
           PY  V+ T+L+G LA+L  ++ A+  F+WL+NI+ +AG  AW+ IS++H+RFMQ LKH+G
Sbjct: 395 PYLGVIVTALLGLLAFLVVNNNANEAFNWLVNISTLAGLCAWLFISLSHVRFMQCLKHRG 454

Query: 441 ISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWI 500
           ISR+DLPFKAK MPWGAYYAA             AF PKF VSDFFT+Y+S+IL   +++
Sbjct: 455 ISREDLPFKAKLMPWGAYYAAFFIGVIIIIQGFKAFTPKFRVSDFFTSYISLILLAVLFL 514

Query: 501 GFQIWFRGPLFKKTEDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           G Q+++R       +DID+D+DRREID  VWE+DEPKNLWEKFW AVA
Sbjct: 515 GCQLFYRCRFIWSLDDIDIDSDRREIDAIVWEDDEPKNLWEKFWVAVA 562

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/513 (64%), Positives = 396/513 (77%), Gaps = 1/513 (0%)

Query: 36  SVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVS 95
            V+   V+R LK RH+ MIALGGTIGTGLFI +STPL NAGPVGALIAY+F+ TLAY V+
Sbjct: 21  EVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVT 80

Query: 96  QSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTD 155
           QSLGEMATFIPVTSSF VF+QRF+SPA GAANGYMY+ SW ITFALELSVVGQVIQFWT 
Sbjct: 81  QSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTF 140

Query: 156 AVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGP 215
           AVPL AWI I WV+L   N+ PVK+YGE EFW+A +KV+AI+GF+IY F MVCGAG TGP
Sbjct: 141 AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP 200

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           VGFRYWR+PG +GPGII+KD N+ RFLGWVSSLI+AAFT+QGTELVGITAGEAANPRKTV
Sbjct: 201 VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 260

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHI 335
           PRAI KV                     +D KL S DSY+S+SPF+IAIENSGT VLPHI
Sbjct: 261 PRAIKKVVFRILFFYILSLFFIGLLVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHI 320

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
           FNAVI++TIISAGNS++Y+ SR++Y +  + LAP  L+ TT+ G+P+ AVL TSL G LA
Sbjct: 321 FNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALA 380

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           Y+E+S G    F+WLLNIT VAGFF W+ IS++HIRFMQAL+ +GISRDDLPFKAK+MP 
Sbjct: 381 YMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPG 440

Query: 456 GAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTE 515
            AYY              T+F P +N  DF TAY+SV +F A+WI FQ WFR  L  + E
Sbjct: 441 LAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVE 499

Query: 516 DIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           D+D+DTDRR ++  VW E EP+  W+KFW+ VA
Sbjct: 500 DVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/522 (62%), Positives = 402/522 (77%), Gaps = 1/522 (0%)

Query: 27  DVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMF 86
           D+   E  G V++T+VKRALK RHI MIALGGTIGTGLF+ ISTPL NAGPVGALIAY+F
Sbjct: 79  DLSDTEEAGHVQDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIF 138

Query: 87  IGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVV 146
           +G++ Y ++QSLGEMATFIPVTSS  VF++RFLSPA G  NGYMY+ +W+IT+A+E+SVV
Sbjct: 139 MGSIIYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVV 198

Query: 147 GQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIM 206
           GQVIQ+WTDAVPL AWI I WV +   N  PVK YGEVEFW+A IKVLAI+G++IYA ++
Sbjct: 199 GQVIQYWTDAVPLAAWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVI 258

Query: 207 VCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAG 266
           VCG    GP+GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLI+AAFTYQGTELVGITAG
Sbjct: 259 VCGGSSQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAG 318

Query: 267 EAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIEN 326
           EAANPRK+VPRAINKV                     ND  L S DSYI+SSPFVI+I+N
Sbjct: 319 EAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYNDHTLSSGDSYIASSPFVISIQN 378

Query: 327 SGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVL 386
           +GT  LP IFNAV++ TIISA NS+VY+ SRVLY++   G APK   + TK G+P+  V+
Sbjct: 379 AGTYALPDIFNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVI 438

Query: 387 TTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDL 446
            T+ +G LA+L  ++ A+  F+WL+NI+ +AG  AW  I+++HIRFMQALK++GISRDDL
Sbjct: 439 VTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDL 498

Query: 447 PFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWF 506
           PFKAK MPWGAYY+A             AF P ++ + FFT+Y+S+IL   V+IG Q+++
Sbjct: 499 PFKAKLMPWGAYYSAFFVFVIIFIQGFEAFTP-WDTTTFFTSYISLILLVVVFIGCQLYY 557

Query: 507 RGPLFKKTEDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           R     K EDID+DTDRREI+  +WE+DEPKNLWEKFW+ VA
Sbjct: 558 RCRFLLKVEDIDIDTDRREIEAIIWEDDEPKNLWEKFWAWVA 599

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/508 (64%), Positives = 392/508 (77%)

Query: 41  QVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGE 100
           +VKR L  RHI+MIALGGTIGTGLF+ I+ PL  +GPVG+LIAY+F+GT+ Y V+QSLGE
Sbjct: 59  EVKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSVTQSLGE 118

Query: 101 MATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLT 160
           MATFIPVT+SF +F+ RFLSPALGAANGYMY+ SW++TFALELSVVGQ+IQFWT AVPL 
Sbjct: 119 MATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLP 178

Query: 161 AWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRY 220
           AWI I WV+L  +NL PV+ YGE+EFWIA +KV AI+GFIIY F +VCGAGKTGPVGFRY
Sbjct: 179 AWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRY 238

Query: 221 WRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAIN 280
           WRNPGPWG GIIS ++ E RFLGW SSLI+AAFT+QGTELVGITAGEAANPR+TVP+AI 
Sbjct: 239 WRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIR 298

Query: 281 KVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVI 340
           KV                     +D KLKSE+SY+SSSPF+IAIENSGTK+LPHIFN VI
Sbjct: 299 KVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVI 358

Query: 341 LSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESS 400
           L TIISAGNS+VYI SR+L+ +  NG  PK    TTKSG+P  AV+ TSL G LA++E+S
Sbjct: 359 LVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETS 418

Query: 401 HGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYA 460
            G    F WLLN+  VAGFF+W+LIS AHIRFMQ L+ +GISR+DLPFKAKFMP+ AYYA
Sbjct: 419 TGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYA 478

Query: 461 AXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDIDLD 520
                        TAFAPKF+V +FF +Y+SV LFF  W  FQ+WF+     K  DID+D
Sbjct: 479 TIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVDIDID 538

Query: 521 TDRREIDNDVWEEDEPKNLWEKFWSAVA 548
            DRREI++ VW++  P NLW KFW  VA
Sbjct: 539 KDRREIEDRVWQDTTPANLWGKFWDFVA 566

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/511 (62%), Positives = 401/511 (78%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
            +TQVKRALK RH+ MIALGGTIGTGLFI I+TPL+N+GPVG+LIAY+F+G++ Y ++QS
Sbjct: 89  HDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQS 148

Query: 98  LGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           LGEMATFIPVTSS  VF++RFLSPA G ANGYMY+ +W+ITFA+E+SVVGQVI++WTD V
Sbjct: 149 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTDKV 208

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
           PL AWI I WV++   N  PVK YGE+EFWIA IKVLAI+G+++YA I+VCG    GP+G
Sbjct: 209 PLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGSSQGPIG 268

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           FRYWRNPGPWGPGIISKDVN GRFLGWVSSLI+AAFTYQGTELVGITAGEAANPRKTVPR
Sbjct: 269 FRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 328

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           AINKV                     ND +L S  + I+SSPFVI+I+N+GTKVLP IFN
Sbjct: 329 AINKVVFRIALFYIMSLFFIGMLVPYNDERLASTSAVIASSPFVISIQNAGTKVLPDIFN 388

Query: 338 AVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYL 397
           A+++ TIISA NS+VY+ SRVLY++ L+G APK   + T+ G+PY  V+ TS +G LA+L
Sbjct: 389 AIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALGLLAFL 448

Query: 398 ESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
             ++ A+  F+WL+NI+ +AG  AW+ IS++HIRFMQALK +GISRDDLPFKAK MP+GA
Sbjct: 449 VVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLMPFGA 508

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDI 517
           YYA              AF+P ++ + FFT+Y+S+I+   ++IG QI++R   F + EDI
Sbjct: 509 YYATFFVTVIIFIQGFQAFSPHWDTTAFFTSYISLIILAVLFIGCQIFYRCRFFWRVEDI 568

Query: 518 DLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           D+D+DRREI+  +WE+DEPK LW+KFW+AVA
Sbjct: 569 DIDSDRREIEAVIWEDDEPKTLWDKFWAAVA 599

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/512 (63%), Positives = 400/512 (78%)

Query: 37  VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQ 96
           V +T+VKRALK RHI MIALGGTIGTGLF+ ISTPLSN+GPVGALIAY+F+GT+ Y V+Q
Sbjct: 86  VHDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQ 145

Query: 97  SLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
           SLGEMATFIPVTSS  VF++RFLSPA G ANGYMY+ +W+IT+A+E+SV+GQVIQ+WT  
Sbjct: 146 SLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFK 205

Query: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPV 216
           VPL AWI I WV++   N  PVK YGE EFW+A IKV+AIVG++IYA I+VCG    GP+
Sbjct: 206 VPLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGSHQGPI 265

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           GFRYWRNPG  G GIIS D+ E RFLGWVSSLI+AAFTYQGTELVGITAGEAANPRK+VP
Sbjct: 266 GFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 325

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIF 336
           RAINKV                     NDP+L +  + I+SSPFVI+I+N+GTKVLP IF
Sbjct: 326 RAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIASSPFVISIQNAGTKVLPDIF 385

Query: 337 NAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAY 396
           NAV+L T+ISA NS+VY+ SRVLY++  +G APK   + T+ G+PY  V+ T+L+G LA+
Sbjct: 386 NAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLLAF 445

Query: 397 LESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWG 456
           L  +H A+  F+WL+NI+ +AG  AW+ IS+AHIRFMQALK +GISRDDLPFKAKFMPWG
Sbjct: 446 LVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPWG 505

Query: 457 AYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTED 516
           AYYA+             AFAPKF+VS+FFTAY+S+IL   ++ G Q+++R     K ED
Sbjct: 506 AYYASFFVTVIIFIQGFQAFAPKFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLWKLED 565

Query: 517 IDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           ID+D+DRREID  VWE+DEP+NLWEKFW+AVA
Sbjct: 566 IDIDSDRREIDAIVWEDDEPQNLWEKFWAAVA 597

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/514 (64%), Positives = 392/514 (76%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G V+ T+VKRALKPRHI MIALGGTIGTGLF+ IS PL NAGPVG LIAY+F+ T+A+ V
Sbjct: 67  GEVRSTEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLIAYLFMATIAFSV 126

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
            QSLGEMAT+IPVTS+F VF+QRFLSPA GAANGYMY+ SWSITFALELSV+GQ++Q+WT
Sbjct: 127 MQSLGEMATYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALELSVIGQIVQYWT 186

Query: 155 DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
             VP+ AWI I WV++   N  PVKFYGE EFWIA IKV+AIVGFIIY FIMVCGAGKTG
Sbjct: 187 FKVPVAAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFIIYCFIMVCGAGKTG 246

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
           PVGFRYWR+   +G GIISK+ NE RFLGWVSSLI+AAFTYQGTELVGITAGEAANPRKT
Sbjct: 247 PVGFRYWRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 306

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           VP++I +                      ND  L+   SY +SSPF++AI+NSGTK LP 
Sbjct: 307 VPKSIKRTLWRILIFYIFSLLFVGLLVPFNDHGLQDSRSYAASSPFILAIKNSGTKALPD 366

Query: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394
           IFNAVIL+T+ISA NSDVY+ SRV+YSM  N LAP  L   +K G+PYAAVL TS +G L
Sbjct: 367 IFNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPYAAVLFTSAIGAL 426

Query: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454
           AYLE+S   + VF+WL+NIT VAGFF+W LIS +H+RFM+ALK +GISR+DLPFKA FMP
Sbjct: 427 AYLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGISRNDLPFKASFMP 486

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKT 514
           W A Y+             T F P F  SDF  +Y+SV LFF +W  FQIWFR PL    
Sbjct: 487 WIAIYSFFFMTLIILVQGFTCFTPHFQASDFVASYISVGLFFVIWAVFQIWFRCPLLVPI 546

Query: 515 EDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
            +ID+DTDRR++D +VWE++ PK LW+KFW+ VA
Sbjct: 547 AEIDIDTDRRDVDAEVWEDEPPKTLWDKFWNIVA 580

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/511 (62%), Positives = 398/511 (77%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           ++T+VKRALK RHI MIALGGTIGTGLF+ I+TPLSNAGPVG+LIAY+F+G++ Y V+QS
Sbjct: 100 QDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYIFMGSVVYFVTQS 159

Query: 98  LGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           LGEMATFIPVTSS  VF++RFLSPA G ANGYMY+ +W+IT+A+E+SV+GQVIQ+WT AV
Sbjct: 160 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAV 219

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
           PL AWI I WV++   N  PVK YGE EFWIA IKVLAI+G++IYA I+VCG    GP+G
Sbjct: 220 PLAAWIGIFWVIVTLMNFFPVKVYGEFEFWIASIKVLAIMGYLIYALIIVCGGSHQGPIG 279

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           FRYWRNPGPWGPGIIS    E RFLGWVSSLI+AAFTYQGTELVGITAGEAANPRK+VPR
Sbjct: 280 FRYWRNPGPWGPGIISDKTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 339

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           AINKV                     ND +L ++ + I+SSPFVI+I+N+GT+ LP IFN
Sbjct: 340 AINKVVFRIALFYIMSLFFIGLLVPFNDDRLANDSAVIASSPFVISIQNAGTRALPDIFN 399

Query: 338 AVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYL 397
           AV+L TIISA NS+VY+ SRVLY++ L G APK  ++ TK G+PY  V+ T+ +G LA+L
Sbjct: 400 AVVLLTIISAANSNVYVGSRVLYALALTGNAPKIFSYVTKYGVPYMGVICTAALGLLAFL 459

Query: 398 ESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
             ++ A+  F+WL+NI+ +AG  AW+ IS++HIRFMQALK++GISRDDLPFKAK MPWGA
Sbjct: 460 VVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKYRGISRDDLPFKAKLMPWGA 519

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDI 517
           YYA+             AF PKF+VS FFT+Y+S+IL   ++ G Q+++R     K EDI
Sbjct: 520 YYASFFVTVIIFIQGFQAFTPKFDVSTFFTSYISLILLAVLFSGCQLYYRCRFIWKVEDI 579

Query: 518 DLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           D+D+DRREI+  +WEEDEPKNLWEKFW+ VA
Sbjct: 580 DIDSDRREIEAIIWEEDEPKNLWEKFWAWVA 610

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/511 (62%), Positives = 399/511 (78%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           K+T+VKRALKPRHI MIALGGTIGTGLFI IS PL  +GPVG+LIAY+F+GT+ Y V+Q+
Sbjct: 98  KDTKVKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIAYIFMGTVVYFVTQA 157

Query: 98  LGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           LGEMATFIPVTSS  VF+ RFLSPA G +NGY+Y+ +W+IT+A+E+SVVGQVI+FWT  V
Sbjct: 158 LGEMATFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEISVVGQVIEFWTTKV 217

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
           PL AWI I WV++ + N  PV  YGE+EFW+A +KVLAIVG++IYA ++VCG  K GP+G
Sbjct: 218 PLAAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYLIYALVIVCGGSKQGPIG 277

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           FRYWR+    G G+ISKD NE RFLGWV+SLI+AAFTYQGTELVGITAGEAANPRK+VPR
Sbjct: 278 FRYWRHGYAMGGGMISKDKNEARFLGWVASLINAAFTYQGTELVGITAGEAANPRKSVPR 337

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           AINKV                     NDPKL S  SYI+SSPFVI+IEN+GT+ LPHIFN
Sbjct: 338 AINKVVFRIVIFYILSLFFIGLLVPYNDPKLNSATSYIASSPFVISIENAGTRALPHIFN 397

Query: 338 AVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYL 397
           A+I+ TIISA NS+VY+SSRVLYS+ L+G APK     T  G+P+  V+ T+L+G LA+L
Sbjct: 398 AIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVPFLGVIVTALMGLLAFL 457

Query: 398 ESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
             ++ A+  F+WL+NI+ +AG  AW+ IS++H+RFM+ALK++GISRDDLPFKA+FMP+G+
Sbjct: 458 VVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKYRGISRDDLPFKARFMPYGS 517

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDI 517
           YYA             TAF+PKF+V+ FFTAY+S+IL   ++IG Q+++R   F K EDI
Sbjct: 518 YYACFFITVIIFIQGFTAFSPKFDVASFFTAYISLILLAVLFIGCQLYYRCRFFWKVEDI 577

Query: 518 DLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           D+DTDRREID  VWE+DEPK  W+KFW+AVA
Sbjct: 578 DIDTDRREIDEIVWEDDEPKTAWDKFWAAVA 608

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/514 (64%), Positives = 396/514 (77%), Gaps = 3/514 (0%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           K+  VKR LK RHISMIALGGTIGTGLF+ I+ PL  AGP+GALIAY+F+GT+ + V+QS
Sbjct: 31  KQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGALIAYLFMGTVVFSVTQS 90

Query: 98  LGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           LGEM TFIPVT+SF VF QRFLSPA GAANGYMY+ SW++TFALELSVVGQ+IQFWT AV
Sbjct: 91  LGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAV 150

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
           PL AWI I+WV+L  +NL PV+ YGE+EFWIA +KVLAI+GFIIY   ++CGAG TGPVG
Sbjct: 151 PLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAILGFIIYGICIICGAGVTGPVG 210

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           FRYW+NPGPWG GIIS +VNE RF GWVSSLI+AAFT+QGTELVGITAGE   PRKTVP+
Sbjct: 211 FRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPK 270

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           AI KV                     NDPKL+S DSY+SSSPF+I I+N+GTK+LPHIFN
Sbjct: 271 AIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFN 330

Query: 338 AVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYL 397
           AVIL TIISAGNS+VYI SR+LY +  N  APK+ T T+K+G+PY  VL TS+ G LAY+
Sbjct: 331 AVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYM 390

Query: 398 ESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
           E++ G    F WLLNI  VAGFFAW+LIS +HIRFM+ALK +GISR+DLP+KA  MPW A
Sbjct: 391 ETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLA 450

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDI 517
           YYA             T+FAPKF V++FF AY+SV LF   W+ FQIWF+  L  K +D+
Sbjct: 451 YYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDV 510

Query: 518 DLDTDRREIDNDVWE---EDEPKNLWEKFWSAVA 548
           DLDTDRR+I+ +VW    ED+ KN W++FW+ VA
Sbjct: 511 DLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/527 (60%), Positives = 401/527 (76%), Gaps = 2/527 (0%)

Query: 22  FSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGAL 81
           F   +++  +ESL    +  VKR LKPRH+SMI+LGGTIGTGLF+ I++P+  AGPVG+L
Sbjct: 42  FINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSL 101

Query: 82  IAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFAL 141
           +AY+F+GT+A+ V+QSLGEMATFIPVTSSF ++TQRFLSPALGAANGY+Y+ SW +TFAL
Sbjct: 102 LAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFAL 161

Query: 142 ELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFII 201
           ELS++GQ+IQ+WT AVPL+ WI++ W++L ++N+ PV+FYGE+EFWIA +KVL+I GF+I
Sbjct: 162 ELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLI 221

Query: 202 YAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELV 261
           YA +MVCG    G +GFRYW+NPGPWG G+IS +  E RFLGWVSSLI AAFTYQGTELV
Sbjct: 222 YALVMVCGGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELV 281

Query: 262 GITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK-SEDSYISSSPF 320
           GITAGE+ NPRKTVP+AINKV                      DP+L  + DS I++SPF
Sbjct: 282 GITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPF 341

Query: 321 VIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGI 380
           V+AI+NSGTKVLP +FN VIL TI+SAGNS++YI SRVLY +  +GLAP     T K G+
Sbjct: 342 VMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGV 401

Query: 381 PYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQG 440
           P+ AVLT+S+ G LAYL  S  A  VFDWLL ITAVAGFFAW+LIS++HIRFMQ LK +G
Sbjct: 402 PFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRG 461

Query: 441 ISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWI 500
           ISR+DLPFKAKFMPWGAYYAA             +FAP+F  S+F   Y+SV LF   W+
Sbjct: 462 ISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWL 521

Query: 501 GFQIWFRGPLFKKTEDIDLDTDRREIDNDVW-EEDEPKNLWEKFWSA 546
           GFQ+ F+  L  + ED+D+DTDRREID  VW ++DEPK L +K W +
Sbjct: 522 GFQVLFKTRLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQS 568

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/514 (66%), Positives = 404/514 (78%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G V++ +VKR LK RHI MIALGGTIGTGLFI ISTPL NAGPVG+LIAY+F+ T+ + V
Sbjct: 82  GVVQDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLKNAGPVGSLIAYLFMATIVFSV 141

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
           +QSLGEMATFIPVTSSF VF+ RF+SP++GAANGYMY+ SW+ITFALELSVVGQ+IQFWT
Sbjct: 142 TQSLGEMATFIPVTSSFTVFSSRFISPSIGAANGYMYWFSWAITFALELSVVGQIIQFWT 201

Query: 155 DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
           DAVPL+AWI+I W +L   N+ PVKFYGE EFW+A IKV+AI+GF+IY   MVCGAG TG
Sbjct: 202 DAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTG 261

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
           PVGFRYWRNPGPWGPGIIS  V EGRFLGWVSSLI+AAFTYQGTELVGITAGEAANPRKT
Sbjct: 262 PVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 321

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           VPRAI KV                     +DPKL S+DSY+SSSPF+IAI+NSGTKVLPH
Sbjct: 322 VPRAIKKVSFRILIFYILSLFFIGLLVPFDDPKLSSDDSYVSSSPFIIAIQNSGTKVLPH 381

Query: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394
           IFNAVILSTIISAGNS++Y+ SRV++ +    LAP++   TTK G+PY AVL TS  G L
Sbjct: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441

Query: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454
           A+LE S G +  F+WLLNI  VAGFFAW+LIS+AH+RF+Q L+H+GISRDDLPFKA  MP
Sbjct: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKT 514
           W AYYA             TAFAP FN SDF  AY+SV LFF +W+ FQ++FR  L+   
Sbjct: 502 WLAYYAIFFMIIIIIIQGFTAFAPTFNGSDFVAAYISVFLFFFLWVSFQLYFRCKLYWSL 561

Query: 515 EDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           +++D+DTDRR+ID  +WE+  PK  W++FW  VA
Sbjct: 562 DEVDIDTDRRDIDAIIWEDSAPKTFWDRFWDVVA 595

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/511 (63%), Positives = 401/511 (78%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
            +T+VKRALK RHI MIALGGTIGTGLF+ I+TPLSNAGPVG+LIAY+F+G++ Y ++QS
Sbjct: 63  HDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFMGSIVYFITQS 122

Query: 98  LGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           LGEMATFIPVTSS  VF++RFLSPA G ANGYMY+ +W+IT+A+E+SV+GQVIQFWT AV
Sbjct: 123 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQFWTSAV 182

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
           PL AWI I WV +   N  PVK YGE+EFW+A IKV+AIVG++IYA ++VCG    GP+G
Sbjct: 183 PLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLIYALVIVCGGSSQGPIG 242

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           FRYWRNPGPWGPGIIS D NEGRFLGWVSSLI+AAFTYQGTELVGITAGEAANPRK+VPR
Sbjct: 243 FRYWRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 302

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           AINKV                     NDP+L S  + I+SSPFVI+I+N+GT+VLPHIFN
Sbjct: 303 AINKVVFRIVIFYIMSLFFVGMLVPFNDPRLASNVAVIASSPFVISIQNAGTRVLPHIFN 362

Query: 338 AVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYL 397
           AV++ TIISA NS+VY+ SRVLY++   G APK   + T+ G+PY  V+ TSL+G LA+L
Sbjct: 363 AVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGVIATSLLGLLAFL 422

Query: 398 ESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
             ++ A+  F+WL+NI+ +AG  AW+ IS++HIRFMQALK +GISRDDLPFKAK MPWGA
Sbjct: 423 VVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLPFKAKLMPWGA 482

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDI 517
           YYAA             AF+PKF+VS FFTAY+S+I+   + IG Q+++R     K EDI
Sbjct: 483 YYAAFFVTVIIFIQGFEAFSPKFDVSGFFTAYISLIILVVLLIGCQLYYRCRFLWKLEDI 542

Query: 518 DLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           D+DTDRREI+  +WEE+EP+NLWEKFWS +A
Sbjct: 543 DIDTDRREIECIIWEEEEPQNLWEKFWSIMA 573

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/532 (59%), Positives = 403/532 (75%), Gaps = 8/532 (1%)

Query: 25  SKDVVSLESLGS--------VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAG 76
           S+D  S + LGS        ++E +VKRALKPRH+SMIALGGTIGTGLF+ I++PLS +G
Sbjct: 90  SQDEPSTDPLGSDTESGEGDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSG 149

Query: 77  PVGALIAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWS 136
           PVGALIAY+F+GT+ Y V+QS+GEMATFIPVTSS  VF+ RFLSPA G ANGYMY+ +W+
Sbjct: 150 PVGALIAYIFMGTVVYFVTQSMGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWA 209

Query: 137 ITFALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAI 196
           ITFA+ELSV GQVI++WT+AVP  AWI I WV++  AN  PV+FYGEVEFW+A IKVLAI
Sbjct: 210 ITFAVELSVTGQVIEYWTEAVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAI 269

Query: 197 VGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQ 256
           VG++IYA ++VCG  K GP+GFRYWRNPGPWG GIISKD +EGRFLGWV+SLI+A+FTYQ
Sbjct: 270 VGYLIYALVIVCGGSKQGPIGFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTYQ 329

Query: 257 GTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYIS 316
           GTELVGITAGEAANPR+TVPRAINKV                     N   L    + I+
Sbjct: 330 GTELVGITAGEAANPRRTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSLDKTTTVIA 389

Query: 317 SSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTT 376
           SSPFVI+I+N+GT+ LP IFNAV+L TIISA NS+VY+ SRVL+S+   G+APK  +  T
Sbjct: 390 SSPFVISIQNAGTRALPDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVT 449

Query: 377 KSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQAL 436
             G+P+  V+ TSL+G LA+L  +H A+  F+WL+NI+ +AG  AW+ IS++HIRFMQ L
Sbjct: 450 PQGVPFMGVIVTSLLGLLAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCL 509

Query: 437 KHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFF 496
           K +GISRDDLPFK+K MP+GAYYAA             AF+P F V++FFT+Y+S++L  
Sbjct: 510 KQRGISRDDLPFKSKLMPYGAYYAAFWVTVIIFVQGFQAFSPHFKVTEFFTSYISLMLLV 569

Query: 497 AVWIGFQIWFRGPLFKKTEDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
            V+ G Q+++R   F + EDID+D+DRRE D  +WE+DEP  LW KFW+AVA
Sbjct: 570 VVFCGAQLFYRCRFFNRLEDIDIDSDRREADALIWEDDEPTTLWGKFWTAVA 621

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/514 (60%), Positives = 395/514 (76%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G ++E QVKRALKPRH+SMIALGGTIGTGLF+ I++PLS+AGPVGALIAY+F+G++ Y V
Sbjct: 47  GDLQEGQVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVYFV 106

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
           +QS+GEMATFIPVTSS  VF+ RFLSPA G ANGYMY+ +W+IT+A+E+SV+GQVIQ+WT
Sbjct: 107 TQSMGEMATFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWT 166

Query: 155 DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
            AVPL AWI I WV +  AN  PV+FYGEVEFW+A IKV+AIVG+++YA I+VCG  K G
Sbjct: 167 KAVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGGSKQG 226

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
           P+GFRYWRNPGPWG GIIS D ++GRFLGWV+SLI+A+FTYQGTELVGITAGEAANPRKT
Sbjct: 227 PIGFRYWRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAANPRKT 286

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           VP+AINKV                     N P L    S I+SSPFVI+I+++GT++LP 
Sbjct: 287 VPKAINKVFFRILFFYILSLFFVGLLVPYNHPGLDKHTSVIASSPFVISIQSAGTRILPD 346

Query: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394
           IFNAV+L TIISA NS+VY+ SR+L+S+   G+APK  ++ T  G+PY  V+ T+L+G L
Sbjct: 347 IFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVICTALLGLL 406

Query: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454
           A+L     A+  F+WL+NI+ +AG  AW+ IS++HIRFMQ LK +GISRDDLPFK+K MP
Sbjct: 407 AFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMP 466

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKT 514
           +GAYYAA             AF PKF V++FFT Y+S+IL   V+   Q+++R   F + 
Sbjct: 467 YGAYYAAFWVAVIIFVQGFQAFCPKFKVAEFFTGYISLILLAVVFCLAQLYYRCRFFNRL 526

Query: 515 EDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           EDID+D+DRREID  +WEE+EP  LW KFW AVA
Sbjct: 527 EDIDIDSDRREIDALIWEEEEPTTLWGKFWVAVA 560

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/526 (61%), Positives = 399/526 (75%), Gaps = 1/526 (0%)

Query: 23  SRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALI 82
           S   D+   E     ++  VKRALK RHI MIALGGTIGTGLF+ ISTPLSNAGPVG+LI
Sbjct: 87  SHETDINEDEEEAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLI 146

Query: 83  AYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALE 142
           AY+F+GT+ Y V+QSLGEMATFIPVTSS  VF++RFLSPA G +NGYMY+ +W+IT+A+E
Sbjct: 147 AYIFMGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVE 206

Query: 143 LSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIY 202
           +SV+GQVI++WTD VPL AWI I WV++   N  PVK YGE EFW+A +KVLAI+G++IY
Sbjct: 207 VSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIY 266

Query: 203 AFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVG 262
           A I+VCG    GP+GFRYWRNPG WGPGIIS D +EGRFLGWVSSLI+AAFTYQGTELVG
Sbjct: 267 ALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSSLINAAFTYQGTELVG 326

Query: 263 ITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVI 322
           ITAGEAANPRKTVPRAINKV                     ND +L +  + I+SSPFVI
Sbjct: 327 ITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRLSASSAVIASSPFVI 386

Query: 323 AIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPY 382
           +I+N+GT  LP IFNAV+L T++SA NS+VY+ SRVLYS+   G APK   + T+ G+PY
Sbjct: 387 SIQNAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPY 446

Query: 383 AAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGIS 442
             V+ T+ +G LA+L  ++ A+  F+WL+NI+ +AG  AW+ IS+AHIRFMQALKH+GIS
Sbjct: 447 LGVVCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS 506

Query: 443 RDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGF 502
           RDDLPFKAK MP+GAYYAA             AF P F VS+FFT+Y+S+IL   V+IG 
Sbjct: 507 RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCP-FKVSEFFTSYISLILLAVVFIGC 565

Query: 503 QIWFRGPLFKKTEDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           QI+++     K EDID+D+DRREI+  +WE+DEPKNLWEKFW+AVA
Sbjct: 566 QIYYKCRFIWKLEDIDIDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/508 (62%), Positives = 395/508 (77%), Gaps = 1/508 (0%)

Query: 41  QVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGE 100
            VKRALK RHI MIALGGTIGTGLF+ ISTPLSNAGPVG+LIAY+F+GT+ Y ++QSLGE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 101 MATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLT 160
           MATFIPVTSS  VF++RFLSPA G +NGYMY+ +W+IT+A+E+SV+GQVIQ+WTD VPL 
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPLA 224

Query: 161 AWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRY 220
           AWI I WV++   N  PVK YGE EFW+A +KVLAIVG++IYA ++VCG    GP+GFRY
Sbjct: 225 AWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGSHQGPIGFRY 284

Query: 221 WRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAIN 280
           WRNPG WGPGIISK+ +EGRFLGWVSSLI+AAFTYQGTELVGITAGEAANPRKTVPRAIN
Sbjct: 285 WRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIN 344

Query: 281 KVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVI 340
           KV                     N+P+L    + I+SSPFVI+I+N+GT  LP IFNAV+
Sbjct: 345 KVVFRIVIFYIMSLFFIGLLVPYNEPRLSPSSAVIASSPFVISIQNAGTYALPDIFNAVV 404

Query: 341 LSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESS 400
           L T+ISA NS+VY+ SRVLYS+  +G APK   + TK G+PY  VL+T+ +G LA+L  +
Sbjct: 405 LITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLAFLVVN 464

Query: 401 HGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYA 460
           + A+  F+WL++I+ +AG  AW+ IS+AHIRFMQALK +GISRDDLPFKAK MP+GAYYA
Sbjct: 465 NNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPYGAYYA 524

Query: 461 AXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDIDLD 520
           +             AF P F+VS+FFT+Y+S+IL   V+I  Q++++     K EDID+D
Sbjct: 525 SFFVTIIIFIQGFQAFCP-FSVSEFFTSYISLILLAVVFISCQLYYKCRFIWKLEDIDID 583

Query: 521 TDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           +DRREI+  +WE+DEPKNLWEKFW+AVA
Sbjct: 584 SDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/516 (61%), Positives = 400/516 (77%), Gaps = 1/516 (0%)

Query: 30  SLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGT 89
           S E    V ET+VKRALK RHI MIALGGTIGTGLF+ ISTPLS AGPVG+LIAY+F+GT
Sbjct: 80  SDELEAEVHETKVKRALKQRHIGMIALGGTIGTGLFVGISTPLSVAGPVGSLIAYIFMGT 139

Query: 90  LAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQV 149
           + Y V+QSLGEMATFIPVTSS  VF++RFLSPA G ANGYMY+ +W+IT+A+E+SV+GQV
Sbjct: 140 IIYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQV 199

Query: 150 IQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG 209
           IQ+WT AVPL AWI I WV++   N  PVK YGEVEFWIA +KVLAIVG++IYA ++VCG
Sbjct: 200 IQYWTKAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWIAFVKVLAIVGYLIYALVIVCG 259

Query: 210 AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAA 269
               GP+GFRYWR+PG +GPGIISK+ N G+FLGWV+SLI+AAFTYQGTELVGITAGEAA
Sbjct: 260 GSHQGPIGFRYWRHPGAFGPGIISKNKNTGKFLGWVASLINAAFTYQGTELVGITAGEAA 319

Query: 270 NPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGT 329
           NPRKTVPRAINKV                     ND +L ++D+ I+SSPFVI+I+N+ T
Sbjct: 320 NPRKTVPRAINKVVFRIVLFYIMSLFFIGMLLPYNDKRLSAQDAVIASSPFVISIKNAHT 379

Query: 330 KVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTS 389
           KVLP IFNAV++ T++SA NS+VY+ SRVLY++ L G APK  ++ T+ G+PY  V+ T+
Sbjct: 380 KVLPDIFNAVVMVTVMSAANSNVYVGSRVLYALALTGNAPKQFSYVTRYGVPYLGVVCTA 439

Query: 390 LVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFK 449
            +G LA+L  ++ A+  F+WL+NI+ +AG  AW+ IS+AHIRFMQALK +GISRDDLPFK
Sbjct: 440 SLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFK 499

Query: 450 AKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGP 509
           AK MPWGAYYAA             AF P ++VS FFT+Y+S+IL   + +G Q+++RG 
Sbjct: 500 AKLMPWGAYYAAFFVTVIIFIQGYQAFCP-WDVSTFFTSYISLILLAVLVVGCQLYYRGR 558

Query: 510 LFKKTEDIDLDTDRREIDNDVWEEDEPKNLWEKFWS 545
              K EDID+DTDRREI++ VWE+DEPK LW+KFW+
Sbjct: 559 FLLKLEDIDIDTDRREIESIVWEDDEPKTLWDKFWA 594

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/518 (60%), Positives = 393/518 (75%), Gaps = 1/518 (0%)

Query: 32  ESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLA 91
           E  G   ET+VKRALK RHISMIALGGTIGTGLFI I++PL  AGPVG+LIAY+F+GT+ 
Sbjct: 50  EQEGDYHETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMGTVV 109

Query: 92  YMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQ 151
           Y ++QSLGEMATFIPVTSS  VF++RFLSPA G ANGYMY+ +W+ITFA+ELSVVGQ+I 
Sbjct: 110 YSITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIN 169

Query: 152 FWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG 211
           +WT  VPL AWI I W+++   N  PV+FYGE+EFWIA +KV+ IVG++IYAFI+VCG  
Sbjct: 170 YWTSVVPLGAWITIFWIIVTLLNFFPVRFYGEIEFWIASVKVITIVGYLIYAFIVVCGGS 229

Query: 212 KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271
             GP+GFR WRNPGPWG G+IS +  E RFLGWVSSLI AAFTYQGTELVGITAGE+ NP
Sbjct: 230 SQGPIGFRNWRNPGPWGTGVISSNQTEARFLGWVSSLIKAAFTYQGTELVGITAGESKNP 289

Query: 272 RKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIAIENSGTK 330
           RKTVP+AINKV                     NDP++  + D+ +++SPFVI+I N+GTK
Sbjct: 290 RKTVPKAINKVFFRILFFYILSLFFVGLLVPYNDPRMDNTSDTDVNASPFVISIRNAGTK 349

Query: 331 VLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSL 390
           +LP IFNAV+L T++SA NS+VYI SRV+YS+  +G APK   +  + G+P   V+ T+L
Sbjct: 350 ILPDIFNAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMVTAL 409

Query: 391 VGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKA 450
           +G +A+L  ++ A   F+WL+NI+ +AG  AW+ IS+AHIRFMQ LK +GISRD LPFKA
Sbjct: 410 MGLMAFLVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALPFKA 469

Query: 451 KFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPL 510
           KFMPW AYYAA            TAF+PKF+V+ FFTAY+S++L   V+IG QI+++   
Sbjct: 470 KFMPWAAYYAASFVFVIIFIQGYTAFSPKFDVTQFFTAYISLMLMLVVFIGCQIYYKCRF 529

Query: 511 FKKTEDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
             K EDID+DT+RREID  VWE+DEPKNLW+KFWS +A
Sbjct: 530 LWKLEDIDIDTNRREIDAIVWEDDEPKNLWDKFWSTIA 567

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/519 (62%), Positives = 406/519 (78%)

Query: 30  SLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGT 89
           S E  G   ET+VKRALKPRH+SMIALGGTIGTGLF+ I+ PLS +GPVG+LIAY+F+G+
Sbjct: 61  SEEGEGDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMGS 120

Query: 90  LAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQV 149
           + Y V+QSLGEMATFIPVTSS  VF++RFLSPA G ANGYMY+ +W+IT+A+ELSV+GQ+
Sbjct: 121 VVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVELSVLGQI 180

Query: 150 IQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG 209
           I +WTDAVPL AWI I WV+L +AN  PVK+YGE EF +A IKV+AIVG+++YA I+VCG
Sbjct: 181 INYWTDAVPLAAWIAIFWVLLTAANFFPVKWYGEFEFCVASIKVIAIVGYLLYALIIVCG 240

Query: 210 AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAA 269
               GP+GFRYWRNPGPWG G I+K+VN+ RFLGWV SL++A+FTYQGTELVGITAGEA+
Sbjct: 241 GSSQGPIGFRYWRNPGPWGTGTIAKNVNKARFLGWVGSLVNASFTYQGTELVGITAGEAS 300

Query: 270 NPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGT 329
           NPRKTVP+AINKV                     N P+L+S  + I+SSPFVI+I+N+GT
Sbjct: 301 NPRKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQLESNSAVIASSPFVISIQNAGT 360

Query: 330 KVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTS 389
           KVLP IFNAV+L TI+SAGNS+VY+ SRVLYS+ L+G APK  ++ TK G+PY  V+ T+
Sbjct: 361 KVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNAPKQFSYVTKQGVPYLGVICTA 420

Query: 390 LVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFK 449
           L+G LA+L ++  A+  F+WL+NI+ +AG  AW  ISVAHIRFMQ LK +GISRD LPFK
Sbjct: 421 LLGLLAFLATNENANTAFNWLINISTLAGLCAWFFISVAHIRFMQCLKLRGISRDSLPFK 480

Query: 450 AKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGP 509
           AK MPWGAYYAA            TAFAP+F+VS+FFTAY+S+IL   ++I  Q+++R  
Sbjct: 481 AKLMPWGAYYAAFFVGLIVFIQGFTAFAPRFDVSEFFTAYISLILLVVLFILCQLYYRCR 540

Query: 510 LFKKTEDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
              K EDID+D+DRREID  +WE+DEPKNLWEKFW A+A
Sbjct: 541 FLTKIEDIDIDSDRREIDAIIWEDDEPKNLWEKFWVALA 579

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/511 (62%), Positives = 393/511 (76%), Gaps = 1/511 (0%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           ++  VKRALK RHI MIALGGTIGTGLF+ ISTPLS AGPVG+LI+Y+F+GT+ Y ++QS
Sbjct: 103 EDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQS 162

Query: 98  LGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           LGEMATFIPVTSS  VF++RFLSPA G ANGYMY+ +W+IT+A+E+SV+GQVIQ+WTD V
Sbjct: 163 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTDKV 222

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
           PL  WI I WV++   N  PVK YGE EFW+A +KVLAI+G++IYA ++VCG    GP+G
Sbjct: 223 PLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSHQGPIG 282

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           FRYWRNPG WGPGIIS D NEGRFLGWVSSLI+AAFTYQGTELVGITAGEAANPRKTVPR
Sbjct: 283 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 342

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           AINKV                     N+P+L +  + I+SSPFVI+I+N+GT  LP IFN
Sbjct: 343 AINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSASSAVIASSPFVISIQNAGTYALPDIFN 402

Query: 338 AVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYL 397
           AV+L T+ISA NS+VY+ SRVLYS+   G APK   + TK G+PY  VL+T+ +G LA+L
Sbjct: 403 AVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFL 462

Query: 398 ESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
             ++ A+  F+WL+NI+ +AG  AW+ IS+AHIRFMQAL+ +GISRDDLPFKAK MP+GA
Sbjct: 463 VVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMPYGA 522

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDI 517
           YYAA             AF P F VSDFFT+Y+S+IL   V+ G Q++++     K EDI
Sbjct: 523 YYAAFFVTVIIFIQGFQAFCP-FKVSDFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDI 581

Query: 518 DLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           D+DTDRREI+  +WE+DEPKNLWEKFW+AVA
Sbjct: 582 DIDTDRREIEAIIWEDDEPKNLWEKFWAAVA 612

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/532 (62%), Positives = 410/532 (77%), Gaps = 7/532 (1%)

Query: 23  SRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALI 82
           S ++D   L S GSV + +VKR LK RHI MIALGGTIGTGLFI ISTPL ++GPVG+LI
Sbjct: 44  STTEDEEMLNS-GSVHDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLI 102

Query: 83  AYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALE 142
           AY+F+GTL Y V+QSLGEMATFIPVTSSF VF  RFLSP++GAA GYMY+ SW++TFALE
Sbjct: 103 AYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALE 162

Query: 143 LSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIY 202
           LSVVGQ++ +WT AVP+ AWI I WV+L + N+ PVKFYGE+EFW+A +KV+AIVGF+IY
Sbjct: 163 LSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIY 222

Query: 203 AFIMVCGAGKTGPVGFRYWRNPGPWGPGI------ISKDVNEGRFLGWVSSLISAAFTYQ 256
              MVCGAG TGPVGFRYWRNPGPWG G+      ISK+ N GRFLGW +SLI+AAFTYQ
Sbjct: 223 CLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQ 282

Query: 257 GTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYIS 316
           GTELVGITAGEAANPRKTVPRAI KV                     +DPKL S+DSY+S
Sbjct: 283 GTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLSSDDSYVS 342

Query: 317 SSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTT 376
           SSPF+IAIENSGTK+LP IFNA+IL TIISAGNS++Y+ SR+L+S+   GLAPK L+ TT
Sbjct: 343 SSPFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTT 402

Query: 377 KSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQAL 436
           K G+P+ +VL T++ G LAY+E++ G   VFDWL+NITA+AGF+AW+ I ++HIRFMQ L
Sbjct: 403 KKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVL 462

Query: 437 KHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFF 496
           K +GISRDDLPFKA  MP  AYYA             TAF P F+VSDFF AY+SVILFF
Sbjct: 463 KFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFF 522

Query: 497 AVWIGFQIWFRGPLFKKTEDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
            +W  FQ+WF+     K ED+D+D++RR+++  +WE+ EPK  W+KFW+ VA
Sbjct: 523 LIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/512 (61%), Positives = 393/512 (76%)

Query: 37  VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQ 96
           VK   VKRALKPRHI+MIALGGTIGTGLF+ I+ PL NAGPVGALIAY+F+GT+ + V+Q
Sbjct: 88  VKHRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALIAYIFVGTIIFSVTQ 147

Query: 97  SLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
           SLGEM TFIPVTSSF VF+ RFLSPA GAANGYMY+ SW++TFA+ELSV+G+VIQFWT A
Sbjct: 148 SLGEMVTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVELSVLGKVIQFWTTA 207

Query: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPV 216
           VPL AWI+I W +L  +N+ PVK+YGE+EFWIA +KVL++VGF+I+   +  GAG  GP 
Sbjct: 208 VPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGFLIFCLCITSGAGPHGPF 267

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           GFRYWR+PG WGPGII++D +E RFLGWVSSLI+AAFTYQGTELVGITAGEAANPRK VP
Sbjct: 268 GFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP 327

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIF 336
           +AI KV                     NDPKL S  S++SSSPF+IAI+NSG  +LP IF
Sbjct: 328 KAIKKVILRILFFYVGSLFFIGMLVPFNDPKLTSATSFVSSSPFIIAIQNSGVSLLPSIF 387

Query: 337 NAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAY 396
           N VIL TIISAGNS+VY+ SR+L+ +  + LAP++ T TTK+G+P+ AVL TSL G LA+
Sbjct: 388 NGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGVPFVAVLFTSLFGSLAF 447

Query: 397 LESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWG 456
           LE +     VF+WLL+I A+AGFFAW+LIS++HIRFM+AL+++GISR+ LPFKA FMPW 
Sbjct: 448 LELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRGISRNSLPFKAIFMPWL 507

Query: 457 AYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTED 516
           AYYA             TAFAP+FNVSDF  +Y+S++LF  +W  FQ   +  +F K ED
Sbjct: 508 AYYATAFIILIILIQGFTAFAPRFNVSDFVASYISLLLFVIIWGVFQAMKKCRIFWKVED 567

Query: 517 IDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           IDLD+DR++I++  WE+D PK  W K W  +A
Sbjct: 568 IDLDSDRKDIEDIRWEDDSPKTFWTKVWQTLA 599

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/511 (60%), Positives = 394/511 (77%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
            +T+VKRALK RHI MIALGGTIGTGLF+ IS PL+N+GPVG+LIAY+F+G++ Y ++QS
Sbjct: 97  HDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQS 156

Query: 98  LGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           LGEMATFIPVTSS  VF++RFLSPA G ANGYMY+ +W+IT+A+E+SVVGQVI++WT  V
Sbjct: 157 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTKKV 216

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
           PL AWI I WV +   N  PVK YGE+EFWIA +KVLAI G+++YA I+VCG    GP+G
Sbjct: 217 PLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGSSQGPIG 276

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           FRYWRNPGPWG GIISKD N  RFLGWVSSLI+AAFTYQGTELVGITAGEAANPRK+VPR
Sbjct: 277 FRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 336

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           AINKV                     +DP+L S+ + ++SSPFVI+I+N+GTK+LP IFN
Sbjct: 337 AINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDSAVVASSPFVISIQNAGTKILPDIFN 396

Query: 338 AVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYL 397
           A+++ T+ISA NS+VY+ SRVLY++   G APK   + T+ G+PY  VL T+ +G LA+L
Sbjct: 397 AIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGLLAFL 456

Query: 398 ESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
             ++ A+  F+WL+NI+ +AG  AW+ IS++HIRFMQALK +GISRDDLPFKAKFMPW A
Sbjct: 457 VVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFMPWAA 516

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDI 517
           YYA              AF+P F+V+ FFTAY+S+I+   ++IG QI++R   F K EDI
Sbjct: 517 YYATFFVTVIIFIQGFQAFSPHFDVTAFFTAYISLIILAVLFIGCQIYYRCRFFWKLEDI 576

Query: 518 DLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           D+DTDRREI+  +WE+DEPK  W+KFW+AVA
Sbjct: 577 DIDTDRREIEEVIWEDDEPKTYWDKFWAAVA 607

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/519 (64%), Positives = 397/519 (76%), Gaps = 2/519 (0%)

Query: 30  SLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGT 89
            +++ G V+E QVKR LKPRHI MIALGGTIGTGLFI I+TP+ NAGPVG+LIAY+F+GT
Sbjct: 90  DIDATGVVEEAQVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGT 149

Query: 90  LAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQV 149
           L + V+QSLGEMATFIPVTSSF VF  RF+S   GAA GYMY+ SW+ITFALELSVVGQV
Sbjct: 150 LVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQV 209

Query: 150 IQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG 209
           I+FWT  VPL AWI I WV++V  N  PVK YGE EFW+A IKV+AI+GFIIY   MVCG
Sbjct: 210 IEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG 269

Query: 210 AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAA 269
           AG TGPVGFRYWR+PGPWGPGIISKD NE RFLGWVSSLI+AAFTYQGTELVGITAGEAA
Sbjct: 270 AGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAA 329

Query: 270 NPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGT 329
           NPRK+VPRAI KV                     NDPKL S DSY+S+SPF+IAI+NSGT
Sbjct: 330 NPRKSVPRAIKKVSVRILLFYILSLFFIGLLVPYNDPKLSSTDSYVSASPFIIAIQNSGT 389

Query: 330 KVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTS 389
           KVLPHIFNAVIL+TIISA NS+VY+ SR+LY +    LAPK+    T++G+P+ AVL T+
Sbjct: 390 KVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQ-KTRNGVPFIAVLFTA 448

Query: 390 LVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFK 449
             G LAY+E+S G    F+WLLNIT VAGFFAW+ IS++HIRFMQ LKH+G+SRDDLP+K
Sbjct: 449 AFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYK 508

Query: 450 AKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGP 509
           A  MP  AYY A            TAFAPKF+ + F TAY+S  LF  ++I  Q +FR  
Sbjct: 509 AALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTR 568

Query: 510 LFKKTEDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           L++  +D+D+DTDRR+ID  +WEE  P+  W+KFW+ +A
Sbjct: 569 LWRTLDDVDIDTDRRDIDTVIWEEG-PQTFWDKFWAVIA 606

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/512 (64%), Positives = 399/512 (77%), Gaps = 1/512 (0%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           K  +VKR LK RHI MIALGGTIGTGL I I  PL++AGPVGALI+Y+F+GT+ Y V+QS
Sbjct: 62  KGGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQS 121

Query: 98  LGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           LGEMATFIPVTSSF VF QRFLSPALGA NGYMY+LSW  TFALELSV+GQ+IQ+WTDAV
Sbjct: 122 LGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTDAV 181

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG-PV 216
           PL AWI+I W +L   N+ PVK+YGE EF IA IKV+A++GFI ++F +VCGAG++G P+
Sbjct: 182 PLVAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQSGGPI 241

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           GFRYWRNPG WGPGIISK+ NEGRFLGWVSSLI+AAFTYQGTELVGITAGEAANPR+ VP
Sbjct: 242 GFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRRAVP 301

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIF 336
           RAI KV                     NDPKL SE +++SSSPF+I+IENSGTKVLP IF
Sbjct: 302 RAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSEGTFVSSSPFMISIENSGTKVLPDIF 361

Query: 337 NAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAY 396
           NAV+L TI+SAGNS+VYI SRVLYS+  N LAP++L+  TK G+PY AVL+TS  GFLA+
Sbjct: 362 NAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSAFGFLAF 421

Query: 397 LESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWG 456
           LE+S G+  VF+WLLNIT VAGFFAW+LIS++HIRFMQA+K +GISRDDLP++A+ MP+ 
Sbjct: 422 LETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPYRARMMPFL 481

Query: 457 AYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTED 516
           AYYA+            TAFAP F   DF  AY+SV LF A+W+ FQ+WF+     K +D
Sbjct: 482 AYYASFFIALIVLIQGFTAFAPTFQPIDFIAAYISVFLFIAIWLLFQVWFKCRFVWKLQD 541

Query: 517 IDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           +D+D+DRR+I+  VW E E K  W+  W  ++
Sbjct: 542 VDIDSDRRDIEEQVWIEPECKTRWQHVWDILS 573

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/511 (61%), Positives = 393/511 (76%), Gaps = 1/511 (0%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           ++  V+RALK RHI MIALGGTIGTGLF+ ISTPLSNAGPVG+LIAY+F+GT+ Y V+QS
Sbjct: 102 EDKHVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQS 161

Query: 98  LGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           LGEMATFIPVTSS  VF++RFLSPA G +NGYMY+ +W+IT+A+E+SV+GQVI++WT  V
Sbjct: 162 LGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTKV 221

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
           PL  WI I WV++   N  PVK YGE EFW+A +KVLAI+G++IYA ++VCG  K GP+G
Sbjct: 222 PLGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSKQGPIG 281

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           FRYWRNPG WGPGIIS D NEGRFLGWVSSLI+AAFTYQGTELVGITAGEAANPRKTVPR
Sbjct: 282 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 341

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           AINKV                      DP+L +  + I+SSPFVI+I+N+GT  LP IFN
Sbjct: 342 AINKVVFRIVLFYIMSLFFIGLLVPYTDPRLSASSAVIASSPFVISIQNAGTYALPDIFN 401

Query: 338 AVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYL 397
           A++L T+ISA NS+VY+ SRVLYS+   G APK   + TK G+PY  VL+T+ +G LA+L
Sbjct: 402 AIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFL 461

Query: 398 ESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
             ++ A+  F+WL+NI+ +AG  AW+ IS++HIRFMQAL  +GISRDDLPFKAKFMP+GA
Sbjct: 462 VVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMPYGA 521

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDI 517
           YYA+             +F P F V+DFFT+Y+S+IL   V+ G Q++++     K EDI
Sbjct: 522 YYASFFVTVIIFIQGFQSFCP-FRVADFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDI 580

Query: 518 DLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           D+D+DRREI+  +WE+DEPKNLWEKFW+AVA
Sbjct: 581 DIDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/527 (62%), Positives = 406/527 (77%), Gaps = 2/527 (0%)

Query: 24  RSKDVVSLESLGSVKET-QVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALI 82
           + +D  + E+  S +E  +VKR LK RHI MIALGGTIGTGL I I  PL++AGPVGALI
Sbjct: 47  KVEDDAAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALI 106

Query: 83  AYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALE 142
           +Y+F+GT+ Y V+QSLGEM TFIPVTSSF VF QRFLSPALGA NGYMY+LSW  TFALE
Sbjct: 107 SYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALE 166

Query: 143 LSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIY 202
           LSV+G+VIQ+WT+AVPL AWI+I W +L S N+ PVK+YGE EF IA IKV+A++GFII+
Sbjct: 167 LSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIF 226

Query: 203 AFIMVCGAGKT-GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELV 261
           +F +VCGAG++ GP+GFRYWRNPG WGPGIIS D NEGRFLGWVSSLI+AAFTYQGTELV
Sbjct: 227 SFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELV 286

Query: 262 GITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFV 321
           GITAGEAANPRK +PRAI KV                     NDPKL S+  ++SSSPF+
Sbjct: 287 GITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFM 346

Query: 322 IAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIP 381
           I+IENSGTKVLP IFNAV+L TI+SAGNS+VYI SRVLYS+  N LAP++L+  T+ G+P
Sbjct: 347 ISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVP 406

Query: 382 YAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGI 441
           Y +VL+TS+ GFLA+LE S G+   F+WLLNIT VAGFFAW+LIS +HIRFMQA++ +GI
Sbjct: 407 YFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGI 466

Query: 442 SRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIG 501
           SRDDLP+KA+ MP+ AYYA+            TAFAP F   DF  AY+S+ LF A+W+ 
Sbjct: 467 SRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLS 526

Query: 502 FQIWFRGPLFKKTEDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           FQ+WF+  L  K +DID+D+DRR+I+  VW E E K  W++ W  ++
Sbjct: 527 FQVWFKCRLLWKLQDIDIDSDRRQIEELVWIEPECKTRWQRVWDVLS 573

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/509 (64%), Positives = 392/509 (77%), Gaps = 1/509 (0%)

Query: 41  QVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGE 100
           +V+R LK RHI MIALGGTIGTGL I I  PL++AGPVGALI+Y+F+GT+ Y V+QSLGE
Sbjct: 65  EVQRKLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGE 124

Query: 101 MATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLT 160
           MATFIPVTSSF VF QRFLSPALGA NGYMY+LSW  TFALELSV+GQ+IQ+WT AVPL 
Sbjct: 125 MATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTHAVPLA 184

Query: 161 AWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGK-TGPVGFR 219
           AWI+I W +L   N+ PVK+YGE EF IA IKV+ ++GFII++F +VCGAG+  GP+GFR
Sbjct: 185 AWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPIGFR 244

Query: 220 YWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAI 279
           YWRNPG WGPGIIS + NEGRFLGWVSSLI+AAFTYQGTELVGITAGEAANPRK VPRAI
Sbjct: 245 YWRNPGAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAI 304

Query: 280 NKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAV 339
            KV                     NDPKL S+ +++S+SPF+I+IENSGTKVLP IFNAV
Sbjct: 305 KKVVIRILVFYILSLFFIGLLVPYNDPKLDSDGTFVSASPFMISIENSGTKVLPDIFNAV 364

Query: 340 ILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLES 399
           +L TI SAGNS+VYI SRVLYS+  N LAPK L+  T+ G+PY AVL TSL GFLA+LE+
Sbjct: 365 VLITIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAFLET 424

Query: 400 SHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYY 459
           S G+   F+WLLNIT VAGFFAW+LIS +HIRFMQA+K +GISRDDLP+KA+ MP+ AYY
Sbjct: 425 SAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPFLAYY 484

Query: 460 AAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDIDL 519
           A+            TAFAP F   DF  AY+SV LF  +W+ FQ+WF+  L  K +DID+
Sbjct: 485 ASFFIALIVLIQGFTAFAPTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICKLQDIDI 544

Query: 520 DTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           D+DRREI+  VW E E K  W++ W  ++
Sbjct: 545 DSDRREIEEQVWIEPECKTRWQRVWDILS 573

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/518 (59%), Positives = 394/518 (76%), Gaps = 7/518 (1%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           ++ QVKR LK RHI MIALGGTIGTGLF+ I+TPL++AGPVGALIAY+F+G++ Y V+Q+
Sbjct: 80  EDKQVKRELKQRHIGMIALGGTIGTGLFVGIATPLADAGPVGALIAYIFMGSIVYFVTQA 139

Query: 98  LGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           LGEMATFIPVTSS  VF+QRFLSPA G ANGYMY+ +W+ITFA+E+SVVGQVIQ+WTDAV
Sbjct: 140 LGEMATFIPVTSSITVFSQRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIQYWTDAV 199

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPV 216
           PL AWI I WV++   N  PVK YGEVEFW+A +KV+AIVG+++YA I+VCG + K GP+
Sbjct: 200 PLAAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIAIVGYLLYALIIVCGGSKKQGPI 259

Query: 217 GFRYWRNPGPWGPGIISK------DVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAAN 270
           GFRYWRNPG WG G+ S          EGRFLGWV+SLI+AAFTYQGTELVGITAGEAAN
Sbjct: 260 GFRYWRNPGAWGNGLTSDGEPIYSSKYEGRFLGWVASLINAAFTYQGTELVGITAGEAAN 319

Query: 271 PRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTK 330
           PRKTVPRAINKV                      D +L  + + I+SSPFVI+IEN+GTK
Sbjct: 320 PRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPFTDSRLSDDTTVIASSPFVISIENAGTK 379

Query: 331 VLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSL 390
           +LP IFNA+++ T++SA NS+VY+ SRVLYS+    +APK     T+ G+P+  V+ TSL
Sbjct: 380 ILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTKVAPKIFARVTRQGVPFMGVICTSL 439

Query: 391 VGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKA 450
           +G LA+L   + A+  F+WL++I+ +AG  AW+ IS+AH+RFMQ LK +GISRDDLPFKA
Sbjct: 440 LGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFISLAHVRFMQVLKQRGISRDDLPFKA 499

Query: 451 KFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPL 510
           KFMPWG+YYAA             AF+P F+V+ FFT Y+S+IL   V+IG Q+++R   
Sbjct: 500 KFMPWGSYYAAFWVFVIIFVQGFQAFSPHFDVTTFFTDYISLILLAVVFIGAQLYYRCRF 559

Query: 511 FKKTEDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
             K ED+D+D+DRREI++ +WE+DEPK +W+KFW+A+A
Sbjct: 560 LWKLEDVDIDSDRREIEDAIWEDDEPKTIWDKFWAAIA 597

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/522 (60%), Positives = 390/522 (74%), Gaps = 1/522 (0%)

Query: 27  DVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMF 86
           D   L + G   +TQVKRALKPRH+ MIALGGTIGTGLF+ IS PLS +GPVG+LIAY+F
Sbjct: 87  DESGLPAKGKFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIF 146

Query: 87  IGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVV 146
           +G++ Y V+QSLGEMATFIPVTSS  VFT+RFLSPALG +NGYMY+ +W+ITFA ELSV 
Sbjct: 147 MGSVVYFVTQSLGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVT 206

Query: 147 GQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIM 206
           GQ+IQ+WT  VPL AWI I WV++   N  PVK YGE+EFW++ +KVLAIVG++IYA ++
Sbjct: 207 GQIIQYWTYKVPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVI 266

Query: 207 VCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAG 266
           VCG  + GP+GFRYWR+   +G G ISK+ +E RFLGWVSSLI+AAFTYQGTELVGI+AG
Sbjct: 267 VCGGSRQGPIGFRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAG 326

Query: 267 EAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIEN 326
           EAANPRKTVPRAINKV                     ND +L    + I+SSPFVI++ N
Sbjct: 327 EAANPRKTVPRAINKVIFRIALFYILSLFFIGLLVPYNDKRLSDGSAIIASSPFVISMLN 386

Query: 327 SGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVL 386
           +GT  LP IFNAVIL T++SA NSDVYI+SRVLY++   G APK  T+  + G+PY  V 
Sbjct: 387 AGTSALPDIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVF 446

Query: 387 TTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDL 446
            T LVG+LA+L  S+ A+  F+WL+NI+ +AG  AW  I  AHIRFMQALKH+GISRDDL
Sbjct: 447 VTCLVGWLAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDL 506

Query: 447 PFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWF 506
           PFKA+FMPWGAYYAA             AF P ++   FFT+Y+S+ILF  +++G  I++
Sbjct: 507 PFKARFMPWGAYYAAFFVGLIIFIQGYDAFTP-WDTKSFFTSYISLILFGVLYLGCLIYY 565

Query: 507 RGPLFKKTEDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           RG L  K EDID+DTDR+E++  VWEED P+N WEKFW+AVA
Sbjct: 566 RGRLLIKIEDIDIDTDRKEVEAYVWEEDAPRNWWEKFWAAVA 607

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/479 (64%), Positives = 372/479 (77%), Gaps = 1/479 (0%)

Query: 71  PLSNAGPVGALIAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYM 130
           PL++AGPVGALI+Y+F+GT+ Y V+QSLGEMATFIPVTSSF VF QRFLSPALGA NGYM
Sbjct: 19  PLAHAGPVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYM 78

Query: 131 YFLSWSITFALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIAC 190
           Y+LSW  TFALELSV+GQ+IQ+WTDAVPL+AWI+I W +L   N+ PVK+YGE EF IA 
Sbjct: 79  YWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIAS 138

Query: 191 IKVLAIVGFIIYAFIMVCGAGK-TGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLI 249
           IKV+A++GFIIY+F MVCGAG+  GP+GFRYWRNPG WGPGIIS D NEGRFLGWVSSLI
Sbjct: 139 IKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 198

Query: 250 SAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK 309
           +AAFTYQGTELVGITAGEAANPRK VPRAI KV                     NDPKL 
Sbjct: 199 NAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKLD 258

Query: 310 SEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAP 369
           S+ S++S+SPF+I+IENSGTKVLP IFNAV+L TI+SAGNS+VYI SRVLYS+  N LAP
Sbjct: 259 SDGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLAP 318

Query: 370 KYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAH 429
           ++L+  TK G+PY AVL TS+ GFLA+LE+S G+   F+WLLNIT VAGFFAW+LIS +H
Sbjct: 319 RFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSH 378

Query: 430 IRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAY 489
           IRFMQA+  +GISR+DLP+KA+ MP+ AYYA+            TAFAP F   DF  AY
Sbjct: 379 IRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAPSFQPVDFVAAY 438

Query: 490 VSVILFFAVWIGFQIWFRGPLFKKTEDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
           +SV LF A+W  FQ+WF+ P+  K +D+D+D+DRREI+  VW E   K  W+  W  +A
Sbjct: 439 ISVFLFVAIWFSFQLWFKCPIILKLQDVDIDSDRREIEEQVWIEPLRKTKWQCVWDVLA 497

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/516 (60%), Positives = 386/516 (74%), Gaps = 2/516 (0%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G  +ET+VKRALK RHISMIALGGTIGTGLFI I++PL  AGPVG+L+AY+FIGT+ Y +
Sbjct: 48  GDYQETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVVYSI 107

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
           +QSLGEMATFIPVTSS  VF++RFLSPA G ANGYMY+ +W+ITFA+ELSVVGQ+IQ+WT
Sbjct: 108 TQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIQYWT 167

Query: 155 DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
           D VP+ AWI+I WV++   N  PV+FYGE+EFWIA +KVL IVG++IYAFI+VCG  K G
Sbjct: 168 DRVPIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCGGSKQG 227

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGR-FLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
           P+G          G    S+   +   FLGWVSSLI AAFTYQGTELVGITAGE+ NPRK
Sbjct: 228 PIGLPATGGIPARGARASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAGESTNPRK 287

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVL 332
            VP+AINKV                     +DP+L SE S  +++SPFVI+I+N+GTK+L
Sbjct: 288 NVPKAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSESSTDVNASPFVISIKNAGTKIL 347

Query: 333 PHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVG 392
           P IFNAV+L T+ISA NS+VYI SRV YS+ L G APK L + TK G+PY  VL TSL+G
Sbjct: 348 PDIFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGVLITSLMG 407

Query: 393 FLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKF 452
            +++L  +H AS  FDWL+NI+ +AG  AW+ IS+AHIRFMQ LKH+GISRDDLPFKAKF
Sbjct: 408 LMSFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDLPFKAKF 467

Query: 453 MPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFK 512
           MPW AYYA             TAF PKF+V+ FFT+Y+S+ L   V+IG QI+++     
Sbjct: 468 MPWAAYYATFFVTVIIFIQGYTAFTPKFDVTTFFTSYISLFLMLLVFIGCQIYYKCRFLW 527

Query: 513 KTEDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548
             EDID+D+DRREID  VWEEDEPKN+W+KFWSAVA
Sbjct: 528 AVEDIDIDSDRREIDAIVWEEDEPKNIWDKFWSAVA 563

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/509 (58%), Positives = 383/509 (75%), Gaps = 3/509 (0%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
            ++ VKR LKPRH++MI+LGGTIGTGLFI I++P+ NAGPVG+L+AY+F+ T+AY V+QS
Sbjct: 45  NQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVTQS 104

Query: 98  LGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           LGEMATFIPVTSSF VF  RF+SPALGAANGY+Y+LSW ITFALE+SV+G++I +W+DAV
Sbjct: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
           P+TAW+ I WV+L + NL PVKFYGE EFWIA +KV+AI+ F+ Y  ++VCG  K G +G
Sbjct: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           FRYW++PGPWG GI+S++++  +FLGWVSSLI AAFT+QGTELVG+TAGE  NPR+TVP+
Sbjct: 225 FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSPFVIAIENSGTKVLPHI 335
           AIN V                     +DP+L  + S    ++SPFV+AI  +GTKVLP I
Sbjct: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            N VI+ TIISAGNS++Y+ SRVLY +G +GLAP +++ TT  G+PY AVL TS+ G L 
Sbjct: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           YL  S  +  VFDWLL+ITAV+GFF W+LISV+HIRFMQ LK +GISRDDLPFKAKFMP+
Sbjct: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464

Query: 456 GAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTE 515
           GAYYAA            TAF P F+  DF   Y+S  +F  +W+ FQ  F+G  F   +
Sbjct: 465 GAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVD 523

Query: 516 DIDLDTDRREIDNDVWEEDEPKNLWEKFW 544
           +ID+DTDRR+ID  +W++D+P  LW K W
Sbjct: 524 EIDIDTDRRDIDAIIWDDDKPTTLWGKIW 552

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  347 bits (891), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 199/530 (37%), Positives = 300/530 (56%), Gaps = 17/530 (3%)

Query: 23  SRSKDVVSLESL----GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPV 78
           S   D+ S ES     G     ++K+ L+ RH+SMIA+GG++GTGL I   T LS AGPV
Sbjct: 32  SNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMIAIGGSLGTGLLIGTGTSLSLAGPV 91

Query: 79  GALIAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSIT 138
             LIAY F+G L Y+V   LGEMAT+IP+   F  +  R+  PALG A GY Y   + I 
Sbjct: 92  SILIAYSFVGFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLII 150

Query: 139 FALELSVVGQVIQFWT--DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAI 196
              +L+    V+Q+W   + V    WI I  V++V+ N+  VKF+GE EFW++  KVL +
Sbjct: 151 TPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINVVGVKFFGEFEFWLSSFKVLVM 210

Query: 197 VGFIIYAFIMVCGAGKT-GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY 255
           +  I+  F+++ G G +   +GFR++++PG + P   +   ++G+F+ +V+  + A F Y
Sbjct: 211 LCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAY 270

Query: 256 QGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL---KSED 312
            GTEL GI A E  NPR+ VPRAI                        NDP L   K + 
Sbjct: 271 LGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQAKKKS 330

Query: 313 SYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYL 372
           +  ++SPFV+AI+N+G  VLPHIFNA +L  + SA NSD+Y++SR LY + ++  APK  
Sbjct: 331 TSAAASPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIF 390

Query: 373 TWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRF 432
             T K G+PY +++   L   LAY+  S G++ VF++ +N+ ++ G  +W+ I + +I F
Sbjct: 391 AKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYF 450

Query: 433 MQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFNVSDFFTAYVS 491
            +AL+ QG+ +  L + A     GAY+A             T F   KF+  +F T Y+ 
Sbjct: 451 DRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIG 510

Query: 492 VILFFAVWIGFQIWFRGPLFKKTEDIDLDTDRREIDNDVWEEDEPKNLWE 541
           + +F   + G++ + RG  F K E+ DL T +  ID    EE+E K LW+
Sbjct: 511 IPVFIICFFGYK-YIRGTKFVKPEEADLYTFKELID---LEEEEGK-LWD 555

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  345 bits (885), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 188/518 (36%), Positives = 283/518 (54%), Gaps = 13/518 (2%)

Query: 33  SLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAY 92
           S G     ++K+ LK RHISMIA+GG++GTGL I   T L   GP   LIAY F+G L +
Sbjct: 41  SDGKEDGVRLKKELKARHISMIAIGGSLGTGLLIGTGTALRTGGPASILIAYSFVGILVF 100

Query: 93  MVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQF 152
            V   LGEMAT+IP+   F  +  R+  PALG A GY Y   + I    +L+    VIQ+
Sbjct: 101 FVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQY 159

Query: 153 WTD--AVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGA 210
           W D   V    WI I  VV+V  N   V+++GE EFW++  K++ + G I++ FI++ G 
Sbjct: 160 WIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGG 219

Query: 211 G-KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAA 269
           G     +GFRYW+NPG + P   S   ++G+F+ +V+  + A F Y G EL GI A EA 
Sbjct: 220 GPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAE 279

Query: 270 NPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL---KSEDSYISSSPFVIAIEN 326
           NPR+ +PRAI                        NDP+L       +  ++SPFV+AI+N
Sbjct: 280 NPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLAAAHASTSAAASPFVVAIQN 339

Query: 327 SGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVL 386
           SG + LPHIFN  +L  + SA NSD+Y+ +R LYS+ ++G APK    T + G+PY A+ 
Sbjct: 340 SGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNALF 399

Query: 387 TTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDL 446
              L   LAY+  S G++ +F++ +N+ ++ G  +W+ I + +I F +A   Q + R+  
Sbjct: 400 GCFLFCLLAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSF 459

Query: 447 PFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWF 506
            ++A F P+GAY               T F  +F+   F T Y+ + L+   + G++I +
Sbjct: 460 AYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIY 519

Query: 507 RGPLFKKTEDIDLDT-----DRREIDNDVWEEDEPKNL 539
           +  L  K E+ DL +     DR E +  + E +  + L
Sbjct: 520 KTKLV-KAEEADLYSFKEAIDREEAEGKIKEAEAKERL 556

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  346 bits (888), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 185/510 (36%), Positives = 292/510 (57%), Gaps = 12/510 (2%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G  + T++++ LK RHISMIA+GG+IGTGL I     L  AGP+   IAY F+G L +  
Sbjct: 79  GKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTAGPMSMFIAYAFVGVLVFFT 138

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
             +LGEMA++IP+   F  +  R+  PALG A GY Y   + I    +L+    VIQ+W 
Sbjct: 139 MAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWL 197

Query: 155 DAVPLT--AWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGK 212
           D   +    WI I  V++V+ N   VKF+GE EFW++  KV+ ++G II  F+++ G G 
Sbjct: 198 DREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGP 257

Query: 213 T-GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271
           T   +GFR++ +PG + P   S D ++G+F+ +V+ L+ A F Y G EL GI A EAANP
Sbjct: 258 THDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYALFAYLGIELTGIVAAEAANP 317

Query: 272 RKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDP---KLKSEDSYISSSPFVIAIENSG 328
           RK++P+AI                        +DP   K K+  +  ++SP+V+AI NSG
Sbjct: 318 RKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKAKTSGTGAAASPYVVAIINSG 377

Query: 329 TKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTT 388
            K LPHIFNA +L  + SA NSD+Y++SR LY + ++  APK    T + G+PY ++L +
Sbjct: 378 IKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMS 437

Query: 389 SLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPF 448
           S    LAY+  S G++ +F++ +N+ ++ G  +W+ I + ++ F +A+K Q + R    +
Sbjct: 438 SCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAY 497

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFNVSDFFTAYVSVILFFAVWIGFQIWFR 507
           +A F P+G+Y+              T F    F+  +F T Y+ + +F   + G++   +
Sbjct: 498 RAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKK 557

Query: 508 GPLFKKTEDIDLDTDRREIDNDVWEEDEPK 537
             ++K  E++DL T +  ID    EE++ K
Sbjct: 558 TKIWKP-EEVDLYTFKAAIDE---EEEQGK 583

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  343 bits (881), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 191/510 (37%), Positives = 290/510 (56%), Gaps = 14/510 (2%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G  +  ++K+ LK RH+SMIA+GG++GTGL I   T L+ AGP    I Y F+G L +  
Sbjct: 57  GKTEGFRLKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFFT 116

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
              LGEMA FIP+   F  +  R++ PALG A GY Y   + I  A +L+    V+Q+W 
Sbjct: 117 MSCLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQYWV 175

Query: 155 DAVPLT--AWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG- 211
           D   L    +I I  +++V+ N+  VK +GE EFW++  KVL ++G I+  FI++ G G 
Sbjct: 176 DRDTLNPGVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGGGP 235

Query: 212 KTGPVGFRYWRNPG---PWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEA 268
               +GFRYWR+PG   P+   IIS   + G+F+ + S  + A F Y G EL GI A EA
Sbjct: 236 NHDRLGFRYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAAEA 295

Query: 269 ANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDP---KLKSEDSYISSSPFVIAIE 325
            NPRK +P+AI                        NDP   K   + +  ++SPFV+AIE
Sbjct: 296 QNPRKNIPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVAIE 355

Query: 326 NSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAV 385
           NSG  +LPHIFN  +L+ ++SA NSD+Y++SR LYS+ ++  APK+   T K GIPY ++
Sbjct: 356 NSGINILPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYWSL 415

Query: 386 LTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDD 445
             ++    LAY+  S  AS VF++ +N  ++ G  +W+ I V +I F +A K QG+ + +
Sbjct: 416 AFSTAFSCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKSN 475

Query: 446 LPFKAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFNVSDFFTAYVSVILFFAVWIGFQI 504
             + A + P+GAY+A             T F   +F+  +F T Y+ + +FF  ++G++I
Sbjct: 476 FTYVAPWQPYGAYFALFFCCVLALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGYKI 535

Query: 505 WFRGPLFKKTEDIDLDTDRREIDNDVWEED 534
            ++     + E++DL T +  ID +  EED
Sbjct: 536 VYKTKT-HRPEEVDLVTLKALIDQE--EED 562

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  342 bits (877), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 192/516 (37%), Positives = 295/516 (57%), Gaps = 14/516 (2%)

Query: 42  VKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEM 101
           +K+ L+ RH+SMIA+GG++GTGL I   T LS AGP    IAY F+G L +    ++GEM
Sbjct: 99  LKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMAAIGEM 158

Query: 102 ATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW--TDAVPL 159
           A++IP+   F  +  R++ PALG A GY Y   + I    +L+    VIQ+W   D V  
Sbjct: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217

Query: 160 TAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KTGPVGF 218
             WI I  VV+V  N+A VKF+GE EFW++  KVL ++G I+  FI++ G G     +GF
Sbjct: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDHDRLGF 277

Query: 219 RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRA 278
           RYW++PG + P   + D + G+F+ +VS  + A F Y G EL GI A EA NPRK+VPRA
Sbjct: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337

Query: 279 INKVXXXXXXXXXXXXXXXXXXXXXNDPKL---KSEDSYISSSPFVIAIENSGTKVLPHI 335
           +                        NDP+L   K   +  ++SPFV+AI+NSG +VLPHI
Sbjct: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIRVLPHI 397

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
           FNA +L  + SA NSD+Y+ SR LYS+ ++G AP     TT  G+P+ ++    L   LA
Sbjct: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           Y+  S G++ VF++ +N+ ++ G  +W+ I + +I FM+A+K QG+ R    + A F P+
Sbjct: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517

Query: 456 GAYYAAXXXXXXXXXXXXTAF-APKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKT 514
           G Y++             T F    F+  +F T Y+ + +F   + G++ + +     K+
Sbjct: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYK-FIKKTKIVKS 576

Query: 515 EDIDLDT-----DRREIDNDVWEEDEPKNLWEKFWS 545
            ++DL T     D++EI+  + ++++   L E  +S
Sbjct: 577 HEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFS 612

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  338 bits (868), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 198/537 (36%), Positives = 295/537 (54%), Gaps = 26/537 (4%)

Query: 30  SLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGT 89
           S  SL       +K+ LK RH+ +IALGG IGTGLF+  S+ L   GP G  IAY  I +
Sbjct: 63  STNSLEEDYTNTLKQGLKSRHVQLIALGGCIGTGLFVGTSSTLHTCGPAGLFIAYCIISS 122

Query: 90  LAYMVSQSLGEMATFIP-----VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELS 144
           + Y +  ++GEM  ++P        S     +R++  +L  A G+ YF  + I  A E +
Sbjct: 123 VIYPIMNAVGEMVCYLPGDGHDSAGSVTHLVKRYVDESLAFATGWNYFYCYVILVAAECT 182

Query: 145 VVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAF 204
               V+++WT AVP  AWI I   ++   N++ VK++GE EFW A IK+L I+G II +F
Sbjct: 183 AAAGVVEYWTLAVPKAAWITIFLAIIFLLNMSSVKYFGETEFWFASIKILCIMGLIILSF 242

Query: 205 IMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVG 262
           I+  G G +   +GFRYW+NPG +   +   D + G FL   S +I  AF +  G ELV 
Sbjct: 243 ILFWGGGPSHDRLGFRYWKNPGAFAHHV--TDGSLGNFLDIYSGIIKGAFAFILGPELVA 300

Query: 263 ITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYIS----SS 318
           +T+ E ++ R+ + +A  +                      NDP L S  S  +    SS
Sbjct: 301 LTSSECSDQRRNIAKASKRFIYRLMFFYILGTLAIGVIVAWNDPVLASALSNNTPGAGSS 360

Query: 319 PFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKS 378
           PFVI I+N+G +VLPHI NA IL++  S+GN+ ++ SSR L++M  NG APK      K 
Sbjct: 361 PFVIGIQNAGIEVLPHIINACILTSAWSSGNAFMFASSRSLFTMAQNGTAPKIFGRINKY 420

Query: 379 GIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKH 438
           G+PY AV+ ++L+  LAYL +S  A+ VF WL NI+ ++GF  W+   +A++RF +A+ +
Sbjct: 421 GVPYMAVILSTLISCLAYLNASSSAARVFTWLSNISTISGFLGWICACIAYLRFRKAIFY 480

Query: 439 QGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF-NVSDFFTAYVSVILFFA 497
             +  D +PFK    P+   ++               F PKF NVSDF  AY+++ +F A
Sbjct: 481 NNL-YDRMPFKTWGQPYLILWSLTVVSIITITNGYQTFIPKFWNVSDFIAAYITLPIFLA 539

Query: 498 VWIGFQIW--FRG--PLFK---KTEDIDLDTDRREIDNDVWEEDE----PKNLWEKF 543
           +++G +++  F+   PL K     EDID+ T   EI+    E DE    P N WE+F
Sbjct: 540 LYVGHKVYNHFKNDYPLMKLAYSVEDIDVITGLDEIETKTCELDENRILPTNRWERF 596

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  338 bits (867), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 193/517 (37%), Positives = 294/517 (56%), Gaps = 14/517 (2%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G  + T++K+ LK RHISMIA+GG++GTGL I   T L   GPV  LIAY F+G L +  
Sbjct: 73  GKDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFFT 132

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW- 153
              LGEMA++IP+   F  +  R++ PALG A GY Y   + I    +L+    VIQ+W 
Sbjct: 133 MACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191

Query: 154 -TDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG- 211
             D V    WI I  VV+V+ N+  VKF+GE EFW++  KV+ ++G I+  FI++ G G 
Sbjct: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 251

Query: 212 KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271
               +GFRYWR+PG +     +   + G+F  +V+  + + F+Y G EL GI   EA NP
Sbjct: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311

Query: 272 RKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL---KSEDSYISSSPFVIAIENSG 328
           RK+VP+AI                        NDP+L   K +    ++SPFV+AI+NSG
Sbjct: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371

Query: 329 TKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTT 388
            KVLPHIFNA +L  + SA NSD+Y+SSR LY++ ++G APK    T+K G+PY A++ +
Sbjct: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431

Query: 389 SLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPF 448
            L   LAY+  S G++ +F++ +N+ ++ G  +W+ I + +I F +A + QGI +    +
Sbjct: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFNVSDFFTAYVSVILFFAVWIGFQIWFR 507
            A    +GAY+A             T F   KF+   F T Y+ + ++   W G+++ ++
Sbjct: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYK 551

Query: 508 GPLFKKTEDIDLDT-----DRREIDNDVWEEDEPKNL 539
             + K T D+DL T     DR E +  + +++  + L
Sbjct: 552 TKVIKST-DVDLYTFKEIYDREEEEGRIKDQEREERL 587

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  337 bits (864), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 184/513 (35%), Positives = 288/513 (56%), Gaps = 15/513 (2%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G    T++K+ LK RHISMIA+GG++GTGL I   T L  AGP   LIAY F+GTL +  
Sbjct: 75  GKDDGTRLKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFFT 134

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
             +LGEMA +IP+   F  +  R+  PALG A GY Y   + I    +L+    VIQ+W 
Sbjct: 135 MAALGEMAAYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYWV 193

Query: 155 D--AVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG- 211
           D   V    WI I  VV+++ N   VK++GE EFW++  K++ ++G +I+ F+++ G G 
Sbjct: 194 DRDTVNPGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGGP 253

Query: 212 KTGPVGFRYWRNPG---PWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEA 268
               +GFRYW+ PG   P+   +++ + + G+F+ +V+  + A F Y G EL GI A EA
Sbjct: 254 NHDRLGFRYWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAEA 313

Query: 269 ANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL---KSEDSYISSSPFVIAIE 325
            NPR+ +PRAI                        +DP L    +  +  ++SPFV+AI+
Sbjct: 314 ENPRRNIPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAIQ 373

Query: 326 NSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAV 385
           NSG  VLPHIFN  +L  + SA NSD+Y+ +R LYS+ ++G APK    T + G+PY A+
Sbjct: 374 NSGVDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNAM 433

Query: 386 LTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDD 445
               L   LAY+  S G++ +F++ +N+ ++ G  +W  I +  I F +A++ QGI R  
Sbjct: 434 GGCVLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRST 493

Query: 446 LPFKAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFNVSDFFTAYVSVILFFAVWIGFQI 504
             + A F P+G+Y+A             + F   +F+   F T Y+ + ++   +IG+++
Sbjct: 494 FAYVAPFQPYGSYFALFFCVLLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIGYKL 553

Query: 505 WFRGPLFKKTEDIDLDTDRREIDNDVWEEDEPK 537
           +++    K  E  DL++ +  +D    EE+E K
Sbjct: 554 YYKTKTVKPHE-ADLNSYKAAVDR---EEEEGK 582

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  333 bits (854), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 199/531 (37%), Positives = 300/531 (56%), Gaps = 24/531 (4%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G  + T++++ LK RHISMIA+GG++GTGL I   T L   GPV  LIAY F+G L +  
Sbjct: 74  GKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALMTGGPVAMLIAYAFVGLLVFFT 133

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
              LGEMA++IP+   F  +  R++ PALG A GY Y   + I    +L+    VIQ+W 
Sbjct: 134 MACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWV 192

Query: 155 --DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG- 211
             D V    WI I  VV+V+ N+  VKF+GE EFW++  KVL ++G I+  FI++ G G 
Sbjct: 193 SRDRVNPGVWITIFMVVIVAINVIGVKFFGEFEFWLSSFKVLVMLGLILLLFIIMLGGGP 252

Query: 212 KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271
               +GFRYWR+PG +     +    +G+F+ +++  + + F+Y G EL GI   EA NP
Sbjct: 253 DHDRLGFRYWRDPGAFKEYSAAIGGGKGKFVSFLAVFVYSLFSYTGIELTGIVCSEAQNP 312

Query: 272 RKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL---KSEDSYISSSPFVIAIENSG 328
           RK+VP+AI                        NDP+L   K +    ++SPFV+AI+NSG
Sbjct: 313 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLISTKGKALSAAASPFVVAIQNSG 372

Query: 329 TKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTT 388
            KVLPHIFNA +L  + SA NSD+Y+SSR LY++ ++G APK  + T K G+PY A++ +
Sbjct: 373 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFSKTNKWGVPYNALIFS 432

Query: 389 SLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPF 448
            L   LAY+  S G++ +F++ +N+ ++ G  +W+ I + +I F +A + QGI +    +
Sbjct: 433 VLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 492

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFNVSDFFTAYVSVILFFAVWIGFQIWFR 507
            A    +GAY+A             T F   KF+   F T Y+ + ++   W+G+++ ++
Sbjct: 493 VAPGQRYGAYFALVFCIFIALIKNFTVFLGHKFDYKTFITGYIGLPVYVFSWVGYKLIYK 552

Query: 508 GPLFKKTEDIDLDT-----DRRE----IDNDVWEEDEPKN------LWEKF 543
             + K T D+DL T     DR E    I++   EE   KN       +EKF
Sbjct: 553 TKVIKST-DVDLYTFKEIYDREEEQGKIEDQEKEERLKKNGKNMEWFYEKF 602

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  333 bits (854), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/529 (36%), Positives = 294/529 (55%), Gaps = 14/529 (2%)

Query: 23  SRSKDVVSLESL--GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGA 80
           S  K+VV+  S   G     ++K+AL+ RH+SMIA+GG++GTGL I   + L+ AGP   
Sbjct: 58  SDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAI 117

Query: 81  LIAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFA 140
           LIAY F+G L + V   LGEMA +IP+   F  ++ R+  PALG A GY Y   + I   
Sbjct: 118 LIAYAFVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVP 176

Query: 141 LELSVVGQVIQFWTD--AVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVG 198
            +L+    VIQ+W D   V    WI IL V +++ N   V+F+GE+E++I+ +K+  ++G
Sbjct: 177 NQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLG 236

Query: 199 FIIYAFIMVCGAGKTGPV-GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQG 257
            II   ++ CG G    V GF+YW+NPG +     +    +GRF+ + S  + A F Y G
Sbjct: 237 LIILLLVLACGGGPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLG 296

Query: 258 TELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL---KSEDSY 314
           TEL GI   E  NPRK VP+AI                        NDP L   KS  + 
Sbjct: 297 TELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTS 356

Query: 315 ISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTW 374
            S+SPFV+AI N+G  VLPHI NA IL  + SA NSD+Y++SR LY + ++  AP+    
Sbjct: 357 ASASPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAK 416

Query: 375 TTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQ 434
           T K G+PY ++L   L   LAY+  S G+S VF + +N  ++ G  +W+ I + +IRF +
Sbjct: 417 TNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDK 476

Query: 435 ALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFNVSDFFTAYVSVI 493
           A + QGI +  L +++   P+GA+++              AF    F+   F T Y+ + 
Sbjct: 477 AFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFITGYIGIP 536

Query: 494 LFFAVWIGFQIWFRGPLFKKTEDIDLDTDRREIDNDVWEEDEPKNLWEK 542
            +   +IG+++W++  +   +E++DL + +  +D    EE+E K L E+
Sbjct: 537 TYIISYIGYKLWYKTKII-PSEEVDLVSFKEAVD---LEEEEGKMLDEE 581

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  333 bits (854), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/517 (36%), Positives = 296/517 (57%), Gaps = 14/517 (2%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G  + T++++ LK RHISMIA+GG++GTGL I   T L   GPV  LIAY F+G L +  
Sbjct: 75  GKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFYT 134

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW- 153
              LGEMA++IP+   F  +  R++ PALG A GY Y   + I    +L+    VIQ+W 
Sbjct: 135 MACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193

Query: 154 -TDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG- 211
             D V    WI I  VV+V+ N+  VKF+GE EFW++  KV+ ++G I+  FI++ G G 
Sbjct: 194 SRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 253

Query: 212 KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271
               +GFRYWR+PG +     +    +G+F+ +V+  + + F+Y G EL GI   EA NP
Sbjct: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313

Query: 272 RKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL---KSEDSYISSSPFVIAIENSG 328
           RK+VP+AI                        NDP+L   K +    ++SPFV+AI+NSG
Sbjct: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373

Query: 329 TKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTT 388
            +VLPHIFNA +L  + SA NSD+Y+SSR LY++ ++G APK    T++ G+PY A++ +
Sbjct: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433

Query: 389 SLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPF 448
            L   LAY+  S G++ +F++ +N+ ++ G  +W+ I + +I F +A + QGI +    +
Sbjct: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFNVSDFFTAYVSVILFFAVWIGFQIWFR 507
            A    +GAY+A             T F   KF+   F T Y+ + ++   W G+++ ++
Sbjct: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYK 553

Query: 508 GPLFKKTEDIDLDT-----DRREIDNDVWEEDEPKNL 539
             + K T D+DL T     DR E +  + ++++ + L
Sbjct: 554 TKVIKST-DVDLYTFKEIYDREEEEGRMKDQEKEERL 589

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  330 bits (847), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 198/529 (37%), Positives = 283/529 (53%), Gaps = 25/529 (4%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
           E ++++ L  RHI +IALGG IGTGLF+  S+ L   GP G  I+Y+ I T+ Y +  + 
Sbjct: 53  EGKLQQGLSARHIQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYVIISTVLYPIMNAF 112

Query: 99  GEMATFIP-----VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW 153
           GEM  ++P        S      R++ P+L  A G+ YF  + I  A E +    V+++W
Sbjct: 113 GEMVCYLPGNGDDSAGSVSHLVDRYVDPSLSFATGWNYFYCYVILVAAECTAASGVVKYW 172

Query: 154 TDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKT 213
           TDAVP  AWI I   ++V  NL  VK+YGE EFW A IKVL IVG II +FI+  G G  
Sbjct: 173 TDAVPTAAWITIFLSIVVLLNLCAVKYYGETEFWFASIKVLCIVGLIILSFILFWGGGPN 232

Query: 214 -GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVGITAGEAANP 271
              +GFRYW+NPG +   I     N G FL   S +I  AF +  G EL+ + + E  + 
Sbjct: 233 HDRLGFRYWKNPGGFAHHITGG--NLGNFLDVYSGIIKGAFAFILGPELIALASSECKDQ 290

Query: 272 RKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSE----DSYISSSPFVIAIENS 327
           R+ + +A  +                      NDP L S          SSPFVI I+N+
Sbjct: 291 RRNIMKASKRFVWRLMFFYILGALSISVIVASNDPALTSALASGKPGAGSSPFVIGIQNA 350

Query: 328 GTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLT 387
           G K+LPHI NA IL++  SAGN+ ++ SSR L +M  NG APK      + G+P+ AV  
Sbjct: 351 GIKILPHIINACILTSAWSAGNAFMFASSRSLLTMASNGQAPKIFGKINRFGVPWVAVTF 410

Query: 388 TSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLP 447
           ++L+  LAYL  S   + VF W  NI+ ++GF  W    VA++RF +A+K+ G+  + LP
Sbjct: 411 SALISCLAYLNVSSSTADVFAWFTNISTISGFIGWDCGLVAYLRFRKAIKYNGL-ENRLP 469

Query: 448 FKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF-NVSDFFTAYVSVILFFAVWIGFQIWF 506
           +  +F  +  +++               F P+F NVSDF  AY+++ LF  +WIG +I+ 
Sbjct: 470 YAPRFQQYMVWWSILVVTLVIFTNGYQVFIPRFWNVSDFIAAYITLPLFVVLWIGHKIYT 529

Query: 507 RGPLFKK----TEDIDLDTDRREIDNDVW----EEDEPKNLWEKFWSAV 547
           R   FKK     E+ID+ T   EI+        E  EPK  + KF  A+
Sbjct: 530 RD--FKKWWYPVEEIDVVTGLTEIEERTRILDEERVEPKGAFPKFMDAL 576

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  330 bits (845), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 194/541 (35%), Positives = 292/541 (53%), Gaps = 25/541 (4%)

Query: 25  SKDVVSLESLGSVKETQ----VKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGA 80
           ++ + +L + GS  + +    +K+ L+ RHI +IALGG IGTGLF+  S+ LS  GP G 
Sbjct: 28  TESLSALNTGGSESQKREPHTLKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGL 87

Query: 81  LIAYMFIGTLAYMVSQSLGEMATFIPVTS-----SFMVFTQRFLSPALGAANGYMYFLSW 135
           L +Y+ I  + Y V  +LGEM  ++P +      S      R+  P+LG A G+ Y+  +
Sbjct: 88  LTSYIIISLVIYPVMNALGEMVCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYCY 147

Query: 136 SITFALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLA 195
            I  A E +    V+ +WT  VP  AWI I   V+   N  PVKFYGE EFW A +K+L 
Sbjct: 148 VILIAAECTAASGVVTYWTTVVPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKILC 207

Query: 196 IVGFIIYAFIMVCGAGKT-GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFT 254
           IVG +  +FI+  G G +   +GFRYW+ PG +   I +   N GRFL   + +I   F 
Sbjct: 208 IVGLLFVSFILFWGGGPSHDRLGFRYWQKPGAFAYHITTG--NTGRFLDVWTGVIKGGFA 265

Query: 255 Y-QGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK---- 309
           +  G ELV +T+ EA + R+ + +A  +                      NDP L+    
Sbjct: 266 FILGPELVAVTSSEAMDQRRNIEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDALA 325

Query: 310 SEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAP 369
           S  +  +SSPFVIAI+N+  K+LPHI NA ILS+  S+GNS ++ +SR L SM  +G+AP
Sbjct: 326 SGKAGAASSPFVIAIQNAHIKILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGVAP 385

Query: 370 KYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAH 429
           K      ++G+PY AV  ++    LAYL  S G++  F W  NI+ ++GF  W+ I VA+
Sbjct: 386 KMFKKINRAGVPYNAVAVSAAFSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIGVAY 445

Query: 430 IRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF-NVSDFFTA 488
           +RF +A+  +G+  D +PFK+ F P+G Y+                F P+F   +DF  A
Sbjct: 446 LRFRKAIFFRGL-YDRVPFKSPFQPYGTYFFIIVVSIICLTNGYATFIPRFWKGADFVAA 504

Query: 489 YVSVILFFAVWIGFQIWFR--GPLFKKTEDIDLDTDRREIDNDVWEEDE----PKNLWEK 542
           Y+++ +F  +W+G +I+ R          ++D+ T   EI+    E D     P + WEK
Sbjct: 505 YITLPVFVVLWVGHKIYTRTLSTWVIPVAEVDVTTGLAEIEELTKELDALRVPPNSAWEK 564

Query: 543 F 543
           F
Sbjct: 565 F 565

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  328 bits (842), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 191/521 (36%), Positives = 291/521 (55%), Gaps = 20/521 (3%)

Query: 25  SKDVVSLESLGSVKET-----------QVKRALKPRHISMIALGGTIGTGLFISISTPLS 73
            + +V+LES G V+             ++K+ L+ RH+SMIA+GG++GTGL I   + L+
Sbjct: 22  EEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMIAIGGSLGTGLLIGTGSSLA 81

Query: 74  NAGPVGALIAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFL 133
           +AGPV  LI+Y F+G L Y V   LGEMA FIP+   F  +  R++ PA+G A GY Y  
Sbjct: 82  SAGPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLF 140

Query: 134 SWSITFALELSVVGQVIQFWT--DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACI 191
            + I    +L+    V+QFW   D V    WI I   ++V  N   V+F+GE EFW++ +
Sbjct: 141 KYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSV 200

Query: 192 KVLAIVGFIIYAFIMVCGAGKT-GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLIS 250
           KVL ++G I+  FI++ G G      GFR+WR+PG + P   +   ++G+F+ + S    
Sbjct: 201 KVLVMLGLILLLFIIMLGGGPNHDRTGFRFWRDPGAFKPYSEAISGSKGKFVSFASVFAL 260

Query: 251 AAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-- 308
           A F Y GTEL GI A EA NPR++VPRAI                        NDP+L  
Sbjct: 261 ALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLK 320

Query: 309 -KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGL 367
            K   +  ++SPFV+AIEN+   VLPHIFN  +L  + SA NSD+Y++SR LY + ++G 
Sbjct: 321 AKKMATSAAASPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGK 380

Query: 368 APKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISV 427
           AP+    T K G+PY ++  + L   LAY+  S G++ VF++ +N+ ++ G  +W+ I +
Sbjct: 381 APRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILI 440

Query: 428 AHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFNVSDFF 486
            +IRF +A++ Q   +  L + A F PW  Y A             T F   KF+   F 
Sbjct: 441 TYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFI 500

Query: 487 TAYVSVILFFAVWIGFQIWFRGPLFKKTEDIDLDTDRREID 527
           + Y+ + ++   ++G+++ +R  L K  ED+DL T +  ID
Sbjct: 501 SGYIGIPVYLICYVGYKVVYRTKLIKP-EDVDLYTFKDAID 540

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  328 bits (840), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 187/516 (36%), Positives = 283/516 (54%), Gaps = 12/516 (2%)

Query: 37  VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQ 96
             E  +++ L  RHI +IALGG IGTGLF+  S+ L N GP+   ++++ I  + Y V  
Sbjct: 41  CDENNLEKGLSSRHIQLIALGGCIGTGLFVGTSSTLHNCGPLPLFLSFVIISFIVYPVMN 100

Query: 97  SLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
           +L EM  ++P   +    T R++ P+LG A G+ Y  S+SI  A ELS    V+Q+WTD 
Sbjct: 101 TLAEMICYLPQQGTVPELTSRYVDPSLGFAAGWNYAYSYSILVATELSAAAGVVQYWTDK 160

Query: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAF-IMVCGAGKTGP 215
           V +  WI I  V++V  N APVKFYGE EFW A +K++ I+G +I +  I   GA     
Sbjct: 161 VHVAVWITIFLVIVVGLNFAPVKFYGESEFWFASLKIICILGLLIVSIVIFFGGAPSHDR 220

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVGITAGEAANPRKT 274
           +GFRYW NPGP+   I     N GRFL   +++I + F +    EL+G+   EA + R+ 
Sbjct: 221 LGFRYWNNPGPFAYHITGG--NTGRFLDIWTAIIKSGFAFILSPELIGLACVEAKDTRRN 278

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPK----LKSEDSYISSSPFVIAIENSGTK 330
           + +A  +                      +DPK    L S+    +SSPFV  I N+G  
Sbjct: 279 IEKASRRFIWRIIFFYITSTLCIGFILSRDDPKLIQALTSDAPGAASSPFVQGISNAGIP 338

Query: 331 VLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSL 390
           VL HI NAVILS+  S+ NS +Y SSR + ++   G APK  T   + G+PY AV  ++ 
Sbjct: 339 VLNHIINAVILSSAWSSANSFMYASSRSILALAKQGDAPKVFTRINRLGVPYNAVALSTA 398

Query: 391 VGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKA 450
           V  L YL +S  ++ VF WL NI  ++GF  W LI + ++RF +A+ +  +  + +PFK+
Sbjct: 399 VSCLTYLNASSSSAQVFTWLSNICTISGFIGWALIGITYLRFRKAIFYNNL-YERVPFKS 457

Query: 451 KFMPWGAYYAAXXXXXXXXXXXXTAFAPKF-NVSDFFTAYVSVILFFAVWIGFQIWFRGP 509
              P+  Y+                F PK+ N SDF  AY+++ +FF +++G +IWF+  
Sbjct: 458 ALQPYFTYFFVVFVVLLCLTNGYATFIPKYWNASDFVAAYITLPIFFLLYLGHKIWFKTR 517

Query: 510 LFKKTEDIDLDTDRREIDND--VWEEDEPKNLWEKF 543
            +    +ID+ T   + + +  + +   PKN+WEKF
Sbjct: 518 WYIPFREIDVITGLADAEEEAKMTQPRTPKNMWEKF 553

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  328 bits (841), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 189/507 (37%), Positives = 286/507 (56%), Gaps = 11/507 (2%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G   + ++K+ LK RH+SMIA+GG++GTGL I     L+ AGPV  LI+Y F+G L + V
Sbjct: 55  GKCSDQRLKKDLKARHVSMIAIGGSLGTGLLIGTGNSLAVAGPVSMLISYSFVGVLVFFV 114

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW- 153
              +GEMA +IP+   F  +  R+  PALG A GY Y + + I    +L+    VIQ+W 
Sbjct: 115 MSCIGEMAAYIPL-DGFTSYASRYCDPALGFAVGYAYLVKYFILPPNQLTAAALVIQYWI 173

Query: 154 -TDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGK 212
             + V    WI I+ VV+V  N   VKF+GE EFW++  KV+ ++G II  FI++ G   
Sbjct: 174 PREKVNPGVWITIVLVVIVVINTFGVKFFGEFEFWLSSFKVIVMLGLIILMFIIMLGGTP 233

Query: 213 T-GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271
           T   +GFRYW++PG +     S   + GRF+ +VS  +   F Y G EL GI A EA NP
Sbjct: 234 THDRLGFRYWKHPGAFKEYSKSIHGDIGRFVSFVSCFVYGLFCYLGIELTGIVAAEAENP 293

Query: 272 RKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL---KSEDSYISSSPFVIAIENSG 328
           RK +P+AI                        NDP L   K++ +  ++SPFV+AI NSG
Sbjct: 294 RKNIPKAIKLTMWRIIIFYIITIFLLGMCVSSNDPLLLEAKTKSTSAAASPFVVAIVNSG 353

Query: 329 TKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTT 388
            + LPHIFNA +L  + SA NSD+Y++SR LYS+ ++  APK    T + GIPY ++   
Sbjct: 354 IEALPHIFNACVLMFVFSACNSDLYVASRNLYSLAIDNKAPKIFAKTNRFGIPYNSLGVA 413

Query: 389 SLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPF 448
            L   LAY+  S G++ +F++ +N+ ++ G   W+ I + +I F +A++ QGI +    +
Sbjct: 414 VLFCLLAYMSVSSGSAKIFNYFVNVVSITGVLTWISILITYICFDRAVRAQGIDKSTFAY 473

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFNVSDFFTAYVSVILFFAVWIGFQIWFR 507
            A   P+GAY++             T F   KF+  +F T Y+ + LFF  + G++ + +
Sbjct: 474 VAPLQPYGAYFSLFFCCLLALIKNFTVFLNHKFDYRNFITGYIGLPLFFICYFGYK-FVK 532

Query: 508 GPLFKKTEDIDLDTDRREIDNDVWEED 534
               +K E++DL + +  ID +  EED
Sbjct: 533 KTKIRKPEEVDLFSFKAAIDQE--EED 557

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  327 bits (838), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 192/513 (37%), Positives = 273/513 (53%), Gaps = 17/513 (3%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
           +  +K+ LK RHI +IALGG IGTGLF+  S+ L   GP G   +Y  I  + Y V  +L
Sbjct: 48  DHTLKKGLKSRHIQLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMNAL 107

Query: 99  GEMATFIPVTSSFMV-----FTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW 153
           GEM  ++P   S           R++ P+LG A G+ Y+  + I  A E +    V+Q+W
Sbjct: 108 GEMVCYLPGDGSSSGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQYW 167

Query: 154 TDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-K 212
           T AVP  AWI I   V+V  N   VKFYGE EFW A +K+L I+G +  +FI+  G G  
Sbjct: 168 TTAVPKGAWITIFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGGPH 227

Query: 213 TGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVGITAGEAANP 271
              +GFRYW+ PG +   I S   N GRFL   + +I   F +  G ELV +T+ EA + 
Sbjct: 228 HDRLGFRYWQKPGAFAYHITSG--NTGRFLDIWTGVIKGGFAFILGPELVALTSAEAQDA 285

Query: 272 RKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSE----DSYISSSPFVIAIENS 327
           R+ + +A  +                      ND  L +          SSPFVI I+N+
Sbjct: 286 RRNIQKASRRFVYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQNA 345

Query: 328 GTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLT 387
           G KVLPHI N  ILS+  S+GNS ++ +SR L SM   G APK L    + G+PYAAV  
Sbjct: 346 GIKVLPHIINVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAVAL 405

Query: 388 TSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLP 447
           TSL+  +AYL  S   + VF W  NI+ ++GF  W+ I +A++RF +A+  Q +  + +P
Sbjct: 406 TSLLSCIAYLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQNL-YERVP 464

Query: 448 FKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-KFNVSDFFTAYVSVILFFAVWIGFQIWF 506
           FK  F P+G ++                F P  +NVSDF  AYV++ +F  +WIG ++W 
Sbjct: 465 FKTPFQPYGTWFFIIAVSVICLTNGYAIFIPANWNVSDFIAAYVTLPIFLVLWIGHKLWT 524

Query: 507 R--GPLFKKTEDIDLDTDRREIDNDVWEEDEPK 537
           R          +ID+ T  +EI+ +  E DE +
Sbjct: 525 RTWKTWAIPVPEIDVTTGLKEIEEESKECDEKR 557

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  327 bits (838), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 187/517 (36%), Positives = 292/517 (56%), Gaps = 14/517 (2%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G  + T++++ LK RHISMIA+GG++GTGL I   T L   GPV  LIAY F+G L +  
Sbjct: 73  GKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFFT 132

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
              LGEMA++IP+   F  +  R++ PALG A GY Y   + I    +L+    VIQ+W 
Sbjct: 133 MACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWV 191

Query: 155 --DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG- 211
             D V    WI I  VV+V+ N+  V+F+GE EFW++  KV+ ++G I+  FI++ G G 
Sbjct: 192 SRDRVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 251

Query: 212 KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271
               +GFRYWR+PG +     +   ++G+F+ + S  + + F+Y G EL GI   EA NP
Sbjct: 252 DHDRLGFRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGIVCSEAKNP 311

Query: 272 RKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL---KSEDSYISSSPFVIAIENSG 328
           RK+VP+AI                        NDP+L   K +    ++SPFV+AI+NSG
Sbjct: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQNSG 371

Query: 329 TKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTT 388
            KVLPHIFN  +L  + SA NSD+Y+SSR LY++ ++G APK    T+K G+PY A++ +
Sbjct: 372 IKVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYALMVS 431

Query: 389 SLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPF 448
            L   LAY+  S G++ +F++ +N+ ++ G  +W+ I + +I F +A + QG+ +    +
Sbjct: 432 VLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDKSKFAY 491

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFNVSDFFTAYVSVILFFAVWIGFQIWFR 507
            A    +GAY+A             T F    F+   F T Y+ + ++   W+G+++ ++
Sbjct: 492 VAPGQRYGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLPIYVFSWVGYKLIYK 551

Query: 508 GPLFKKTEDIDLDT-----DRREIDNDVWEEDEPKNL 539
             + K   D DL T     DR E    + ++++ + L
Sbjct: 552 TKVVKPA-DADLYTLKEIYDREEEQGKLQDQEKEERL 587

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  325 bits (833), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 190/510 (37%), Positives = 289/510 (56%), Gaps = 17/510 (3%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G  + T++K+ L+ R +SM+A+GG++GTGL I     L+ AGPV  LIAY F+G L +  
Sbjct: 64  GKTEGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIAYAFVGLLVFFT 123

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW- 153
             SLGEMA++IP+   F  +  R+  PALG A GY Y   + I    +L+    VIQ+W 
Sbjct: 124 MASLGEMASYIPL-DGFTSYATRYADPALGFAVGYCYLFKYFILPPNQLTAAALVIQYWI 182

Query: 154 -TDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGK 212
             + V    WI I  VV+V+ N   V+F+GE EFW++  KVL +   II  FI++ G G 
Sbjct: 183 PREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMFALIILLFILMLGGGP 242

Query: 213 T-GPVGFRYWRNPGP---WGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEA 268
               +GFR+W++PG    + P I     + G+F+ +VS  + A F Y GTELVGI  GEA
Sbjct: 243 NHDRLGFRHWKHPGAFNNYSPAITG---DTGKFVAFVSVFVYATFAYLGTELVGIVVGEA 299

Query: 269 ANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL---KSEDSYISSSPFVIAIE 325
            NPRK+VP+AI                        +DP L   K++ +  ++SPFV+AI 
Sbjct: 300 RNPRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSAAASPFVVAIV 359

Query: 326 NSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAV 385
           NSG KVLPHIFNA +L  + SA NSD+Y++SR LYS+ ++  APK    T + GIPY ++
Sbjct: 360 NSGIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFARTNRWGIPYYSL 419

Query: 386 LTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDD 445
             + L   LAY+  S G++ +F++ +N+ ++ G  +W+ I V ++ F +A++ QGI +  
Sbjct: 420 GLSVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRAVRAQGIDKST 479

Query: 446 LPFKAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFNVSDFFTAYVSVILFFAVWIGFQI 504
             + A    +GAY+A             T F   +F+   F T Y+ + +FF  + G+++
Sbjct: 480 FSYVAPGQRYGAYFALFFCSLIALIKNFTVFLGHQFDYKTFITGYIGIPVFFISYFGYKL 539

Query: 505 WFRGPLFKKTEDIDLDTDRREIDNDVWEED 534
            ++  +    E +DL T +  ID +  EED
Sbjct: 540 IYKTKIIDPLE-VDLYTFKAAIDQE--EED 566

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  321 bits (823), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 187/507 (36%), Positives = 288/507 (56%), Gaps = 11/507 (2%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G  + T++K+ALK RH+SMIA+GG++GTGL I   T L+ AGPV  LIAY F+G L +  
Sbjct: 61  GKTEGTRLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIAYAFVGLLVFFT 120

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
              LGEMAT+IP+   F  +  R+  PALG A GY Y   + I    +L+    VIQ+W 
Sbjct: 121 MACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWV 179

Query: 155 DAVPLT--AWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG- 211
           D   +    W+ I  VV+VS N+  V+F+GE EFW++  KVL ++G ++  FI++ G G 
Sbjct: 180 DKEKVNPGVWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLGLMLLLFILMLGGGP 239

Query: 212 KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271
               +GFRYWR+PG +     +   + GRF+ +VS  + A + Y G EL GI A EA NP
Sbjct: 240 DHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNP 299

Query: 272 RKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDP---KLKSEDSYISSSPFVIAIENSG 328
           RK++P+AI                        +DP   K K+  +  ++SPFV+AI NSG
Sbjct: 300 RKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAASPFVVAIINSG 359

Query: 329 TKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTT 388
              LPHI NA +L  + SA NSD+Y+SSR LYS+ ++  APK    T + GIPY A+  +
Sbjct: 360 INALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVS 419

Query: 389 SLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPF 448
            L   LAY+  S  ++ +F++ +N+ ++ G  +W+ I + +I F +A++ QG+ +    +
Sbjct: 420 VLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAY 479

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFNVSDFFTAYVSVILFFAVWIGFQIWFR 507
            A F P+GA+++             T F   +F+  +F T Y+ + +FF  + G++  ++
Sbjct: 480 VAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYK 539

Query: 508 GPLFKKTEDIDLDTDRREIDNDVWEED 534
             +    + +DL T +  ID +  EED
Sbjct: 540 TKVIDPLK-VDLYTFKAAIDQE--EED 563

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  321 bits (823), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 190/519 (36%), Positives = 281/519 (54%), Gaps = 21/519 (4%)

Query: 42  VKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEM 101
           +K+ L+ RHI +IALGG IGTGLF+  S+ LS  GP G L +Y+ I  + Y V  SLGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 102 ATFIPVTS-----SFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
             F+P ++     S      R+  P+LG A G+ Y+  + I  A E +    V+ +WT A
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTA 224

Query: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKT-GP 215
           VP  AWI I   V+   N +PVK YGE EFW A +K+L IVG +  +FI+  G G T   
Sbjct: 225 VPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTHDR 284

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVGITAGEAANPRKT 274
           +GFRYW++PG +   I +   N GRFL   + +I   F +  G ELV IT+ EA + R+ 
Sbjct: 285 LGFRYWQHPGAFAYHITTG--NTGRFLDIWTGVIKGGFAFILGPELVAITSSEALDARRN 342

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSE----DSYISSSPFVIAIENSGTK 330
           + +A  +                       DP LK+      +   SSPFVIAI+N+  K
Sbjct: 343 IEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAHIK 402

Query: 331 VLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSL 390
           VLPHI NA ILS+  S+GNS ++ +SR L SM  +G AP+ L    + G+PY AV  ++ 
Sbjct: 403 VLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALSAA 462

Query: 391 VGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKA 450
              LA+L  S G++  F W  NI+ ++GF  W+ I VA+++F +A+  +G+  + +PFK+
Sbjct: 463 FSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGL-YERVPFKS 521

Query: 451 KFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFR--G 508
              P+G Y+               +F   +N SDF  AY+++ +F  +W+G +I+ R   
Sbjct: 522 PLQPYGTYFFIVVVSLICLTNGYASFV-NWNASDFVAAYITLPIFVVLWVGHKIYTRTWS 580

Query: 509 PLFKKTEDIDLDTDRREIDNDVWEEDE----PKNLWEKF 543
                  ++D+ T   EI+ +    D     P N W+KF
Sbjct: 581 TWLLPVAEVDVTTGLAEIEEETKILDAQRIPPANAWQKF 619

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  321 bits (822), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 181/511 (35%), Positives = 285/511 (55%), Gaps = 10/511 (1%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G  +  ++K+ LK RHISMIA+GG++GTGL I+    L  AGPV  LIAY F+G + +  
Sbjct: 58  GKYEGIRLKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMVFFT 117

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
              LGEMATFIP+   F  +  R+  PALG A GY Y + + I    +L+    V+Q+W 
Sbjct: 118 MACLGEMATFIPL-DGFTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQYWV 176

Query: 155 --DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAF-IMVCGAG 211
             D V    W+ +++ V+   N+  V+F+GE EFW++ +KVL ++G II  F IM+ GAG
Sbjct: 177 PRDTVNPGIWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGGAG 236

Query: 212 KTGPVGFRYWRNPGPWGPGIISKDVNE--GRFLGWVSSLISAAFTYQGTELVGITAGEAA 269
               +GFRYW++PG +     S D++   G+F+ +V+ L+   F Y G EL GI A EA+
Sbjct: 237 SHDRLGFRYWKHPGAFND--YSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEAS 294

Query: 270 NPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIAIENSG 328
           NPR++VP+AI                        ND KL  + ++ +++SPF IAI N+G
Sbjct: 295 NPRRSVPKAIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTASPFSIAILNAG 354

Query: 329 TKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTT 388
             VLP IFN  +L  + SA NSD+Y++SR LYS+ ++  APK    T + GIPY ++  +
Sbjct: 355 ITVLPDIFNGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLFVS 414

Query: 389 SLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPF 448
            L   LAY+  S  ++ VF + +N+ ++AG   W+ I + +I F +A++ Q + +    +
Sbjct: 415 CLFCLLAYMTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTFAY 474

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRG 508
            A F P+GAY +             T F   F+   F T Y+ + +F   + G++I  + 
Sbjct: 475 VAPFQPYGAYVSLFFCCLIAIIKNFTVFLGHFDYKTFITGYIGLPIFVLCYFGYKITCKS 534

Query: 509 PLFKKTEDIDLDTDRREIDNDVWEEDEPKNL 539
            + +    +DL + +  +D +  E +  + L
Sbjct: 535 EI-RSARYVDLVSQKSLVDREQVEYELIEQL 564

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  319 bits (818), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 184/522 (35%), Positives = 283/522 (54%), Gaps = 21/522 (4%)

Query: 41  QVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGE 100
           ++K+ LK RH+ +IALGG IGTGLF+  S+ L   GP G  I+Y  I ++ Y + Q +GE
Sbjct: 74  ELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIMQGIGE 133

Query: 101 MATFIPVTSS----FMVF-TQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTD 155
           M  ++P + S    F  +   +++  +LG A+ + Y+  + I  A E +    V+++WT 
Sbjct: 134 MVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAASGVVEYWTT 193

Query: 156 AVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KTG 214
           +VP  AWI I    +V  N   VKFYGE EFW A IK+L IVG II +FI+  G G    
Sbjct: 194 SVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSFILFWGGGPNHD 253

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVGITAGEAANPRK 273
            +GFRYW+NPG +   I  +  + G FL   + +I   F +  G E++ +T+ E  + R+
Sbjct: 254 RLGFRYWQNPGGFAHHI--RGGSFGSFLDIYTGIIKGGFAFILGPEMIAMTSSEVEDQRR 311

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKS----EDSYISSSPFVIAIENSGT 329
            + +A  +                      NDP L++          SSPFVI I+N+G 
Sbjct: 312 NIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPFVIGIQNAGI 371

Query: 330 KVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTS 389
           KVLPHI NA ILS+  SAGN+ ++ SSR L +M  NG AP+      + G+PY AV  +S
Sbjct: 372 KVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPYYAVGLSS 431

Query: 390 LVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFK 449
            +  LAYL  S   + VF+W  NI+ ++GF  W+ + +A+IRF +A+   G+ +  LP+ 
Sbjct: 432 AISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFHGM-QSRLPYT 490

Query: 450 AKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF-NVSDFFTAYVSVILFFAVWIGFQIWFRG 508
           A+ MP+  Y+                F P+F +  +F  AY+++ +F+ +WIG ++ +R 
Sbjct: 491 ARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAKNFVAAYITLPVFWVLWIGHRV-YRR 549

Query: 509 PLF-----KKTEDIDLDTDRREIDNDVWEEDEPKNLWEKFWS 545
            +F     K  E+ID+ T   EI+    E D  + L  K+W 
Sbjct: 550 KIFTLKWWKSIEEIDVVTGVEEIEEKTRECDASRVLPTKWWE 591

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  318 bits (815), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 181/506 (35%), Positives = 269/506 (53%), Gaps = 12/506 (2%)

Query: 36  SVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVS 95
           +   + ++  LK RH+ MI++GG IGTGLF+   T L  AGP G LI ++  G++ Y + 
Sbjct: 78  ATARSPLQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMV 137

Query: 96  QSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW-T 154
            S+ E+A   PV   F  +  RF+  + G AN + Y L W +T  LE+      + +W T
Sbjct: 138 MSVAELAIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHT 197

Query: 155 DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
           D      ++ + WVV+V  N+  V+ YGE EF  +  K+L IVGFII A I++CG G   
Sbjct: 198 DKKYRDGFVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGT 257

Query: 215 PVGF-RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
                RYW +PG +     + D +  +F G+ S  ++AAF++ G+ELVG+ A EA+NPRK
Sbjct: 258 GYIGARYWYHPGAF-----AGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRK 312

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVL 332
            VP A  +V                      DP+L    S   ++SPFVIAI+N G   L
Sbjct: 313 DVPGAAKQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAASPFVIAIKNQGISGL 372

Query: 333 PHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVG 392
           P + N VIL  ++S GNS VY  SR L ++   G  PK  ++  + G P   +  TS  G
Sbjct: 373 PTLVNVVILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFG 432

Query: 393 FLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKF 452
            +A++  S     VFDWL+ ++ ++  F W  I + HIRF +AL  QG S ++L F +  
Sbjct: 433 LIAFVAQSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASPA 492

Query: 453 MPWGAYYAAXXXXXXXXXXXXTAFAP---KFNVSDFFTAYVSVILFFAVWIGFQIWFRG- 508
             WGA +               A  P     + +DFF  Y+S+ +  A+W+G +IW +  
Sbjct: 493 GVWGAAWGLFLCIIMLAAQFYVALFPLGAPPSANDFFQGYLSLPIVLAMWLGHKIWKKNW 552

Query: 509 PLFKKTEDIDLDTDRREIDNDVWEED 534
            LF K ED+D+DT RRE+D D+  + 
Sbjct: 553 KLFIKAEDMDIDTGRRELDLDLLRQQ 578

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  318 bits (815), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 171/507 (33%), Positives = 276/507 (54%), Gaps = 13/507 (2%)

Query: 36  SVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVS 95
           +  ++++ + L  RH+  +A+GG IGTGLF++    L+  GP   ++A++ + T  + + 
Sbjct: 82  TANDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAWVIVSTCLFTIV 141

Query: 96  QSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTD 155
            +LGE+A   PV   F V+  RF+ P+ G A    Y   W++   LEL      I++W +
Sbjct: 142 NALGELAAVFPVVGGFNVYITRFVEPSFGFAVNINYLAQWAVLLPLELVAASITIRYWNN 201

Query: 156 AVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGP 215
            +   AW+ I +  +  AN+  VK +GE EF ++ IK+LAI+GF I   ++ CG G +G 
Sbjct: 202 TINSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPSGE 261

Query: 216 -VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
            +G RYW +PG +       D    RF G  +  ++AAF+Y GTELV ++A E+ NPR T
Sbjct: 262 YIGGRYWNDPGAF-----VGDTPGRRFKGVCAVFVTAAFSYSGTELVAVSAAESHNPRVT 316

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSPFVIAIENSGTKVL 332
           +P+A  +                      ND +L + +S +  ++SP VIAIEN G K L
Sbjct: 317 LPKASKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSVDAAASPLVIAIENGGIKGL 376

Query: 333 PHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVG 392
           P + NA+IL  I+S  NS VY  SR + +M   G  PK L +  K G P  A+  T + G
Sbjct: 377 PSLMNAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNYIDKRGRPLYAIFATLIFG 436

Query: 393 FLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKF 452
            L+++ +S     VF WL  ++ ++  F W  I+++HIRF QA+K Q  S ++LPF +  
Sbjct: 437 LLSFIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQAMKAQDRSLNELPFVSIT 496

Query: 453 MPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG 508
             +G++Y              T+  P      +   FF  Y+S+ +F   ++G +++ + 
Sbjct: 497 GVYGSWYGCIVIFLVLIASFWTSLFPVGSDGADAESFFEGYLSLPIFIVCYLGHKVYKKD 556

Query: 509 -PLFKKTEDIDLDTDRREIDNDVWEED 534
             L+ KT+D+DLDT RREID D+ +++
Sbjct: 557 WRLYVKTKDMDLDTGRREIDLDILKQE 583

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  318 bits (815), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/544 (34%), Positives = 293/544 (53%), Gaps = 25/544 (4%)

Query: 22  FSRSKDVVSLESL-GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGA 80
           + +S D  S++ L G  KE  +K+++KPRH+ MI+LG  IGTGL +  +  L++AGP G 
Sbjct: 104 YKKSGDSGSVDELEGKTKEEHLKKSIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGL 163

Query: 81  LIAYMFIGTLAYMVSQSLGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITF 139
            I Y  +G+  Y + Q+ GEMA T+  +   F  +    +SP LG A  ++Y+L W+   
Sbjct: 164 AIGYAIMGSCIYCIIQAAGEMAVTYSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVC 223

Query: 140 ALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGF 199
            LEL      I++WT  V    +++I + +++  N+   + Y E EF+  C KVL I GF
Sbjct: 224 PLELVTASMTIKYWTTKVNPDVFVVIFYFLIIVINVFGARGYAEAEFFFNCCKVLMITGF 283

Query: 200 IIYAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGT 258
            I   I+ CG AG  G +G +YW +PG +       D    RF G  ++L++AAF + G+
Sbjct: 284 FILGIIINCGGAGNDGYIGGKYWHDPGAF-----RGDKAIDRFKGVAATLVTAAFAFGGS 338

Query: 259 ELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISS 317
           E + +TA E +NPRK +P A  K+                     N D  + S+ S   +
Sbjct: 339 EFIALTASEQSNPRKAIPAAAKKILYRIIIIFLGSIIMVGFLVPWNSDQLMGSDSSKTKA 398

Query: 318 SPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTK 377
           SP+VIAI + G +V+PH  NAVIL +++S GNS  Y SSR+L S+   G APK+  +  +
Sbjct: 399 SPYVIAISSHGVRVVPHFVNAVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFNYIDR 458

Query: 378 SGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALK 437
            G P  A++  +L   +A+  +S     VF WLL I+ ++  F W  I ++HIRF +A+ 
Sbjct: 459 EGRPARAMVIGALFAVIAFCAASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFRRAMH 518

Query: 438 HQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVI 493
            QG S  ++ FK++   WG+YYAA               AP    K +   FF +Y++++
Sbjct: 519 VQGRSLGEIGFKSELGVWGSYYAAGMMFLVLIAQFWVGLAPIGMNKLDAQSFFESYLAML 578

Query: 494 LFFAVWIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDV--WEEDEPKN------LWEK-- 542
           +  A ++G+  W +   LF + +DIDLD  R+  D DV   E++E K       LW++  
Sbjct: 579 MLIAFYVGYMFWKKDWTLFIRAKDIDLDHHRQIFDEDVLRQEDEETKEKLRNGPLWKRIL 638

Query: 543 -FWS 545
            FW 
Sbjct: 639 NFWC 642

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  316 bits (810), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/529 (35%), Positives = 277/529 (52%), Gaps = 22/529 (4%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
            E  +++ LK RHI MIALGG IGTGLF+  S+ L+  GP G  I+Y+ I ++ Y +   
Sbjct: 73  NEGSLQQGLKSRHIQMIALGGAIGTGLFVGTSSTLALCGPAGLFISYIIISSVVYPIMCG 132

Query: 98  LGEMATFIP-----VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQF 152
            GEM  ++P      + S      R++  +LG A  + Y+  + I  A E +    V+++
Sbjct: 133 FGEMVCYLPGNGNDASGSAAHLVARYVDKSLGFATAWNYYYCYIILVAAECTAASGVVEY 192

Query: 153 WTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGK 212
           WT AVP   WI+I   ++V  N  PVK+YGE EFW A IK+L IVG II +FI+  G G 
Sbjct: 193 WTVAVPKGVWILIFLGIVVILNFGPVKYYGEAEFWFASIKILCIVGLIILSFILFWGGGP 252

Query: 213 T-GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVGITAGEAAN 270
               +GFRYW+ PG +   I+      GRFL   S +I   F +  G ELV +T+ E  +
Sbjct: 253 NHDRLGFRYWQRPGAFTEHIMKGGF--GRFLDIYSGVIKGGFAFILGPELVCLTSAECED 310

Query: 271 PRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL----KSEDSYISSSPFVIAIEN 326
            R+ + +A  +                      NDP L     S      SSPFVI I+N
Sbjct: 311 QRRNIAKAARRFIWRLMFFYVLGTLAISVIVAYNDPSLVSALASGKPGAGSSPFVIGIQN 370

Query: 327 SGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVL 386
           +G +VLPHI NA ILS+  SAGN+ ++ S+R L +M  NG AP+      + G+PY A+ 
Sbjct: 371 AGIRVLPHIINACILSSAWSAGNAFMFASTRSLLTMARNGDAPRVFGKINRFGVPYVAIS 430

Query: 387 TTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDL 446
            +  +  LA+L  S   + VF+W  NI+ ++GF  W+   VA+IRF +A+   G+  D L
Sbjct: 431 LSGGLSCLAFLNVSSSTADVFNWFSNISTISGFIGWICGCVAYIRFRKAIFFNGM-YDRL 489

Query: 447 PFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPK-FNVSDFFTAYVSVILFFAVWIGFQIW 505
           PFK    P+  YY+               F PK +  SDF  AY+++ +F  +W+G ++W
Sbjct: 490 PFKTWGQPYAVYYSLFVISLITLTNGYATFIPKNWKGSDFVAAYITLPIFVVLWVGHKLW 549

Query: 506 ---FRGPLFKKTEDIDLDTDRREIDNDVWEED----EPKNLWEKFWSAV 547
              F    +++ + ID+ T   +I+      D    EP   W+KF  AV
Sbjct: 550 TRTFTKRWWRRVDQIDVTTGLVDIEERTKILDETRVEPSTRWQKFMDAV 598

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  314 bits (805), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/532 (35%), Positives = 281/532 (52%), Gaps = 21/532 (3%)

Query: 25  SKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAY 84
           S + +  +S GS   T + + L+ RHI +IALGG IGTGLF+  S  L N G    L+++
Sbjct: 30  SLEELETQSAGSEYNT-LHKGLQSRHIQLIALGGCIGTGLFVGTSWTLHNCGAAPLLLSF 88

Query: 85  MFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELS 144
           + I T+ Y +  SL EM  ++P   S      R++ P+LG A G+ Y  +++I  A ELS
Sbjct: 89  ILISTIVYPIMCSLAEMICYLPQQGSVPELVSRYVDPSLGFATGWNYAYAYAILVAAELS 148

Query: 145 VVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYA- 203
               V+ +W + VP+ AWI I  VV+V  N   VK+YGE EFW A IK++ I+G ++ + 
Sbjct: 149 AAASVVSYWDNPVPMAAWITIFLVVVVGLNFTAVKYYGEAEFWFASIKLICILGLLVVSV 208

Query: 204 FIMVCGAGKTGPVGFRYWRNPGPW----GPGIISKDVNEGRFLGWVSSLISAAFTY-QGT 258
            I   GA      GFRYW+NPGP+     PG      + GRFL    ++I +AF +    
Sbjct: 209 VIFFGGAPNHDRTGFRYWKNPGPFAMSLAPG------STGRFLDVWRAVIKSAFAFILSP 262

Query: 259 ELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPK----LKSEDSY 314
           EL+GI   EA + R+   +A  +                       DPK    L++    
Sbjct: 263 ELIGIACVEAQDTRRNTEKASRRFIYRIIFFYVSCALMIGVILSRTDPKLIEALETGAPG 322

Query: 315 ISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTW 374
            +SSPFV  I N+G  VL H+ N  ILS+  SAGNS +Y S+R++ ++   G APK+LT 
Sbjct: 323 AASSPFVQGIANAGIPVLDHVINVAILSSAWSAGNSFMYASTRMVLALAREGNAPKFLTK 382

Query: 375 TTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQ 434
             + G+PY AV+  +LV  LAYL     ++ VF WL NI  ++GF  W  + +A IRF +
Sbjct: 383 INRYGVPYNAVIVCTLVACLAYLNVKTTSANVFQWLSNICTISGFIGWFAMGIAFIRFRR 442

Query: 435 ALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-KFNVSDFFTAYVSVI 493
            +    + +  +P++    P+ AYY                F   ++NV DF  AYV++ 
Sbjct: 443 GIVFNNL-QSRIPYQGPLQPYIAYYFTFMTVVVCLTNGFHVFLKGRWNVVDFVAAYVTLP 501

Query: 494 LFFAVWIGFQIWFRGPLFKKTEDIDLDTDRREIDND--VWEEDEPKNLWEKF 543
           ++  +++G ++WFR   +   E ID+ T   E + +  +     PKNLWEKF
Sbjct: 502 IYLVLYLGHKLWFRTRWYIPVEQIDVITGLVEAEEESKMTPPRIPKNLWEKF 553

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  315 bits (807), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/499 (35%), Positives = 264/499 (52%), Gaps = 12/499 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
           ++ +K  LK RH+ MIA+GG IGTGLF+   T L  AGP G LI +   GT+ Y +  ++
Sbjct: 76  QSPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMAV 135

Query: 99  GEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW-TDAV 157
           GE+A   PV   F  +  RF+  + G A  ++Y L W +   LE+      + +W TD  
Sbjct: 136 GELAVVFPVAGGFTTYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASITVNYWGTDPK 195

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGP-V 216
               ++ + +VV+V  N+  VK YGE EF  + IKV+ ++GFII A +++CG GK    +
Sbjct: 196 YRDGFVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVLICGGGKDHKYI 255

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           G +YW NPG +       D    +F G+ +  ++AAF++ G+ELVG+   EA  PRK+VP
Sbjct: 256 GAQYWYNPGAF-----VGDTAGQQFQGFCTVFVTAAFSFAGSELVGLAGSEAEEPRKSVP 310

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPHI 335
            A  +V                     + P+L    S   ++SPFVIAI N G K LP +
Sbjct: 311 GAAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASSVDAAASPFVIAIVNHGIKGLPSV 370

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            N VIL  ++S GNS +Y  SR L ++   G  P    +  + G P   +  ++  G +A
Sbjct: 371 VNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGIAISAFFGLIA 430

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++  S     VF+WL+ ++ ++  F W  I + HIR+  AL  QG S D+LPF+A    W
Sbjct: 431 FVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDELPFQAPAGVW 490

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP---KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-PLF 511
           G+Y+                  P   K N  DFF AY+S  +F A++   +IW R   LF
Sbjct: 491 GSYWGFFMCILMFIAQFYVGLFPPGTKPNAYDFFLAYLSFCIFIALYAFHKIWKRNWKLF 550

Query: 512 KKTEDIDLDTDRREIDNDV 530
              +D+D+DT RRE+D DV
Sbjct: 551 IPLKDLDIDTGRREVDLDV 569

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  315 bits (807), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 179/523 (34%), Positives = 282/523 (53%), Gaps = 13/523 (2%)

Query: 23  SRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALI 82
           S + D       G   + ++K+ +K RH+ MI+LG  IGTG+ +     L N GP G +I
Sbjct: 77  SNNPDKEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVI 136

Query: 83  AYMFIGTLAYMVSQSLGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFAL 141
            Y  +G+  Y + Q+ GE+A  +  ++  F  +    + PALG +  ++Y L W     L
Sbjct: 137 GYAIMGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPL 196

Query: 142 ELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFII 201
           EL      I++WT +V    ++ I +VV+++ N+   + Y E EF+    KVL I GF+I
Sbjct: 197 ELVTASITIKYWTTSVNPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGFLI 256

Query: 202 YAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTEL 260
              I+ CG AG  G +G +YW +PG +     S D     F G VS+L++AAF +  TE 
Sbjct: 257 LGIIVNCGGAGNDGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEF 311

Query: 261 VGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSP 319
           + +TA E ANPRK++P A  K+                     N  +L  S  S   +SP
Sbjct: 312 IALTAAEQANPRKSIPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSATHASP 371

Query: 320 FVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSG 379
           +VIAI + G KV+PH+ NAVIL ++IS GNS  Y SSR+L ++   G AP +L +  + G
Sbjct: 372 YVIAIASHGVKVVPHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREG 431

Query: 380 IPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQ 439
            P  A++ +S+ G ++++ +S     VF WLL I+ ++  F W  I ++HIRF +A+K Q
Sbjct: 432 RPTLAMVISSVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQ 491

Query: 440 GISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILF 495
           G S  +L FK++   WG+YYA             TA AP    K +   FF  Y+++ + 
Sbjct: 492 GRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPIL 551

Query: 496 FAVWIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWEEDEPK 537
            A++ G+++W R   L+     IDL ++RR  D DV ++++ +
Sbjct: 552 IALYFGYKVWKRDWTLYIPASKIDLISNRRIFDEDVLKQEDAE 594

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  312 bits (800), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 181/500 (36%), Positives = 279/500 (55%), Gaps = 9/500 (1%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G  +  ++K+AL+ RH+SMIA+GG++GTGL I   + L++AGP   LI+Y F+G L Y V
Sbjct: 44  GKHEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYTV 103

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
              LGEMA FIP+   F  +  R++ PALG A GY Y   + I    +L+    V+Q+W 
Sbjct: 104 MACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162

Query: 155 --DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG- 211
             + V    WI I  V++V  N   V+F+GE EFW++ +KVL ++G I+  FI++ G G 
Sbjct: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGP 222

Query: 212 KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271
                GFRYWR+PG + P   +   ++G+F+ + S    A F Y GTEL GI A EA NP
Sbjct: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNP 282

Query: 272 RKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDP---KLKSEDSYISSSPFVIAIENSG 328
           R++VPRAI                        NDP   K K   +  ++SPFV+AI+N+G
Sbjct: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAG 342

Query: 329 TKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTT 388
             VLPHIFNA +L  + SA NSD+Y++SR LY + ++  APK    T   G+PY ++  +
Sbjct: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402

Query: 389 SLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPF 448
            L   LAY+  S G++ +F++ +N+ ++ G  +W+ I + ++RF +A+  Q   +    +
Sbjct: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFNVSDFFTAYVSVILFFAVWIGFQIWFR 507
            A F PW  + +             T F    F+   F + Y+ + ++   ++G+++  R
Sbjct: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522

Query: 508 GPLFKKTEDIDLDTDRREID 527
             L K  ED+DL T +  ID
Sbjct: 523 SKLIKP-EDVDLYTFKAAID 541

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  309 bits (792), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 172/508 (33%), Positives = 275/508 (54%), Gaps = 13/508 (2%)

Query: 36  SVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVS 95
           + K++++ + L  RH+  +A+GG IGTGLF++    LS  GP   +IA+  I T  + + 
Sbjct: 58  NTKDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWTIISTCLFTIV 117

Query: 96  QSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTD 155
            SLGE++   PV   F V+  RF+ P+ G A  + Y   W+I   LEL      I++W  
Sbjct: 118 NSLGELSATFPVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAASITIRYWNK 177

Query: 156 AVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVC-GAGKTG 214
           ++   AW+ I +V +  AN+  VK +GE EF ++ +K+LAI+GF I   +++C G    G
Sbjct: 178 SINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLICGGGPSGG 237

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
            +G +YW +PG +       D    RF G  +  I+AAF+Y G ELVG++A E+ NPR T
Sbjct: 238 FIGGKYWNDPGAF-----VGDTPAQRFKGLSAVFITAAFSYSGLELVGVSAAESRNPRVT 292

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSPFVIAIENSGTKVL 332
           +P+A  +                      NDP L +  S +  ++SP VIAI+N G K L
Sbjct: 293 LPKAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAASPLVIAIQNGGIKGL 352

Query: 333 PHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVG 392
           P + NA+IL  ++S  NS VY  SR + SM   G  P+ L    K G P  A+  T LVG
Sbjct: 353 PSLMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLYAIAITLLVG 412

Query: 393 FLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKF 452
            L+++ +S+    VF WL  ++ ++  F W  I++AH+RF  A+KHQ  S ++LP+ +  
Sbjct: 413 LLSFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSLEELPYVSMT 472

Query: 453 MPWGAYYAAXXXXXXXXXXXXTAFAPK----FNVSDFFTAYVSVILFFAVWIGFQIWFRG 508
             WG++Y              T+  P      + + FF +Y+S+ +F A ++G +IW R 
Sbjct: 473 GEWGSWYGCIVIGLVLIASFWTSLFPAGGNGADATSFFESYLSLPIFIACYLGHKIWKRN 532

Query: 509 -PLFKKTEDIDLDTDRREIDNDVWEEDE 535
             L+ K  ++D+D+ R + D    ++++
Sbjct: 533 LRLYIKLSEVDVDSGRTDTDAATLKQEK 560

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  307 bits (787), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 168/480 (35%), Positives = 261/480 (54%), Gaps = 5/480 (1%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           K   + R LKPR +S++ LG  +GTGL I   + L+  GP+   IAY+F G+L  +V  S
Sbjct: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87

Query: 98  LGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           L EMA+F P+   F  +  R++ PA G A G+ YFL ++I  +  L+  G VI +W   V
Sbjct: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDV 147

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPV 216
            +  W+ +L+V +   N   VK++GE+E  +   K+L +V   I   I+ CG A      
Sbjct: 148 NVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           GFRYWR  G   P ++      G+FLGW + ++ + F + G+E++GI  GE ANP+KT+P
Sbjct: 208 GFRYWRESGAL-PYLVGG--GTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264

Query: 277 RA-INKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHI 335
           ++ +N                       N   + +  +  ++SPFVIAI +SG KVLP+ 
Sbjct: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            NA +L  IIS+ N+D+YI SR LY +  +G APK      +  +P    +T SL+GFLA
Sbjct: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           Y+ +   A+ VF ++ +  +V G   W  I +A+I + +A+K +GIS DD+PF+  F P+
Sbjct: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444

Query: 456 GAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTE 515
            AY                AF  KF+   F T+Y+ V     + IG++++F+    K +E
Sbjct: 445 AAYVTLFFVTIITFFNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPSE 504

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  307 bits (786), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 185/530 (34%), Positives = 277/530 (52%), Gaps = 18/530 (3%)

Query: 23  SRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALI 82
           S++ DVVS        E  +K+ L  RHI +IALGG IGTGLF+  S+ L+  GP    +
Sbjct: 38  SQNSDVVS------DYEHNLKKGLSNRHIQLIALGGCIGTGLFVGTSSTLTQCGPAPLFL 91

Query: 83  AYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALE 142
           +++ I T+ Y +  +L EM  ++P   S      R++ P+LG A G+ Y  S+++  A E
Sbjct: 92  SFIIISTMVYCIMCTLAEMVCYLPQQGSVPELVTRYVDPSLGFAAGWNYAYSYAMLVATE 151

Query: 143 LSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIY 202
           L+    ++++WTD VP   WI I  +V+V  N + V+FYGE EFW A +K++ I+  ++ 
Sbjct: 152 LTAAAGIVRYWTDQVPQGVWITIFLIVVVVLNFSAVRFYGESEFWFASLKIICILALLVV 211

Query: 203 AF-IMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTEL 260
           +  I   GA     VGFRYWRNPG +G  I     N GRFL   +++I +AF +    EL
Sbjct: 212 SIVIFFGGAPNHDRVGFRYWRNPGAFGYHITGG--NLGRFLDLWTAIIKSAFAFILSPEL 269

Query: 261 VGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPK----LKSEDSYIS 316
           VG+   EA + R+ + +A  +                      ND      L+      +
Sbjct: 270 VGLACVEAKDTRRNIEKASRRFIYRIIFFYLSSSLMIGVIVAKNDHNLLLALEENRPGAA 329

Query: 317 SSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTT 376
           SSPFV  I NSG  VL H+ N  IL++  SAGNS  Y SSR + ++   G APK  +   
Sbjct: 330 SSPFVQGIANSGIPVLNHVINVAILTSAWSAGNSFFYASSRSILALSKQGDAPKIFSKIN 389

Query: 377 KSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQAL 436
           + G+PY AV   SLV  LAYL  S  +S VF WL NI  ++GF  W LI VA+IRF +A+
Sbjct: 390 RFGVPYNAVFLCSLVACLAYLNVSSTSSKVFQWLSNICTISGFIGWFLIGVAYIRFRKAI 449

Query: 437 KHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-KFNVSDFFTAYVSVILF 495
               +  D +P+++   P+ AY+                F   +++  DF T+Y+S+ +F
Sbjct: 450 LFNRL-LDRIPYRSPLQPFSAYFFTIVVAIITLTNGYVVFIKGRWDYKDFLTSYISLPIF 508

Query: 496 FAVWIGFQIWFRGPLFKKTEDIDLDTD--RREIDNDVWEEDEPKNLWEKF 543
            A ++G +  ++       + ID+ T     E +  +     PKN WEKF
Sbjct: 509 LAFYLGHKTIYKTRFCIPVDQIDVITGLEEAEEEAKLSVVRVPKNAWEKF 558

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  308 bits (788), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 177/533 (33%), Positives = 285/533 (53%), Gaps = 25/533 (4%)

Query: 23  SRSKDVVS------LESLGSV------KETQVKRALKPRHISMIALGGTIGTGLFISIST 70
           S+ KD++S      LE+L S       ++ +  + L  RH+  +A+GG IGTGLF++   
Sbjct: 41  SKQKDLMSGSETKALENLDSTSQEVEDQDARYNKDLSVRHLLTLAVGGAIGTGLFVNSGA 100

Query: 71  PLSNAGPVGALIAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYM 130
            L+  GP   +I ++ I T  + +  +LGE+++  PV   F V+  RF+ P+ G A    
Sbjct: 101 ALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPVVGGFNVYISRFVEPSFGFAVNLN 160

Query: 131 YFLSWSITFALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIAC 190
           Y   W++   LEL      I++W   +   AW+ I + +++ ANL  VK +GE EF ++ 
Sbjct: 161 YLAQWAVLLPLELVAASLTIRYWNHTINSDAWVAIFYTIILLANLLDVKSFGETEFVLSM 220

Query: 191 IKVLAIVGFIIYAFIMVC-GAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLI 249
           +K+LAI+GF I   ++ C G  K G +G +YW NPG +  G  + D    RF G  S  +
Sbjct: 221 VKILAIIGFTILGIVLTCGGGPKGGYIGGKYWSNPGAF-VGHTAGD----RFHGLCSVFV 275

Query: 250 SAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK 309
           +AAF+Y GTEL+ ++A E+ NPR T+P+A  +                      +DP+L 
Sbjct: 276 TAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLITVCYIVVLTLVGCLVSSDDPRLL 335

Query: 310 SEDSY--ISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGL 367
           +  S   +++SP VIAIEN G K LP + NA+IL  ++S  NS VY  SR + SM   G 
Sbjct: 336 NGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRCMASMAQIGN 395

Query: 368 APKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISV 427
            PK  T+  + G P  A++ T + G L+++ +S     VF WL  ++ ++  F W  I+V
Sbjct: 396 LPKVFTYVDRKGRPLYAIVATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFAINV 455

Query: 428 AHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVS 483
           +HIRF + +K +G + D+LPF +    WG+YY              T+  P      N  
Sbjct: 456 SHIRFRRTMKERGRTLDELPFVSMTGVWGSYYGCIVIFIVLVVCFWTSLFPGGGEGANAE 515

Query: 484 DFFTAYVSVILFFAVWIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWEEDE 535
            FF  Y+S  +  A + G +++ R   L   T++IDLD+ RR +D ++ ++++
Sbjct: 516 SFFETYLSFPILLACYFGHKLYTRSWRLLTPTKEIDLDSGRRAVDLELMKDEK 568

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  307 bits (787), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 179/512 (34%), Positives = 280/512 (54%), Gaps = 14/512 (2%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G  K  ++K+ L+ RH+SMIA+GG++GTGL I   + LS AGP+  LIAY  +G + + V
Sbjct: 51  GKHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFTV 110

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
              LGEMA +IP+   F  +  R+  PALG A GY Y   + +    +L+    V+Q+W 
Sbjct: 111 MSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169

Query: 155 D--AVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGK 212
               V    WI +   V+++ N+  VKF+GE EFW++  KVL ++  +    ++V G G 
Sbjct: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGGP 229

Query: 213 T-GPVGFRYWRNPGPWGP--GIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAA 269
           +   +GFRYW++PG + P  G +S    +G+F+ + S  + A F Y GTEL GI A E  
Sbjct: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECK 289

Query: 270 NPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL---KSEDSYISSSPFVIAIEN 326
           NPR+ VPRAI                        NDP L   K   +  ++SP+V+AI+N
Sbjct: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIKN 349

Query: 327 SGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVL 386
           +G  VLPHIFNA +L+ + SA NSD+Y+ SR LY + ++  APK    T   G+PY ++ 
Sbjct: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409

Query: 387 TTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDL 446
             +L   LAY+  S  A  +F + +N+T++ G  +W+ I + +I F +A + QGI ++ L
Sbjct: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469

Query: 447 PFKAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFNVSDFFTAYVSVILFFAVWIGFQIW 505
            ++A F P  A+ A             T F    F+   F T Y+ + ++   ++ ++I 
Sbjct: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529

Query: 506 FRGPLFKKTEDIDLDTDRREIDNDVWEEDEPK 537
            +   + K+ ++DL T +  ID    EE+E K
Sbjct: 530 HKTK-WIKSANVDLFTYKTAID---LEEEEGK 557

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  306 bits (784), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 171/528 (32%), Positives = 279/528 (52%), Gaps = 16/528 (3%)

Query: 26  KDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYM 85
           ++V S       ++++  + L  RH+  +A+GG IGTGLF++  + L+  GP   +I ++
Sbjct: 54  ENVESTSGTSDAEDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWV 113

Query: 86  FIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSV 145
            I T  + +  +LGE+++  PV   F V+  RF+ P+ G A    Y   W++   LEL  
Sbjct: 114 IISTCLFTIVNALGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVA 173

Query: 146 VGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFI 205
               I++W   +   AW+ I + ++  ANL  VK +GE EF ++ +K+LAI+GF I   +
Sbjct: 174 ASLTIRYWNSTINSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIV 233

Query: 206 MVC-GAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGIT 264
           + C G  + G +G +YW NPG +       + +  RF G  S  ++AAF+Y GTEL+ ++
Sbjct: 234 LTCGGGPEGGYIGGKYWSNPGAF-----VGNTSSQRFHGLCSVFVTAAFSYSGTELIAVS 288

Query: 265 AGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL--KSEDSYISSSPFVI 322
           A E+ NPR T+P+A  +                      +DP+L   S    +++SP VI
Sbjct: 289 AAESVNPRITLPKACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLVI 348

Query: 323 AIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPY 382
           AIEN G K LP + NA+IL  ++S  NS VY  SR + SM   G  PK  ++  + G P 
Sbjct: 349 AIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPL 408

Query: 383 AAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGIS 442
            A+L T + G L+++ +S+    VF WL  ++ ++  F W  I+V+HIRF   +K +G S
Sbjct: 409 YAILATLIFGLLSFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRS 468

Query: 443 RDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF----NVSDFFTAYVSVILFFAV 498
            D+LPF +    WG+YY              TA  P      +   FF  Y+S  +    
Sbjct: 469 LDELPFVSMTGVWGSYYGCVIIFVVLVVCFWTALFPSTEGVASAESFFETYLSFPILLVC 528

Query: 499 WIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWEED---EPKNLWEK 542
           +IG +++ +   L   T +ID+D+ RR +D +V +++   E + + EK
Sbjct: 529 YIGHKLYTKSWRLLTPTTEIDIDSGRRAVDIEVLKDEKRMEEQAMREK 576

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  306 bits (784), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 186/523 (35%), Positives = 279/523 (53%), Gaps = 30/523 (5%)

Query: 40  TQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLG 99
           + +KR LK RH+ MIA+GG+IGTGLF+     L   GP   +IA++  G++ Y V Q+LG
Sbjct: 87  SPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQALG 146

Query: 100 EMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW-TDAVP 158
           E+A  +PV+ S++ +  RF+ P+ G A  Y Y +   IT  LEL      + +W  D+  
Sbjct: 147 ELAVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYWDVDSKY 206

Query: 159 LTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKT--GPV 216
             A++ + ++V+V  NL  VK YGE EF  + IKV AIVGFII   ++VCG G +  G +
Sbjct: 207 ADAFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGYI 266

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           G RYW NPG +  G          F G+ +  +++AF++ G+E+  + A E  NPRK +P
Sbjct: 267 GARYWYNPGGFAHG----------FKGFAAIFVTSAFSFAGSEMFALAAAETENPRKDLP 316

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIAIENSGTKVLPHI 335
           RA  +V                      D  L  +     S+SPFVIAI  +G K LP +
Sbjct: 317 RAAKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASASPFVIAIARAGIKGLPSV 376

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            N VIL  ++S GN  VY +SR + S+   G  P+   +  + G P   +L  ++ G L+
Sbjct: 377 VNVVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGLLS 436

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           +L +S     VFDW+L I+ +  FF W  I V H+RF +AL  QG S D+L +KA+   W
Sbjct: 437 FLSASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQTGIW 496

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP---KFNVSDFFTAYVS--VILFFAVWIGFQIWFRGPL 510
           G+ Y               A  P     N + FF+AY+S  V++FF  +   +++ R   
Sbjct: 497 GSLYGIGLIFIVLCFQFWVALFPIGGSPNANHFFSAYLSLPVVIFF--YTCHKLYTRSWT 554

Query: 511 FK-KTEDIDLDTDRREID-----NDVWEEDE---PKNLWEKFW 544
           F  K+ DID+DT RRE+D      ++ EE +    K +W + +
Sbjct: 555 FLIKSSDIDIDTGRREMDLELLKQEIQEEQQYIRSKPIWYRIY 597

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  306 bits (784), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 182/531 (34%), Positives = 280/531 (52%), Gaps = 19/531 (3%)

Query: 24  RSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIA 83
           RS+D   +E +  +  T + + L  RH+  +A+GG IGTGL+++  T LS  GP   +I 
Sbjct: 69  RSRDNDDVEQV-DINNTNLNKDLSVRHLLTLAVGGAIGTGLYVNTGTALSTGGPASLVID 127

Query: 84  YMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALEL 143
           ++ IGT  + V  SLGE++   PV   F V+  RF+ P+   A    Y   W +   LEL
Sbjct: 128 WVIIGTCLFTVINSLGELSAAFPVVGGFNVYGMRFVEPSFAFAVNLNYLAQWLVLLPLEL 187

Query: 144 SVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYA 203
                 I++W D +   AW+ I +  +  AN+  VK +GE EF ++ IK+L+I+GF I  
Sbjct: 188 VAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFSILG 247

Query: 204 FIMVC-GAGKTGPVGFRYWRNPGPWGPGIISKDVNEG-RFLGWVSSLISAAFTYQGTELV 261
            ++ C G    G +G +YWRNPG +         N G +F G  S  ++AAF+Y G E+ 
Sbjct: 248 IVLSCGGGPHGGYIGGKYWRNPGAF------VGHNSGTKFKGLCSVFVTAAFSYSGIEMT 301

Query: 262 GITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSP 319
            ++A E+ NPR+T+P+A  +                      NDP+L +  S +  +SSP
Sbjct: 302 AVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSP 361

Query: 320 FVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSG 379
            VIAIEN   K LP + NA+IL  ++S  NS VY  SR + +M   G  PK+L    K G
Sbjct: 362 LVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRG 421

Query: 380 IPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQ 439
            P  A+L T   G L+++ +S+  + VF WL  ++ ++  F WM I+++HIRF +A+K Q
Sbjct: 422 RPMNAILLTLFFGLLSFVAASNKEAEVFTWLSALSGLSTIFCWMAINLSHIRFRKAMKVQ 481

Query: 440 GISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILF 495
             S D+LPF ++    G++Y              T+  P      +   FF  Y+S  + 
Sbjct: 482 ERSLDELPFISQTGVLGSWYGFVVLFLVLIASFWTSLFPIGSSGASAESFFEGYLSFPIL 541

Query: 496 FAVWIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWEED---EPKNLWEK 542
              + G +I+ R   L  K EDIDLDT R+++D  +  E+   E +NL +K
Sbjct: 542 IVCYFGHKIYTRNWTLMVKIEDIDLDTGRKQVDLTLRREEMKIERENLAKK 592

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  305 bits (782), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 171/501 (34%), Positives = 269/501 (53%), Gaps = 19/501 (3%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           +   + R L  RH+  +A+GG IGTGLF++  + L+  GP   +IA+  I T  + +  +
Sbjct: 67  RSLNLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIGGPASLVIAWTIISTCLFTIVNA 126

Query: 98  LGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           LGE+A   PV   F V+  R + P+LG A    Y   W++   LEL      I++W ++V
Sbjct: 127 LGELAAVFPVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLELVAASITIRYWNNSV 186

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KTGPV 216
              AW+ + +V +  A+L  VK +GE EF ++ +K+LAI GF I   +++CG G K G +
Sbjct: 187 NSDAWVAVFYVCIFLASLLDVKSFGETEFILSMVKILAIGGFTILGIVLICGGGPKNGYI 246

Query: 217 GFRYWRNPGPW---GPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
           G +YW +PG +    PG         +F G  S  ++AAF+Y GTELVG++A E+ANPR 
Sbjct: 247 GAKYWNDPGSFVGASPG--------SQFKGLCSVFVTAAFSYSGTELVGVSAAESANPRY 298

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY--ISSSPFVIAIENSGTKV 331
           T+P+A  +                      +DPKL S  S   +++SP VIAIEN G + 
Sbjct: 299 TLPKASKRTFWLITLSYLLVLTIIGCLVRHDDPKLLSASSSVDVAASPLVIAIENGGIQG 358

Query: 332 LPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLV 391
           LP + NA+IL  IIS  NS VY  SR + SM   G  P+  T+    G P  A++ T + 
Sbjct: 359 LPSLMNAIILIAIISVANSSVYACSRCMVSMAEIGNLPRIFTYIDNRGRPIVAIIFTLVF 418

Query: 392 GFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAK 451
           G L+++ +S+    +F WL  ++ ++  F W+ I+++HIRF +AL  QG S D+LP+ + 
Sbjct: 419 GLLSFIAASNKQEEIFVWLSALSGLSTLFCWLAINISHIRFRRALNTQGYSLDELPYLSM 478

Query: 452 FMPWGAYYAAXXXXXXXXXXXXTAFAPKFNV----SDFFTAYVSVILFFAVWIGFQIWFR 507
               G++Y              T+  P  +       FF  Y+S+ +F   ++G +++ R
Sbjct: 479 TGVIGSWYGCVVIILVLIASFWTSLFPAGSSGADWESFFKGYLSLPIFLFCFVGHKLYKR 538

Query: 508 G-PLFKKTEDIDLDTDRREID 527
                 ++  ID++T RR ID
Sbjct: 539 NWSWMIRSNKIDVNTGRRMID 559

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  305 bits (780), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 174/524 (33%), Positives = 277/524 (52%), Gaps = 21/524 (4%)

Query: 37  VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQ 96
           V +TQ+K+ +K RH+ M++LG  IGTGL ++ +  L  AGP   +IAY  +  + Y + Q
Sbjct: 70  VTDTQLKKTMKSRHVVMMSLGTGIGTGLLVANAQGLHKAGPAPLVIAYGMVSFVTYFMIQ 129

Query: 97  SLGEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTD 155
           + GEMA   P +  +F  +   F+S   G A  +++F+ W     LEL      +Q+W D
Sbjct: 130 AAGEMAVVYPTLPGNFNAYISTFISKPFGFATVWLFFIQWLTVLPLELITAAMTVQYWND 189

Query: 156 AVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIM-VCGAGKTG 214
           ++    +++I +V L+  +   VK YGE EF     K+L + GFII++ ++ V GAG +G
Sbjct: 190 SINADVYVVIFYVFLLFIHFFGVKAYGETEFIFNLCKILFVGGFIIFSIVVNVGGAGNSG 249

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
            +G +YW +PG +     + D N GRF G    L++A F+Y G EL  ++  E  NPR++
Sbjct: 250 YIGAKYWHDPGAF-----TSDTNAGRFKGVCYVLVTAYFSYGGMELFALSVNEQENPRRS 304

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK-SEDSYISSSPFVIAIENSGTKVLP 333
            P A  +                      N  +L  S  S   +SP+V+A    G KV+P
Sbjct: 305 TPTAAKQSIYRIVVIYLLTMILVGFNVPSNSNELMGSGGSVTHASPYVLAASIHGVKVVP 364

Query: 334 HIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGF 393
           HI NAVIL ++IS GNS +Y + R++ ++   G APK++ +  + G P  A++  S+ G 
Sbjct: 365 HIVNAVILISLISVGNSALYAAPRLMCALAQQGFAPKFMDYVDREGRPLFALIVCSVFGV 424

Query: 394 LAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFM 453
           + ++  S     VF+WL  I  +A  F W  I ++HIRF QA+K Q  S D++ +K+ F 
Sbjct: 425 IGFVACSSKEEQVFNWLAAIAGLAELFTWSGIMISHIRFRQAMKLQNKSLDEVGYKSPFG 484

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG- 508
            +G+Y+               A AP    + +   FF +Y++  +FFA + G+ IW R  
Sbjct: 485 VYGSYFGVFFNLLVFVAQFWVALAPPMYTEMSADTFFESYLAFPIFFAFYFGYMIWKRDF 544

Query: 509 PLFKKTEDIDLDTDRREIDND-VWEEDEPKN-------LWEKFW 544
            LF   E +DLD  RR  D + V +EDE K        +W++ +
Sbjct: 545 TLFSDLESVDLDYHRRIYDPELVKQEDEEKKEMLKNSPMWKRMY 588

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  305 bits (782), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 188/530 (35%), Positives = 277/530 (52%), Gaps = 25/530 (4%)

Query: 36  SVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVS 95
           S    ++K+ LK RHI +IALGGTIGT L +  S+ L+N GP G  I+Y+ I T  Y + 
Sbjct: 90  SSSNGELKQGLKSRHIQLIALGGTIGTSLLVGTSSALANCGPAGLFISYLIISTFVYPIM 149

Query: 96  QSLGEMATFIPVTSSFMV-----FTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVI 150
            +LGEM  F+P   S           +++ P+LG A  + Y+  + I  A E+S    VI
Sbjct: 150 NALGEMVCFLPGNGSDSAGSAAHLVHKYVDPSLGFAASWNYYYCFVILVAAEVSAASGVI 209

Query: 151 QFWT--DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVC 208
           ++W   + VP  AWI I   ++V  N  PV  YGE EFW A IK+L I G II +FI+  
Sbjct: 210 EYWAWAEHVPKGAWITIFLSLIVILNFLPVNVYGESEFWFASIKILCITGLIILSFILFW 269

Query: 209 GAG--KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVGITA 265
           G G    G +GFRYW+NPG +   I       G FL   + +I   F+   G ELV +T+
Sbjct: 270 GGGPKSDGILGFRYWKNPGSFAHHITGG--GGGNFLDIYTGIIKGGFSVILGPELVCLTS 327

Query: 266 GEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKS----EDSYISSSPFV 321
            E A+ R+ + +A  +                      NDP L++      +   SSPFV
Sbjct: 328 SECADQRRNIAKASKRFVWRLMFFYILGSLSIGVIVAYNDPVLQNALAQSKAGAGSSPFV 387

Query: 322 IAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIP 381
           I I+N+G + +PHI N  IL++  SAGN+ ++ SSR L +M  NG APK      + G+P
Sbjct: 388 IGIQNAGIRAVPHIVNFCILTSAWSAGNAYMFASSRSLLTMARNGNAPKIFCRINQLGVP 447

Query: 382 YAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGI 441
           Y AV  + L+  LAYL  S   + VF+W  NI+ ++GF  W+   VA+IRF +A+ +  +
Sbjct: 448 YTAVGASLLLSCLAYLNVSSSTADVFNWFSNISTISGFIGWICACVAYIRFRKAITYNKL 507

Query: 442 SRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPK-FNVSDFFTAYVSVILFFAVWI 500
           +   +PF+AK   +  +Y+               F P+ +NV DF  AY+++ +F  +WI
Sbjct: 508 TH-RIPFRAKGQQYTIWYSLFWVSLITLTNGYAIFIPRNWNVKDFIAAYITLPIFIVLWI 566

Query: 501 GFQIWFRGPL---FKKTEDIDLDTDRREIDNDVW----EEDEPKNLWEKF 543
           G +++ R  L    +  + ID+ T   EI+            PKN WEKF
Sbjct: 567 GHKVFTRTLLKAWLRPIDKIDVYTGLEEIEELTEELNANRQAPKNKWEKF 616

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  304 bits (779), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 173/503 (34%), Positives = 274/503 (54%), Gaps = 12/503 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
           ++ ++R LK RH+ MIA+GG IGTGLFI  S  L  AGP G LI +  + T+   +  SL
Sbjct: 81  QSPLQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILIGWGLMATMILCMCLSL 140

Query: 99  GEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW-TDAV 157
           GEMA   PV+  +  +  RF+  + G AN   Y +   +   LE+      + +W   + 
Sbjct: 141 GEMAVTFPVSGGYTTYATRFIDESYGFANNINYMMQALVVLPLEIVAASITVDYWGPKSQ 200

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGP-V 216
              A++ + W+ +VS N+  VK YGE EF  + IKV+ ++GFII   I+VCG G T   +
Sbjct: 201 YRAAFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGFIILGVILVCGGGPTHEYI 260

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           G ++W NPG +       D    +F G  S  ++AAF++  TELVG+ A E  +PRK+VP
Sbjct: 261 GSKFWSNPGAF-----VGDTAGQKFKGICSVFVTAAFSFANTELVGLAAAETEDPRKSVP 315

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIAIENSGTKVLPHI 335
           +A  +V                      DP+L  S     ++SPFV+A++N G K LP +
Sbjct: 316 KAAKQVFWRITLFYILSLLMVGLLVPYTDPRLLGSSIVDAAASPFVLALKNHGIKGLPSV 375

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            N VIL+ ++S GNS V+  SR L ++   G  P    +  + G P  +++ +S  G L 
Sbjct: 376 INVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLVSIIFSSAFGLLC 435

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           +L  SH    +FDW+L+++ ++  F W+ IS+ HIRF +AL  Q  S D+L F +    W
Sbjct: 436 FLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSIDELAFASPIGIW 495

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP---KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-PLF 511
           G+YY+              A  P   K + S+FF AY+S+ +  A+++G +I+ +   L 
Sbjct: 496 GSYYSVFLIIVVLILQFWIALFPGHQKPSASNFFKAYLSMPIAVAMYLGHKIYTKNWKLL 555

Query: 512 KKTEDIDLDTDRREIDNDVWEED 534
              + +D+DT RRE+D ++++++
Sbjct: 556 IDPKYMDIDTGRRELDIELFKQE 578

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  304 bits (778), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 178/503 (35%), Positives = 263/503 (52%), Gaps = 12/503 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
           ++ ++R LK RH+ MIA+GG IGTGLF+     L   GP G LI +  IG + Y V  S+
Sbjct: 74  QSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSM 133

Query: 99  GEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW-TDAV 157
           GE+A   PV+  F  +  RF+  + G A  Y Y L W +   LE+      + FW T   
Sbjct: 134 GELAVTFPVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPK 193

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
               ++ + ++V+V  N   V+ YGE EF  + IKV+ ++GFII   ++VCG G  G   
Sbjct: 194 YRDGFVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGYI 253

Query: 218 F-RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
             +YW NPG +     S D    RF G  S  ++AAF++ GTELVG+ + E ANPRK +P
Sbjct: 254 GGKYWHNPGAF-----SGDDAGSRFKGVCSVFVTAAFSFAGTELVGLASAETANPRKALP 308

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPHI 335
           RA  +V                        +L    S   ++SPFV+AI+  G K LP +
Sbjct: 309 RAAKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAASPFVLAIQTHGIKGLPSV 368

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            N VIL +++S GNS VY  SR + ++   G  P    +  + G P  A++TT + G L+
Sbjct: 369 INVVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVFGLLS 428

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++  S     VF+WLL ++ ++  F+W  I + HIRF +AL  QG S D+L F +     
Sbjct: 429 FIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSYAGIA 488

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP---KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-PLF 511
           G+Y+               A  P     N  DFF+AY+S  +  A +I  +IW R   LF
Sbjct: 489 GSYFGVILVLLVLIAQFWVAVWPIGGSPNAEDFFSAYLSFPVLLAFYIFHKIWKRNWKLF 548

Query: 512 KKTEDIDLDTDRREIDNDVWEED 534
            + +DID+DT RRE+D +   ++
Sbjct: 549 TRAKDIDIDTGRREMDTEALRQE 571

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  303 bits (777), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 175/523 (33%), Positives = 274/523 (52%), Gaps = 18/523 (3%)

Query: 26  KDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYM 85
            D  S  S  SV    + + L  RH+  +A+GG IG GLF++    L++ GP   +I ++
Sbjct: 54  NDATSTVSNASVTNVNLNKNLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWV 113

Query: 86  FIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSV 145
            I T  + V  +LGEMA   PV   F V+  RF+ P++G A    Y   W +   LEL  
Sbjct: 114 IISTCLFTVINALGEMAAAFPVVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVA 173

Query: 146 VGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFI 205
               I++W D +   AW+ I + V+  AN+  VK +GE EF ++ +K+LAI+GF I   +
Sbjct: 174 ASMTIKYWNDTINSDAWVAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILGIV 233

Query: 206 MVC-GAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGIT 264
           + C G  + G +G +YW NPG +         +  +F G  S  ++AAF+Y G E+  ++
Sbjct: 234 LSCGGGPQGGYLGGKYWHNPGSF-----VGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVS 288

Query: 265 AGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSPFVI 322
           A E+ +PR+T+P+A  +                      ++P+L S  S +  +SSP VI
Sbjct: 289 AAESKDPRRTIPKAAKRTFWLITASYITILTLIGCLVPYDEPRLLSGSSSVDAASSPLVI 348

Query: 323 AIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPY 382
           AIEN G K LP + NA+IL +IIS  NS VY  SR + +M   G  P+ L    K G P 
Sbjct: 349 AIENGGIKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPV 408

Query: 383 AAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGIS 442
            A+L T   G L+++ +S   + VF WL  ++ ++  F WM I+++HIRF QA+K Q  S
Sbjct: 409 NAILFTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKS 468

Query: 443 RDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAV 498
            D+LP+ ++   WG++Y              T+  P      +   FF  Y+S  +  A 
Sbjct: 469 LDELPYLSQTGVWGSWYGVIVLFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILIAC 528

Query: 499 WIGFQIWFRGP-LFKKTEDIDLDTDRREID-----NDVWEEDE 535
           ++G ++ +R   +    ED+D+DT RR++D      ++ EE E
Sbjct: 529 YVGHKLVYRKKQIVVALEDMDIDTGRRQVDLTIRRQEMKEEQE 571

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  304 bits (778), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 185/531 (34%), Positives = 276/531 (51%), Gaps = 21/531 (3%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G  +  ++K+ L+ RH+ +IALGG IGTGL +  S+ L   GP G  I+Y+ I  + Y +
Sbjct: 99  GDSEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPI 158

Query: 95  SQSLGEMATFIP-----VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQV 149
             +LGEM  F+P        S      R++ P+LG A G+ YF  + I  A E +    V
Sbjct: 159 MCALGEMVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAECTAASGV 218

Query: 150 IQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG 209
           +++WT AVP   WI I   V+V  N + VK YGE EFW A IK+L IVG II +FI+  G
Sbjct: 219 VEYWTTAVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWG 278

Query: 210 AGKTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVGITAGE 267
            G     +GFRYW++PG +   +    +  G F    + +I  AF +  G ELV +T+ E
Sbjct: 279 GGPNHDRLGFRYWQHPGAFAHHLTGGSL--GNFTDIYTGIIKGAFAFILGPELVCMTSAE 336

Query: 268 AANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY----ISSSPFVIA 323
            A+ R+ + +A  +                      NDP L +  +       SSPFVI 
Sbjct: 337 CADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGSSPFVIG 396

Query: 324 IENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYA 383
           I+N+G KVLPHI N  IL++  SA N+ ++ S+R L +M   G APK L    K G+PY 
Sbjct: 397 IQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINKWGVPYV 456

Query: 384 AVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISR 443
           AV  + L   LAYL  S   + VF+W  NI+ ++GF  WM   +A++RF +A+ + G+  
Sbjct: 457 AVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-Y 515

Query: 444 DDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF-NVSDFFTAYVSVILFFAVWIGF 502
           D LPFK    P+  +++               F PK+  V+DF  AY+++ +F  +W G 
Sbjct: 516 DRLPFKTWGQPYTVWFSLIVIGIITITNGYAIFIPKYWRVADFIAAYITLPIFLVLWFGH 575

Query: 503 QIWFRG--PLFKKTEDIDLDTDRREIDNDVWEEDE----PKNLWEKFWSAV 547
           +++ R     +    +ID+ T   EI+    E +E    P    +KF  A+
Sbjct: 576 KLYTRTWRQWWLPVSEIDVTTGLVEIEEKSREIEEMRLPPTGFKDKFLDAL 626

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  302 bits (773), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 172/510 (33%), Positives = 272/510 (53%), Gaps = 23/510 (4%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           ++ ++K+ L  RHI +IALGG IGTGLF+     L+  GP G + +Y+ I T+ Y +   
Sbjct: 98  RKNKLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKCGPAGLVASYLIISTMVYPIMNV 157

Query: 98  LGEMATFIP-----VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQF 152
           LGEM  ++P        S     +R+L  +L  A G+ Y+  + +  A E +    V+++
Sbjct: 158 LGEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNYYYCFVMLVAAECTAASGVVEY 217

Query: 153 WTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG- 211
           WT  VP  AWI++  +++   N+ PV+ YGE EFW A  K+L IVG II +FI+  G G 
Sbjct: 218 WTKVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAISKILCIVGLIILSFILFWGGGP 277

Query: 212 KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVGITAGEAAN 270
               +GFRYW  PG +   I +     G FL     +I  AF++  G ELV + + E ++
Sbjct: 278 NHDRLGFRYWITPGSFANTITNGSF--GNFLDVYKGIILGAFSFILGPELVVLPSSECSD 335

Query: 271 PRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKS----EDSYISSSPFVIAIEN 326
           PR+ + +A  +                      NDP L +    +     SSPFVI I+N
Sbjct: 336 PRRNIKKASKRFIWRLMFFYILGTLSISVIVSYNDPILSTALIQDKPGAGSSPFVIGIQN 395

Query: 327 SGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVL 386
           +G  VLPHI N  IL +  S+GN+ ++ SSR L +M +N  APK L    + G+PY AV+
Sbjct: 396 AGIDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAINSQAPKCLGKINRFGVPYVAVI 455

Query: 387 TTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDL 446
            + ++  +AYL  S   S VF W  N++ ++GF  W+++SV ++RF +A+++ G+ +D L
Sbjct: 456 VSIILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWIIVSVTYLRFRKAIEYHGM-KDRL 514

Query: 447 PFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPK-FNVSDFFTAYVSVILFFAVWIGFQIW 505
           P+     P+   Y+                 P+ +NVSDF  AY+++ +F  +WIG + +
Sbjct: 515 PYTTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVSDFIAAYLTLPIFLMIWIGHKFY 574

Query: 506 -FRGPLFKK-------TEDIDLDTDRREID 527
            +R  +F +        EDID+ T   EI+
Sbjct: 575 KYRFKIFTRQCRWWYQVEDIDVITGLEEIE 604

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  301 bits (772), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 174/528 (32%), Positives = 280/528 (53%), Gaps = 15/528 (2%)

Query: 28  VVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFI 87
           VV + ++ +    ++K+ ++PRH+ MI LG  +GTGL +   T LS+AGP G +I Y  +
Sbjct: 85  VVEISAVDNQINEKLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIM 144

Query: 88  GTLAYMVSQSLGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVV 146
            T  Y V Q++GEMA  ++ +   F  +    + P L  A  ++Y + W     LEL   
Sbjct: 145 STCIYCVMQAVGEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTA 204

Query: 147 GQVIQFWTDAVPLTAWIIILWVVLVSANL-APVKFYGEVEFWIACIKVLAIVGFIIYAFI 205
              IQ+WT  V    +++I +++++  N+    + Y E EF+    K+L + GF I   I
Sbjct: 205 SMTIQYWTTKVNADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGII 264

Query: 206 MVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGIT 264
           ++CG AG +G +G RYW +PG +       D    RF G VS+L++AAF + GTE + IT
Sbjct: 265 LICGGAGNSGFIGARYWHSPGAF-----RGDNGINRFKGIVSTLVTAAFAFGGTEFLAIT 319

Query: 265 AGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIA 323
           A E ANPRK +P A  KV                     N  +L  S      +SP+VIA
Sbjct: 320 ASEQANPRKAIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSSGPATKASPYVIA 379

Query: 324 IENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYA 383
           + + G +V+PH  NAVIL ++ S  +S  Y SSR+L ++   G APK  T+  K G P  
Sbjct: 380 VASHGIRVVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTL 439

Query: 384 AVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISR 443
             +  +++  +++   S   + VF+WLL+I+ ++  F W +IS++HIRF +A+K QG S 
Sbjct: 440 GFVVGAIIAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSL 499

Query: 444 DDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVW 499
           D++ FK++   WG+ YA                 P      +   FF AY+++ +F  ++
Sbjct: 500 DEIGFKSQAGVWGSVYAFVMMILVLIGQFWVGIVPVGEDSADAVSFFQAYLAMPVFIVLY 559

Query: 500 IGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWEEDEPKNLWEKFWSA 546
            G++IW R   LF + ++IDL   R   D ++  + E K + E+  +A
Sbjct: 560 FGYKIWNRDWRLFIRAKNIDLIAHRHIYDPELLRQ-ERKEMRERARNA 606

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  302 bits (774), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 172/510 (33%), Positives = 271/510 (53%), Gaps = 16/510 (3%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           +E  +K+++KPRH+ MI+LG  IGTGL +  +  L NAGP G +I Y  +G+  Y + Q+
Sbjct: 138 EEEALKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQA 197

Query: 98  LGEMAT-FIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
            GEMA  +  +   F  +    + P  G A  ++Y L W     LEL      I++WT  
Sbjct: 198 AGEMAVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWTTT 257

Query: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIM-VCGAGKTGP 215
           V   A+++I +VV++   +   + Y E EF+  C K+L I+GF I   I+   GAG  G 
Sbjct: 258 VNPDAFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAGNDGY 317

Query: 216 VGFRYWRNPGPW-GPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
           +G +YW +PG + G   I       RF G +++ +SAAF +  TE + +TA E +NPRK 
Sbjct: 318 LGAKYWHDPGAFRGTNGIQ------RFKGIMATFVSAAFAFGATEFIALTAAEQSNPRKA 371

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXX-XNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
           +P A  KV                      +D  + +  S   +SP+V+AI   G +V+P
Sbjct: 372 IPSAAKKVLYRVICIFVGTIALLGFLVPWDSDQLMGAGGSATKASPYVLAISIHGVRVVP 431

Query: 334 HIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGF 393
           H  NAVIL ++ S  NS  Y SSR+L  +   G APK+  +  + G P+ A+   +L G 
Sbjct: 432 HFINAVILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGV 491

Query: 394 LAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFM 453
           +A+  +S     VF WLL I+ ++  F W+ I V+HIRF +A+  QG S  ++ FKA+  
Sbjct: 492 IAFCAASPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLG 551

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAPKFNVSD-----FFTAYVSVILFFAVWIGFQIWFRG 508
            +G+YYA              A AP  N  D     FF  Y+++ +  A + G+++W R 
Sbjct: 552 VYGSYYATIMMVLALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPILIAFYFGYKLWKRD 611

Query: 509 -PLFKKTEDIDLDTDRREIDNDVWEEDEPK 537
             LF + +DIDLD+ R+  D ++ ++++ +
Sbjct: 612 WRLFIRAKDIDLDSYRQVFDEELLKQEDEE 641

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  300 bits (769), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 175/519 (33%), Positives = 270/519 (52%), Gaps = 16/519 (3%)

Query: 24  RSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIA 83
            S D V  E    +  T + + L  RH+  +A+GG IGTGLF++    LS  GP   +I 
Sbjct: 71  HSDDDVQQED---INNTNLSKELSVRHLLTLAVGGAIGTGLFVNTGAALSTGGPASLVID 127

Query: 84  YMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALEL 143
           ++ I T  + V  SLGE++   PV   F V++ RF+ P+   A    Y   W +   LEL
Sbjct: 128 WVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLEL 187

Query: 144 SVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYA 203
                 I++W D +   AW+ I +  +  AN+  VK +GE EF ++ IK+LAI+GF I  
Sbjct: 188 VAASITIKYWNDKINSDAWVAIFYATIAMANMLDVKSFGETEFVLSMIKILAIIGFTILG 247

Query: 204 FIMVC-GAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVG 262
            ++ C G    G +G +YW +PG +    +  D +  +F G  S  ++AAF+Y G E+  
Sbjct: 248 IVLSCGGGPHGGYIGGKYWNDPGAF----VGHD-SGTKFKGLCSVFVTAAFSYSGIEMTA 302

Query: 263 ITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSPF 320
           ++A E+ NPR+T+P+A  +                      NDP+L +  S +  +SSP 
Sbjct: 303 VSAAESKNPRETIPKAAKRTFWLITISYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPL 362

Query: 321 VIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGI 380
           VIAIEN   K LP + NA+IL  ++S  NS VY  SR + +M   G  PK+L    K G 
Sbjct: 363 VIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLRRVDKRGR 422

Query: 381 PYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQG 440
           P  A++ T   G L+++ +S   + VF WL  ++ ++  F WM I+++HIRF QA+K Q 
Sbjct: 423 PINAIVLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKFQE 482

Query: 441 ISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFF 496
            S D+LPF ++   WG+ Y              T+  P      N   FF  Y+S  +  
Sbjct: 483 RSLDELPFISQTGVWGSIYGFVVLFLVLIASFWTSMFPIGSSGANAESFFEGYLSFPILI 542

Query: 497 AVWIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWEED 534
             + G +I+ R   L  K ED+DLDT R+++D ++  ++
Sbjct: 543 VCYFGHKIYTRDWRLLVKLEDMDLDTGRKQVDLNLRRQE 581

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  301 bits (770), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 178/523 (34%), Positives = 279/523 (53%), Gaps = 13/523 (2%)

Query: 23  SRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALI 82
           S + D       G   + ++K+ +K RH+ MI+LG  IGTG+ +     L N GP G +I
Sbjct: 77  SNNPDKEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVI 136

Query: 83  AYMFIGTLAYMVSQSLGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFAL 141
            Y  +G+  Y + Q+ GE+A  +  ++  F  +    + PALG +  ++Y L W     L
Sbjct: 137 GYAIMGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPL 196

Query: 142 ELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFII 201
           EL      I++WT +V    ++ I +V+ ++ N+   + Y E EF+    KVL I GF I
Sbjct: 197 ELVTASITIKYWTTSVNPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMITGFFI 256

Query: 202 YAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTEL 260
              I+ CG AG  G +G +YW +PG +     S D     F G VS+L++AAF +  TE 
Sbjct: 257 LGIIVNCGGAGNDGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEF 311

Query: 261 VGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSP 319
           + +TA E ANPRK++P A  KV                     N  +L  S  S   +SP
Sbjct: 312 IALTAAEQANPRKSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSATHASP 371

Query: 320 FVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSG 379
           +VIAI + G KV+PH  NAVIL +++S GNS  Y SSR+L S+   G AP +L +  + G
Sbjct: 372 YVIAIASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREG 431

Query: 380 IPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQ 439
            P  A++ +++ G ++++ +S     VF WLL I+ ++  F W  I ++HIRF +A+K Q
Sbjct: 432 RPTLAMIISAVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQ 491

Query: 440 GISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILF 495
           G S  +L FK++   WG+YYA             TA AP    K +   FF  Y+++ + 
Sbjct: 492 GRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPIL 551

Query: 496 FAVWIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWEEDEPK 537
            A++ G+++W R   L+     IDL ++RR  D DV ++++ +
Sbjct: 552 IALYFGYKVWKRDWTLYIPASKIDLISNRRIFDEDVLKQEDAE 594

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  300 bits (768), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 186/544 (34%), Positives = 282/544 (51%), Gaps = 29/544 (5%)

Query: 23  SRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALI 82
           +RS     +E+ G+ K   +K+ L  RH+  IALGGTIGTGLF+  S  L   GP G +I
Sbjct: 42  TRSDSSSEVEAEGNGK---LKQGLSSRHVQFIALGGTIGTGLFVGTSVTLKTVGPGGLVI 98

Query: 83  AYMFIGTLAYMVSQSLGEMATFIP-----VTSSFMVFTQRFLSPALGAANGYMYFLSWSI 137
           +Y+ I T+ Y +  +LGEM  ++P        S      R++  +L  A G+ Y+  + I
Sbjct: 99  SYIIISTVIYPIMNALGEMVCYLPGNGEDSAGSVAHLVGRYVDKSLAFATGWNYYYCFVI 158

Query: 138 TFALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIV 197
             A E +    V+ +WT +VP   WI I   ++   N + VK++GE EFW A IK+L I+
Sbjct: 159 LVAAECTAASGVVTYWTTSVPTAVWITIFLGIVTLLNFSAVKYFGETEFWFASIKILCIL 218

Query: 198 GFIIYAFIMVCGAGKTG-PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY- 255
           G I+ +FI+  G G +   +GF YW++PG +   I     + G FL   + +I  AF + 
Sbjct: 219 GLILVSFILFWGGGPSHVRLGFHYWKDPGTFAHHITGG--SWGSFLDIYTGIIKGAFAFI 276

Query: 256 QGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDP----KLKSE 311
            G ELV +T+ E  + R+ + +A  +                      NDP     L+  
Sbjct: 277 LGPELVALTSSECNDQRRNIAKASKRFIWRLMFFYILGTLSISVIVAYNDPVLLNALEEG 336

Query: 312 DSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKY 371
               +SSPFVI I+N+G KVLPHI NA ILS+  SAGNS ++ SSR L +M  NG APK 
Sbjct: 337 KEGAASSPFVIGIQNAGIKVLPHIINACILSSAWSAGNSFMFASSRSLMTMAHNGSAPKI 396

Query: 372 LTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIR 431
                + G+PY +V  ++++  LA+L  S   + VFDW  NI+ ++GF  W+   +A++R
Sbjct: 397 FCKVNRFGVPYYSVGLSAMLSCLAFLNVSSSTAQVFDWFSNISTISGFLGWICAIIAYLR 456

Query: 432 FMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF-NVSDFFTAYV 490
           F +A+ +  +  D LPFK    P+  +Y+               F P+F + SDF  AY+
Sbjct: 457 FRKAIFYNNM-YDRLPFKTFGQPYLIWYSLLVISVITLTNGYQTFIPRFWSGSDFVAAYI 515

Query: 491 SVILFFAVWIGFQIWFRG----PLFK---KTEDIDLDTDRREIDNDVWEED----EPKNL 539
           ++ LF  +W+G + W R     PL K     ++ID+ T   E +    + D     P   
Sbjct: 516 TLPLFLILWVGHKFWARYKHAVPLLKLYYPVDEIDVITGLAEAEEVAEKLDMNRIPPSTY 575

Query: 540 WEKF 543
           W KF
Sbjct: 576 WGKF 579

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  301 bits (771), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 184/531 (34%), Positives = 276/531 (51%), Gaps = 21/531 (3%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G  +  ++K+ L+ RH+ +IALGG IGTGL +  S+ L   GP G  I+Y+ I  + Y +
Sbjct: 103 GDNEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPI 162

Query: 95  SQSLGEMATFIP-----VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQV 149
             +LGEM  F+P        S      R++  +LG A G+ YF  + I  A E +    V
Sbjct: 163 MCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGV 222

Query: 150 IQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG 209
           +++WT AVP   WI I   V+V  NL+ VK YGE EFW A IK+L IVG II +FI+  G
Sbjct: 223 VEYWTTAVPKGVWITIFLCVVVLLNLSAVKVYGESEFWFASIKILCIVGLIILSFILFWG 282

Query: 210 AGKTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVGITAGE 267
            G     +GFRYW++PG +   +    +  G F    + +I  AF +  G ELV +T+ E
Sbjct: 283 GGPNHDRLGFRYWQHPGAFAHHLTGGSL--GNFTDIYTGIIKGAFAFILGPELVCMTSAE 340

Query: 268 AANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY----ISSSPFVIA 323
            A+ R+ + +A  +                      NDP L +  +       SSPFVI 
Sbjct: 341 CADQRRNISKASRRFVWRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKPGAGSSPFVIG 400

Query: 324 IENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYA 383
           I+N+G KVLPHI N  ILS+  SA N+ ++ S+R L +M   G APK L    + G+PY 
Sbjct: 401 IQNAGIKVLPHIINGCILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINRWGVPYV 460

Query: 384 AVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISR 443
           AV  + L   LAYL  S   + VF+W  NI+ ++GF  WM   +A++RF +A+ + G+  
Sbjct: 461 AVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-F 519

Query: 444 DDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF-NVSDFFTAYVSVILFFAVWIGF 502
           D LPFK    P+  + +               F PK+  ++DF  AY+++ +F  +W G 
Sbjct: 520 DRLPFKTWGQPYTVWASLIVVGIITLTNGYAIFIPKYWKIADFIAAYITLPIFLVLWFGH 579

Query: 503 QIWFR--GPLFKKTEDIDLDTDRREIDNDVWEEDE----PKNLWEKFWSAV 547
           +++ R     +    +ID+ T   EI+    E +E    P +  +KF  A+
Sbjct: 580 KLYTRTWSQWWLPVSEIDVTTGLIEIEEKSREIEEMRLPPSSFKDKFMDAL 630

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  301 bits (771), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 179/522 (34%), Positives = 282/522 (54%), Gaps = 21/522 (4%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           K   +K+ +KPRH+ MI+LG  IGTGL +     LS AGP   +I Y  +GT  Y + Q+
Sbjct: 116 KSEDLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGTCLYCIIQA 175

Query: 98  LGEMAT-FIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
            GE+A  +  +   F  +    + PALG +  ++Y L W     LEL      I++WT  
Sbjct: 176 AGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTTK 235

Query: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGP 215
           V    +++I +V++++ N    + Y E EF+  C KVL + GF I   I+  G AG  G 
Sbjct: 236 VDPDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCKVLMMTGFFILGIIITAGGAGNDGY 295

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G +YW +PG +     + D +  RF G + + ++AAF +  TE + +TA E +NPRK +
Sbjct: 296 LGAKYWHDPGAF-----NGDKSIDRFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAI 350

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           P A  KV                     N D  L S  S I +SP+VIA+ + G +V+PH
Sbjct: 351 PSAAKKVLYRIVCIFLASITLIGFLVPYNSDQLLGSGGSGIKASPYVIAVSSHGVRVVPH 410

Query: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394
             NAVIL +++S GNS  Y SSR+L S+   G APK+  +  + G P+ A+L ++L G +
Sbjct: 411 FINAVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAMLMSALFGVI 470

Query: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454
           A+  +S   + VF WLL I+ ++  F W+ I V+HIRF +A++ QG S  ++ + ++   
Sbjct: 471 AFCATSPKETEVFSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEVGYLSQSGV 530

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-P 509
           +G+ YAA             A AP    K +  +FF  Y+++ +  A + G+++W R   
Sbjct: 531 YGSAYAAIMLFLALIAQFWVAIAPIGEGKLDAENFFQNYLAMPILIAFYFGYRVWKRDWK 590

Query: 510 LFKKTEDIDLDTDRREIDNDVW-EEDEP-----KN--LWEKF 543
           LF + +DIDLDT R+  D ++  +EDE      +N  +W +F
Sbjct: 591 LFIRAKDIDLDTHRQIFDENILRQEDEEYKEKLRNGPMWRRF 632

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  302 bits (774), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 182/531 (34%), Positives = 276/531 (51%), Gaps = 21/531 (3%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G     ++K+ L+ RH+ +IALGG IGTGL +  S+ L   GP G  I+Y+ I  + Y +
Sbjct: 155 GDAGPHRLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPI 214

Query: 95  SQSLGEMATFIP-----VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQV 149
             +LGEM  F+P        S      R++  +LG A G+ Y+  + I  A E +    V
Sbjct: 215 MCALGEMVCFLPGDGSDSAGSSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAASGV 274

Query: 150 IQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG 209
           +++WT AVP   WI I   V+V  N + VK YGE EFW A IK+L IVG II +FI+  G
Sbjct: 275 VEYWTTAVPKGVWITIFLCVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWG 334

Query: 210 AG-KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVGITAGE 267
            G K   +GFRYW++PG +   +    +  G F    + +I  AF +  G ELV +T+ E
Sbjct: 335 GGPKHDRLGFRYWQHPGSFAHHLAGGSL--GNFTDIYTGIIKGAFAFILGPELVCMTSAE 392

Query: 268 AANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY----ISSSPFVIA 323
            A+ R+ + +A  +                      NDP L +  +       SSP+VI 
Sbjct: 393 CADQRRNIAKASRRFVWRLIFFYVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYVIG 452

Query: 324 IENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYA 383
           I+N+G KVLPHI N  IL++  SA N+ ++ S+R L +M   G APK L    + G+PY 
Sbjct: 453 IQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVPYV 512

Query: 384 AVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISR 443
           AV  + L   LAYL  S   + VF+W  NI+ ++GF  W+   +A++RF +A+   G+  
Sbjct: 513 AVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFFNGL-Y 571

Query: 444 DDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF-NVSDFFTAYVSVILFFAVWIGF 502
           D LPFK    P+  +++               F PK+ NV+DF  AY+++ +F  +W+G 
Sbjct: 572 DRLPFKTWGQPYTVWFSLTVVSIITITNGYAIFIPKYWNVADFIAAYITLPIFLVLWLGH 631

Query: 503 QIWFR--GPLFKKTEDIDLDTDRREIDNDVWEEDE----PKNLWEKFWSAV 547
           +++ R     +    +ID+ T   EI+    + +E    P    EKF  A+
Sbjct: 632 KLYTRTWNHWWHSVSEIDVTTGLVEIEEKSRDIEELRLPPATFKEKFMDAL 682

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  301 bits (771), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 168/509 (33%), Positives = 274/509 (53%), Gaps = 14/509 (2%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
            +  +K+ +KPRHI M++LG  IGTGL +  S  L+NAGP G +I Y  +G+  Y + Q+
Sbjct: 139 NQENLKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGPAGLVIGYAIMGSCIYCIIQA 198

Query: 98  LGEMAT-FIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
            GE+A  +  +   F  +    + PALG +  ++Y L W     LEL      I++WT  
Sbjct: 199 CGELAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTVK 258

Query: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGP 215
           V    +++I +V+++  N+   K Y E +F+  C K+L I+GF I A I+ CG AG  G 
Sbjct: 259 VDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGY 318

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G RYW NPG +       +    RF G V++ ++AAF +  +E + +TA E +NPRK +
Sbjct: 319 IGSRYWHNPGAF-----RGNTGIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAI 373

Query: 276 PRAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           P A  K +                     +D  L +  S   +SP+VIA+ + G +V+PH
Sbjct: 374 PSAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLLGASGSATKASPYVIAVASHGVRVVPH 433

Query: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394
             NAVIL +++S  N   Y SSR+L S+   G APK   +  + G P  A+L +S+ G +
Sbjct: 434 FINAVILLSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSSIFGII 493

Query: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454
           A+  SS     VF WLL I+ ++  F W+ I ++HIRF +A+K QG S  ++ +K++   
Sbjct: 494 AFCASSPKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGI 553

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG- 508
           WG+ YA              A +P     K +   FF  Y+++ +  A+++ +++W +  
Sbjct: 554 WGSMYAIVMMVLALIAQFWVAISPIGGGGKLSAQSFFENYLAMPILIALYVFYKVWKKDW 613

Query: 509 PLFKKTEDIDLDTDRREIDNDVWEEDEPK 537
            LF   + IDL TDR+  D ++ ++++ +
Sbjct: 614 TLFIPADKIDLVTDRQIFDEELLKQEDEE 642

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  300 bits (768), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 174/507 (34%), Positives = 275/507 (54%), Gaps = 14/507 (2%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           K   +K+ ++PRH+ MIALG  IGTGL +   T L +AGP G LI Y  +G++ Y + Q+
Sbjct: 112 KSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQA 171

Query: 98  LGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
            GEMA  +  +T  +  +    +    G A  ++Y L W     LEL      I++WT +
Sbjct: 172 CGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIM-VCGAGKTGP 215
           V    ++II +V++++ N+   + Y E EF+  C K+L + GF I   I+ V GAG  G 
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGF 291

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G +YW +PG +  G  S D    RF G V++L++AAF + G+E + IT  E ANPRK V
Sbjct: 292 IGGKYWHDPGAFN-GKHSID----RFKGVVATLVTAAFAFGGSEFIAITTAEQANPRKAV 346

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIAIENSGTKVLPH 334
           P A  ++                     N  +L  S      +SP+VIA+ + G +V+PH
Sbjct: 347 PGAAKQMIYRILFLFLATIILLGFLVPYNSNQLLGSSGGGTKASPYVIAVASHGVRVVPH 406

Query: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394
             NAVIL +++S  NS  Y S+R+L ++   G AP+  T+  K+G P  A+  ++L G +
Sbjct: 407 FINAVILLSVLSMANSSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSALFGVI 466

Query: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454
           A+  +S     VF WLL I+ ++  F W  I ++HIRF +A+K QG S  +L F+++   
Sbjct: 467 AFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFRSQTGV 526

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-P 509
           WG+ YA              A AP    K +   FF  Y+++ +  A+++G++IW +   
Sbjct: 527 WGSTYACIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWKKDWK 586

Query: 510 LFKKTEDIDLDTDRREIDND-VWEEDE 535
           LF + + IDL + R+  D + + +EDE
Sbjct: 587 LFIRADKIDLISHRQIFDEELIKQEDE 613

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  301 bits (770), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 169/509 (33%), Positives = 277/509 (54%), Gaps = 14/509 (2%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           K+  +K+++KPRH  M++LG  IGTGL +  S  L+NAGP G +I Y  +G+  Y + Q+
Sbjct: 141 KQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQA 200

Query: 98  LGEMAT-FIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
            GE+A  +  +   F  +    + PALG +  +++ L W     LEL      I++WT +
Sbjct: 201 CGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTTS 260

Query: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGP 215
           V    +++I +V++V  N+   K Y E +F+  C K+L IVGF I A I+ CG AG  G 
Sbjct: 261 VNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTDGY 320

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G +YWR+PG +       D    RF G V++ ++AAF +  +E + +TA E +NPRK +
Sbjct: 321 IGSKYWRDPGAF-----RGDTPIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAI 375

Query: 276 PRAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           P A  K +                     +D  L +  S   +SP+VIA+ + G +V+PH
Sbjct: 376 PSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPH 435

Query: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394
             NAVIL +++S  N   Y SSR+L S+   G APK   +  + G P AA+L ++L G +
Sbjct: 436 FINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFGVI 495

Query: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454
           A+  SS     VF WLL I+ ++  F W+ I ++HIRF +A+K QG S  ++ +K++   
Sbjct: 496 AFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGV 555

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG- 508
           WG+ YA              A AP     K +   FF  Y+++ ++ A++I +++W +  
Sbjct: 556 WGSAYAVLMMVLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYIFYKVWKKDW 615

Query: 509 PLFKKTEDIDLDTDRREIDNDVWEEDEPK 537
            LF   + +DL + R   D ++ ++++ +
Sbjct: 616 SLFIPADKVDLVSHRNIFDEELLKQEDEE 644

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  298 bits (764), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 171/507 (33%), Positives = 268/507 (52%), Gaps = 13/507 (2%)

Query: 36  SVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVS 95
            +  + + + L  RH+  +A+GG IGTGLF++    L+  GP   +I +  + T  + V 
Sbjct: 80  DIHTSNMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVSTALFTVI 139

Query: 96  QSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTD 155
            SLGE+A   PV   F V+  RF+ P+   +    Y + W +   LEL      I++W D
Sbjct: 140 NSLGELAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTIRYWDD 199

Query: 156 AVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVC-GAGKTG 214
            +   AW+ I + +++ ANL  VK +GE EF ++ +K+LAI+GF I   ++ C G  K G
Sbjct: 200 TINSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTCGGGPKGG 259

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
            +G +YW +PG +       D    +F G  S  ++AAF+Y G E++ ++A E+ NPRKT
Sbjct: 260 YIGGKYWHDPGAF-----VGDSAGTQFKGLCSVFVTAAFSYAGIEMIAVSAAESQNPRKT 314

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY--ISSSPFVIAIENSGTKVL 332
           +P A  +                      ND +L +  S   +++SP VIAIEN G K L
Sbjct: 315 IPTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAASPLVIAIENGGIKGL 374

Query: 333 PHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVG 392
           P + NA+IL  I+S  NS VY  SR + SM L G  PK L+   K G P  A+ TT   G
Sbjct: 375 PSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIFTTLFFG 434

Query: 393 FLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKF 452
            L+++ +S     VF WL  ++ ++  F WM I++AHIRF QA+  Q  S D++P+ ++ 
Sbjct: 435 LLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEMPYLSQT 494

Query: 453 MPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG 508
             +G+YY              T+  P      +   FF  Y+S  +  A +IG +++F+ 
Sbjct: 495 GIYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIGHKLYFKN 554

Query: 509 -PLFKKTEDIDLDTDRREIDNDVWEED 534
             +    E+IDL T R+E+D D+ +E+
Sbjct: 555 WRIMTPLEEIDLLTGRKEVDIDILKEE 581

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  298 bits (763), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 177/516 (34%), Positives = 263/516 (50%), Gaps = 15/516 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
            + ++R LK RH+ MIA+GG IGTGLF+   + L   GP   LI +  IG + Y V  ++
Sbjct: 77  RSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAM 136

Query: 99  GEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW-TDAV 157
           GE+A   PV   F  +  RF+  + G A  Y+Y L W +   LE+      + +W T A 
Sbjct: 137 GELAVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAK 196

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
               ++ + +VV+V  N+  VK YGE EF  + IKV  +VGFII   +++CG G  G   
Sbjct: 197 YRDGFVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYV 256

Query: 218 F-RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
             +YW NPG +     + D    RF    S  ++AAF++ GTELVG+ A E  NPRK +P
Sbjct: 257 GGKYWHNPGAF-----NGDNAGQRFKAVCSVFVTAAFSFAGTELVGLAAAETENPRKALP 311

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPHI 335
           RA  +V                         L    S   ++SPFV+AI+  G   LP +
Sbjct: 312 RAAKQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAASPFVLAIKTHGISGLPSV 371

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            N VIL +++S GNS VY  SR L ++   G  P+  ++  + G P   +L T   G L 
Sbjct: 372 INVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCTFGLLC 431

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++  S     VF+WL+ ++ ++  F W  I + H+RF +AL  QG S D+L F +    W
Sbjct: 432 FIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTSYVGVW 491

Query: 456 GAYYAAXXXXXXXXXXXXTAFAPKF---NVSDFFTAYVSVILFFAVWIGFQIWFRGPLF- 511
           G+Y+               A  P     N SDFF AY+SV++    ++  +++ R   F 
Sbjct: 492 GSYFGVILICLVFIAQFWIAVWPMGGTPNASDFFQAYLSVVVVLFFYLAHKLYTRNWTFA 551

Query: 512 KKTEDIDLDTDRREIDNDVWEE---DEPKNLWEKFW 544
           K+ +DID+DT RRE+D D  ++   +E   L  K W
Sbjct: 552 KRAKDIDIDTGRRELDLDALKQEIAEEKLRLSTKPW 587

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  298 bits (763), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 171/506 (33%), Positives = 264/506 (52%), Gaps = 13/506 (2%)

Query: 37  VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQ 96
           +  T + + L  RH+  +A+GG IGTGL+++    LS  GP   +I ++ I T  + V  
Sbjct: 81  INNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVIN 140

Query: 97  SLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
           SLGE++   PV   F V++ RF+ P+   A    Y   W +   LEL      I++W D 
Sbjct: 141 SLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDK 200

Query: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVC-GAGKTGP 215
           +   AW+ I +  +  AN+  VK +GE EF ++ IK+L+I+GF I   ++ C G    G 
Sbjct: 201 INSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGY 260

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G +YW +PG +         +  +F G  S  ++AAF+Y G E+  ++A E+ NPR+T+
Sbjct: 261 IGGKYWHDPGAF-----VGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETI 315

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSPFVIAIENSGTKVLP 333
           P+A  +                      NDP+L +  S +  +SSP VIAIEN G K LP
Sbjct: 316 PKAAKRTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGLP 375

Query: 334 HIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGF 393
            + NA+IL  ++S  NS VY  SR + +M   G  PK+L    K G P  A+L T   G 
Sbjct: 376 SLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGL 435

Query: 394 LAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFM 453
           L+++ +S   + VF WL  ++ ++  F WM I+++HIRF QA+K Q  S D+LPF ++  
Sbjct: 436 LSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQTG 495

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG- 508
             G++Y              T+  P      N   FF  Y+S  +    + G +I+ R  
Sbjct: 496 VKGSWYGFIVLFLVLIASFWTSLFPLGSSGANAESFFEGYLSFPILIVCYFGHKIYTRNW 555

Query: 509 PLFKKTEDIDLDTDRREIDNDVWEED 534
            L  K EDIDLDT R+++D  +  E+
Sbjct: 556 TLMVKLEDIDLDTGRKQVDLALRREE 581

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  300 bits (767), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 168/509 (33%), Positives = 273/509 (53%), Gaps = 14/509 (2%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           K+  +K+++KPRH  M++LG  IGTGL +  S  L+NAGP G +I Y  +G+  Y + Q+
Sbjct: 141 KQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQA 200

Query: 98  LGEMAT-FIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
            GE+A  +  +   F  +    + PALG +  +++ L W     LEL      I++WT  
Sbjct: 201 CGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVK 260

Query: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGP 215
           V    +++I +V+++  N+   K Y E +F+  C K+L I+GF I A I+ CG AG  G 
Sbjct: 261 VDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGY 320

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G +YWR+PG +       D    RF G V++ ++AAF +  +E + +TA E +NPRK +
Sbjct: 321 IGSKYWRDPGAF-----RGDTPIQRFKGIVATFVTAAFAFGMSEQLAMTASEQSNPRKAI 375

Query: 276 PRAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           P A  K +                     +D  L +  S   +SP+VIA+ + G +V+PH
Sbjct: 376 PSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPH 435

Query: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394
             NAVIL +++S  NS  Y SSR+L S+   G APK   +  + G P  A+L ++L G +
Sbjct: 436 FINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSALFGVI 495

Query: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454
           A+  SS     VF WLL I+ ++  F W+ I ++HIRF +A+K QG S  ++ +K++   
Sbjct: 496 AFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGV 555

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG- 508
           WG+ YA              A AP     K +   FF  Y+++ +  A++I F++W    
Sbjct: 556 WGSAYAVLMMMLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPILIALYIFFKVWKNDW 615

Query: 509 PLFKKTEDIDLDTDRREIDNDVWEEDEPK 537
            LF     +DL + R   D ++ ++++ +
Sbjct: 616 SLFIPANKVDLVSHRNIFDEELLKQEDEE 644

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  297 bits (761), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 170/511 (33%), Positives = 272/511 (53%), Gaps = 20/511 (3%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
             Q+++ ++PRH+ MI+LG  IGTGL +     L NAGP G LI Y+ + +  Y + Q+ 
Sbjct: 77  NNQLQKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCIYCIIQAC 136

Query: 99  GEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           GEMA  ++ +   F  +    +  A   A  ++Y + W     LEL      I++W + V
Sbjct: 137 GEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKV 196

Query: 158 PLTAWIIILWVVLVSANL-APVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGP 215
               ++ I ++++++ NL    + Y E EF+    K+L I GF I   I++CG AG +G 
Sbjct: 197 DPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICGGAGTSGY 256

Query: 216 VGFRYWRNPGPW---GPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPR 272
           +G  YW NPG +    PG         RF G VS+L++AAF++  TE + ITA E +NPR
Sbjct: 257 IGVSYWNNPGAFRGHTPGT--------RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPR 308

Query: 273 KTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIAIENSGTKV 331
           K +P A  KV                     N P+L  S+ S   +SP+VIA+ + G ++
Sbjct: 309 KAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRI 368

Query: 332 LPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLV 391
            PH  NAVIL +++S  NS  Y SSR+L ++   G APK  T+  + G P   ++  SL+
Sbjct: 369 APHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLL 428

Query: 392 GFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAK 451
             +A+  SS   + VF WLL I+ ++  F W  I ++HIRF +A+K QG S ++L +K++
Sbjct: 429 ATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQ 488

Query: 452 FMPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFR 507
              WG+ YAA             A  P      N+++FF  Y+++ +    + G++ W +
Sbjct: 489 VGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKK 548

Query: 508 G-PLFKKTEDIDLDTDRREIDNDVWEEDEPK 537
              LF + +DIDL + R   D DV ++++ +
Sbjct: 549 DWNLFIRAKDIDLISHRHIYDEDVLKQEKNQ 579

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  296 bits (758), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 171/510 (33%), Positives = 268/510 (52%), Gaps = 23/510 (4%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
            + +KR LK RH+ MIA+GG+IGTGLF+     L   GP   ++A++  G++ Y V Q++
Sbjct: 81  RSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAI 140

Query: 99  GEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT-DAV 157
           GE+   +PV+ S++ +  RF+ P+ G A  Y Y +   +T  LE+      + +W  D  
Sbjct: 141 GELCVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHK 200

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG--KTGP 215
               ++ + +V ++  N   VK YGE EF  + IKVLAIVGFII   ++VCG G   TG 
Sbjct: 201 YADGFVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGY 260

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G +YW NPG +  G          F G+ +  +++AF++ G+E+  + A E+ NPR+ +
Sbjct: 261 IGTKYWHNPGGFAHG----------FKGFAAIFVTSAFSFSGSEMFALGAAESKNPRRDL 310

Query: 276 PRAINKVX-XXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           P+A  +V                      N     S     S+SPFVIAI+ +G   LP 
Sbjct: 311 PKAAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASASPFVIAIKEAGISGLPS 370

Query: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394
           + N VIL  ++S GN+ V+ SSR   S+   G  PK   +  + G P A ++ + + G L
Sbjct: 371 VINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLL 430

Query: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454
           ++L SS    VVF+W+L ++ +  FF W  I V H+RF Q L+ QG S D+L FKA+   
Sbjct: 431 SFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQTGI 490

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP---KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-PL 510
           WG+ Y               A  P     +   FF  Y+S+ +    ++G +++ R   L
Sbjct: 491 WGSIYGITLISVVLCFQFWVALFPLSKSPSAYHFFEQYLSLPVVIVFYMGHKVYSRNWRL 550

Query: 511 FKKTEDIDLDTDRREID-----NDVWEEDE 535
               +++DLDT RRE+D      ++ EE+E
Sbjct: 551 VIPAKELDLDTGRREVDLELLKQEIKEENE 580

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  297 bits (760), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 171/507 (33%), Positives = 275/507 (54%), Gaps = 14/507 (2%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           K   +K+ ++PRH+ MIALG  IGTGL +   T L +AGP G LI Y  +G++ Y + Q+
Sbjct: 112 KSGSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQA 171

Query: 98  LGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
            GE+A  +  +T  +  +    +    G A  ++Y L W     LEL      I++WT +
Sbjct: 172 CGELALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIM-VCGAGKTGP 215
           V    ++II +V++++ N+   + Y E EF+  C K+L + GF I + I+ V GAG  G 
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGNDGF 291

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G +YW +PG +  G  S D    RF G V++L++AAF + G+E + IT  E +NPRK +
Sbjct: 292 IGGKYWHDPGAFN-GKHSID----RFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAI 346

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           P A  ++                     N D  L S      +SP+VIAI + G +V+PH
Sbjct: 347 PGAAKQMIYRILFLFLATIIMLGFLVPYNSDQLLGSGGGGTKASPYVIAIASHGVRVVPH 406

Query: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394
             NAVIL +++S  NS  Y S+R+  ++   G APK+ ++  ++G P  A+  ++L   +
Sbjct: 407 FVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALFAVI 466

Query: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454
           A+  +S     VF WLL I+ ++  F W  I  +HIRF +A+K QG S  +L FK++   
Sbjct: 467 AFCAASPKEEQVFTWLLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFKSQTGV 526

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-P 509
           WG+ YA              A AP    K +   FF  Y+++ +  A+++G++IW +   
Sbjct: 527 WGSMYACIMMLLILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWTKDWK 586

Query: 510 LFKKTEDIDLDTDRREIDND-VWEEDE 535
           LF + + IDL++ R+  D + + +EDE
Sbjct: 587 LFIRADKIDLESHRQIFDEELIKQEDE 613

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  298 bits (763), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 172/523 (32%), Positives = 278/523 (53%), Gaps = 18/523 (3%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           K+  +K+++KPRH  M++LG  IGTGL +  S  L+NAGP G +I Y  +G+  Y + Q+
Sbjct: 141 KQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQA 200

Query: 98  LGEMAT-FIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
            GE+A  +  +   F  +    + PA+G +  +++ L W     LEL      I++WT  
Sbjct: 201 CGELAVIYSDLIGGFNTYPSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVK 260

Query: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGP 215
           V    ++II +V+++  N+   K Y E +F+  C K+L I GF I A I+ CG AG  G 
Sbjct: 261 VNADVFVIIFYVLILVINIFGAKGYAEADFFFNCCKILMITGFFILAIIIDCGGAGTDGY 320

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G RYWR+PG +       D +  RF G V++ ++AAF +  +E + +TA E +NPRK +
Sbjct: 321 IGSRYWRDPGAF-----RGDTSIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAI 375

Query: 276 PRAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           P A  K +                     +D  L +  S   +SP+VIA+ + G +V+PH
Sbjct: 376 PSAAKKMIYRILFVFLASLALVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPH 435

Query: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394
             NAVIL +++S  NS  Y SSR+L S+   G APK   +  + G P  A++ +++ G +
Sbjct: 436 FINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMIVSAVFGVI 495

Query: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454
           A+  SS     VF WLL I+ ++  F W+ I ++HIRF + +K QG S  ++ +K++   
Sbjct: 496 AFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEVGYKSQVGV 555

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG- 508
           WG+ YA              A +P     K +   FF  Y+++ +  A++I +++W R  
Sbjct: 556 WGSAYAVVLMVLALIGQFWVAISPIGGDKKLSAQSFFENYLAMPILIALYIFYKVWKRDW 615

Query: 509 PLFKKTEDIDLDTDRREIDNDV--WEEDEPKNLWEK--FWSAV 547
            LF   + IDL + R   D ++   E++E K+      FW  V
Sbjct: 616 SLFIPADKIDLVSHRNIFDEELLKQEDEEYKDRLRNGPFWKRV 658

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  296 bits (759), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 163/508 (32%), Positives = 269/508 (52%), Gaps = 13/508 (2%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           K  ++K+ +KPRH+ +I+LG  IGTGL +  +  L NAGP G LI Y  +GT  Y + Q+
Sbjct: 102 KNKELKQTIKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQA 161

Query: 98  LGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
            GE+A ++  ++  F V+    + PA G +  ++Y + W     LEL      I++WT  
Sbjct: 162 AGELAVSYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTT 221

Query: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIM-VCGAGKTGP 215
           V    ++ I +V+++  N    + Y E EF+  C K+L ++GF I   ++   GAG  G 
Sbjct: 222 VNADIFVGIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFILGIVINTGGAGNDGY 281

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G RYW  PG +     + D     F G ++++++AAF +  TE + +TA E +NPRK +
Sbjct: 282 IGDRYWHTPGAF-----AGDRPIDHFKGIMATMVTAAFAFGATEFIALTAAEQSNPRKAI 336

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           P A  KV                     + D  + S  S   +SP+V+A+   G KV+PH
Sbjct: 337 PSAAKKVLYRILFIFLGSITLVGFLVPYDSDQLMGSGGSATKASPYVLAVSTHGVKVVPH 396

Query: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394
             NAVIL +++S GNS  Y SSR+LYS+   G APK+  +  + G P+ A++   +   +
Sbjct: 397 FINAVILLSVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRPFRAMVCAGVFAII 456

Query: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454
           ++  +S     VF WLL I+ ++  F W  I ++HIRF +A+  Q  S  ++ FKA+   
Sbjct: 457 SFCAASPKEEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKRSLGEIGFKAQTGV 516

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-P 509
           WG+YY               A AP    K +   FF  Y+++ +    ++G++IW +   
Sbjct: 517 WGSYYVCFMLVMILIAQFWVAIAPIGEGKLDAQGFFENYLAMPILILFYVGYKIWKKDWS 576

Query: 510 LFKKTEDIDLDTDRREIDNDVWEEDEPK 537
           LF +  +IDLD  R+  D ++ ++++ +
Sbjct: 577 LFIRANNIDLDKHRQIFDEELLKQEDEE 604

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  296 bits (758), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 182/522 (34%), Positives = 274/522 (52%), Gaps = 15/522 (2%)

Query: 24  RSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIA 83
           R  D  SL+   + K  ++K+ ++PRH+ MI+LG  IGTGL +     L N GP G  + 
Sbjct: 73  RENDQESLQD--NNKHEKLKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGPGGLAVG 130

Query: 84  YMFIGTLAYMVSQSLGEMATFIPVTSS-FMVFTQRFLSPALGAANGYMYFLSWSITFALE 142
           +  +GT  Y V Q+ GEMA   P  S  F  +    + P  G A  ++Y + W   F LE
Sbjct: 131 FFVMGTCVYCVIQAAGEMAVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWLCVFPLE 190

Query: 143 LSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIY 202
           L      I++WT A+    ++ + +++++  N    + Y E EF+    KVL I+GF I 
Sbjct: 191 LVTASITIKYWTTAINPDIFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMIIGFFIV 250

Query: 203 AFIMVCGA-GKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELV 261
             ++  GA G  G +G +YWR PG +G G  + D     F G VS+L++AAF+   +E V
Sbjct: 251 GILVNTGAAGNDGYIGAKYWREPGSFG-GHTAID----HFKGVVSTLVNAAFSLGCSEFV 305

Query: 262 GITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK-SEDSYISSSPF 320
            +TA E ANPRK+VP A  K+                     N  +L  S DS +  SP+
Sbjct: 306 ALTAAEQANPRKSVPSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDSSVHVSPY 365

Query: 321 VIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGI 380
           VIA+ + G +V+PH  NAVIL +++S GNS  Y SSR+L S+   G AP    +  + G 
Sbjct: 366 VIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQGR 425

Query: 381 PYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQG 440
           P  A++ +  +G L ++ +S     VF WLL I+ ++  F W  I ++HIRF +AL  QG
Sbjct: 426 PLMAMMVSITMGCLCFVAASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRKALLVQG 485

Query: 441 ISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFF 496
              D L FKA+   WG+YY+A            T   P    K N   FF  Y++  +F 
Sbjct: 486 RGWDGLGFKAQTGVWGSYYSAVIMILTFIAQFWTCLIPMGSSKPNAESFFEGYLAFPIFV 545

Query: 497 AVWIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWEEDEPK 537
           A++ G++I+ +   LF   E IDLD  R+  D DV ++++ +
Sbjct: 546 ALYFGYKIYNKNWQLFIPAEKIDLDLHRKIFDADVLKQEDAE 587

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  296 bits (759), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 168/507 (33%), Positives = 273/507 (53%), Gaps = 14/507 (2%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           K   +K+ ++PRH+ MIALG  IGTGL +   T L +AGP G LI Y  +G++ Y + Q+
Sbjct: 112 KSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQA 171

Query: 98  LGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
            GEMA  +  +T  +  +    +    G A  ++Y L W     LEL      I++WT +
Sbjct: 172 CGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIM-VCGAGKTGP 215
           V    ++II +V++++ N+   + Y E EF+  C K+L + GF I   I+ V GAG  G 
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGF 291

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G +YW +PG +  G  + D    RF G  ++L++AAF + G+E + IT  E +NPRK +
Sbjct: 292 IGGKYWHDPGAFN-GKHAID----RFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAI 346

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           P A  ++                     N D  L S      +SP+VIA+ + G +V+PH
Sbjct: 347 PGAAKQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPH 406

Query: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394
             NAVIL +++S  NS  Y S+R+  ++   G APK  ++  ++G P  A+  ++L   +
Sbjct: 407 FINAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVI 466

Query: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454
           A+  +S     VF WLL I+ ++  F W  I ++H+RF +A+K QG S  +L FK++   
Sbjct: 467 AFCAASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGV 526

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-P 509
           WG+ YA              A AP    K +   FF  Y+++ +  A+++G+++W +   
Sbjct: 527 WGSAYACIMMILILIAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKVWHKDWK 586

Query: 510 LFKKTEDIDLDTDRREIDND-VWEEDE 535
           LF + + IDLD+ R+  D + + +EDE
Sbjct: 587 LFIRADKIDLDSHRQIFDEELIKQEDE 613

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  295 bits (756), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 181/526 (34%), Positives = 268/526 (50%), Gaps = 26/526 (4%)

Query: 22  FSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGAL 81
           F R  D       GS     +KR LK RH+ MIA+GG+IGTGLFI     L++ GP+  +
Sbjct: 65  FQRCIDSFKPPLDGSFHTHNLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALI 124

Query: 82  IAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFAL 141
           I +   GT        LGE+    PV  +F  ++ RFL P++      +Y + W     L
Sbjct: 125 IGWSIAGTQIVGTIHGLGEITVRFPVVGAFANYSTRFLDPSISFVISTIYVIQWFFVLPL 184

Query: 142 ELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFII 201
           E+      IQ+W  ++    W+ I + V+VS NL   + +GE EF  + IKV+ I+GFII
Sbjct: 185 EIIASAMTIQYWNQSIDPVVWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFII 244

Query: 202 YAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTEL 260
              +++CG G     VG RYW +PG    G          F G +S L+ A+++  GTE+
Sbjct: 245 LCIVLICGGGPDHDFVGARYWHDPGCLSHG----------FPGVLSVLVVASYSLGGTEM 294

Query: 261 VGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPF 320
           V + +GE  NPR+ +P AI +                       +P L    S +++SPF
Sbjct: 295 VCLASGE-TNPRE-LPSAIKQTFWRILFFFLISLTLIGFLVPYTNPNLLGGSS-VNNSPF 351

Query: 321 VIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGI 380
           VIAI+    K LP I NAVIL +I+S GNS ++ SSR L SM   GL PK+  +  ++G 
Sbjct: 352 VIAIKLHHIKALPSIVNAVILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGR 411

Query: 381 PYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQG 440
           P   +LT SL G LA+L  S     VFDWL+ I  +A    W+ I+++HIRF  A+K QG
Sbjct: 412 PLTGILTNSLFGLLAFLVKSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQG 471

Query: 441 ISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSD-------FFTAYVSVI 493
            S D+L F +    WG+ Y+A             A  P     D       FF +Y+  +
Sbjct: 472 KSLDELEFVSAVGMWGSAYSALINSLILIAQFYCALWPIGGWKDSSERAKTFFQSYLCAL 531

Query: 494 LFFAVWIGFQIWFRGPLFK-----KTEDIDLDTDRREIDNDVWEED 534
           +   +++  ++++R    K       + IDL+TDR+ ID DV +++
Sbjct: 532 IMAFLFVCHKVFYRYKTGKWWAIMDLDKIDLETDRKNIDIDVLKQE 577

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  295 bits (756), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 175/503 (34%), Positives = 262/503 (52%), Gaps = 11/503 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
            + ++  LK RH+ MIA+GG IGTGLF+   T L  AGP G LI +   GT+ Y +  +L
Sbjct: 78  NSPLQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMAL 137

Query: 99  GEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW-TDAV 157
           GE+A   PV+  F  +  RF+  + G AN   Y L W +   LE+      + +W T+  
Sbjct: 138 GELAVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLEIVAASITVNYWGTNPR 197

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKT-GPV 216
               ++ + W+ +   NL  VK YGE EF  + IKV+ +VGFII   I+ CG G   G +
Sbjct: 198 YRDGFVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFIILGIILNCGGGPVKGYI 257

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           G RYW +P     G    D    RF G  S  ++AAF++ G+ELVG+ + E ANPRK+VP
Sbjct: 258 GGRYWHHP----YGAFVGDSAGARFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSVP 313

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPHI 335
           +A  +V                      + +L    S   ++SPFVIAI   G + LP +
Sbjct: 314 KAAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGASSVDAAASPFVIAITTHGIRGLPSV 373

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            N VIL  ++S GNS +Y  SR L ++      PK+  +  +SG P  ++L TS  G +A
Sbjct: 374 VNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRSGRPLYSILVTSGFGLVA 433

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++  S     VF+WLL ++ ++  F W  I + HIRF +AL  QG   D+L F +    +
Sbjct: 434 FVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSAQGRGTDELSFVSPAGVY 493

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP---KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-PLF 511
           G+Y+               A  P   K N   FF AY+S  +  A ++G +I+ +   +F
Sbjct: 494 GSYWGLFMIILMFIAQFYVALFPPGAKPNAKAFFEAYLSFPIVIACYLGHKIYKKNWKIF 553

Query: 512 KKTEDIDLDTDRREIDNDVWEED 534
            K ED+D+DT R++ D D+  ++
Sbjct: 554 IKAEDMDIDTGRKDDDLDLLRQE 576

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  295 bits (755), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 170/514 (33%), Positives = 268/514 (52%), Gaps = 17/514 (3%)

Query: 22  FSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGAL 81
           F R++D    +    +  T + + L  RH+  +A+GG IGTGL+++    LS  GP   +
Sbjct: 70  FRRNEDTEQED----INNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLV 125

Query: 82  IAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFAL 141
           I ++ I T  + V  SLGE++   PV   F V++ RF+ P+   A    Y   W +   L
Sbjct: 126 IDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFIEPSFAFAVNLNYLAQWLVLLPL 185

Query: 142 ELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFII 201
           EL      I++W D +   AW+ I +  +  AN+  VK +GE EF ++ IK+L+I+GF I
Sbjct: 186 ELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTI 245

Query: 202 YAFIMVC-GAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTEL 260
              ++ C G    G +G +YW +PG +         +  +F G  S  ++AAF+Y G E+
Sbjct: 246 LGIVLSCGGGPHGGYIGGKYWHDPGAF-----VGHSSGTQFKGLCSVFVTAAFSYSGIEM 300

Query: 261 VGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSS 318
             ++A E+ NPR+T+P+A  +                      NDP+L +  S +  +SS
Sbjct: 301 TAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASS 360

Query: 319 PFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKS 378
           P VIAIEN G K LP + NA+IL  ++S  NS VY  SR + +M   G  PK+L    K 
Sbjct: 361 PLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKR 420

Query: 379 GIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKH 438
           G P  A+L T   G L+++ +S   + VF WL  ++ ++  F WM I+++HIRF QA+K 
Sbjct: 421 GRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKV 480

Query: 439 QGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVIL 494
           Q  S D+LPF ++    G++Y              T+  P      +   FF  Y+S  +
Sbjct: 481 QERSLDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGGSGASAESFFEGYLSFPI 540

Query: 495 FFAVWIGFQIWFRG-PLFKKTEDIDLDTDRREID 527
               ++G +++ R   L  K ED+DLDT R+++D
Sbjct: 541 LIVCYVGHKLYTRNWTLMVKLEDMDLDTGRKQVD 574

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  295 bits (754), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 172/512 (33%), Positives = 267/512 (52%), Gaps = 17/512 (3%)

Query: 28  VVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFI 87
           V+S E    +    + + L  RH+  +A+GG+IG GLF++    L++ GP   +I ++ I
Sbjct: 63  VISHED--DINNVNLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIII 120

Query: 88  GTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVG 147
            T  + V  +LGEMA   PV   F V+  RF+ P++G A    Y   W +   LEL    
Sbjct: 121 STCLFTVINALGEMAAAFPVVGGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAAS 180

Query: 148 QVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMV 207
             I++W + +   AW+ I + V+  AN+  VK +GE EF ++ IK+LAI+GF I   ++ 
Sbjct: 181 MTIKYWNETINSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLA 240

Query: 208 C-GAGKTGPVGFRYWRNPGPWGPGIISKDVNEG-RFLGWVSSLISAAFTYQGTELVGITA 265
           C G    G +G +YW +PG +         N G +F G  S  ++AAF+Y G E+  ++A
Sbjct: 241 CGGGPHGGFIGGKYWNHPGSF------VGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVSA 294

Query: 266 GEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSPFVIA 323
            E+ +PR T+P+A  +                      +DP+L S  S +  +SSP VIA
Sbjct: 295 AESKDPRTTIPKAAKRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAASSPLVIA 354

Query: 324 IENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYA 383
           IEN G K LP + NA+IL +IIS  NS VY  SR + +M   G  P+ L      G P  
Sbjct: 355 IENDGIKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMN 414

Query: 384 AVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISR 443
           A++ T   G L+++ +S   + VF WL  ++ ++  F WM I+++HIRF Q++  Q  S 
Sbjct: 415 AIIFTLFFGLLSFVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSL 474

Query: 444 DDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVW 499
           D+LPF ++   WG++Y              T+  P      +   FF  Y+S  +  A +
Sbjct: 475 DELPFLSQTGVWGSWYGTIVLFLVLVASFWTSLFPLGGTSADAESFFEGYLSFPILLACY 534

Query: 500 IGFQIWFRGPLFK-KTEDIDLDTDRREIDNDV 530
            G +++ R   F     D+DLDT RR++D DV
Sbjct: 535 FGHKLYVRKREFMVGLADMDLDTGRRQVDLDV 566

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  293 bits (750), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 169/519 (32%), Positives = 275/519 (52%), Gaps = 17/519 (3%)

Query: 37  VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQ 96
           +  T + + L  RH+  +A+GG+IGTGLF++  T LS+ GP   ++ ++ I T  + V  
Sbjct: 38  LNNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVIN 97

Query: 97  SLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
           SLGE+A   P+   F V+  RF+ P++G A    Y   W +   LEL      I++W D 
Sbjct: 98  SLGELAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDK 157

Query: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVC-GAGKTGP 215
           +   AW+ I +V +V AN+  VK +GE EF ++ +K+LAI+GF I   ++   G    G 
Sbjct: 158 INSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGY 217

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +GF+YW NPG +  G      N  +F G  S  ++AAF++ G E++ ++A E+ NPRK +
Sbjct: 218 LGFKYWNNPGAFVGG-----TNASKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVI 272

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSPFVIAIENSGTKVLP 333
           P+A  +                      ND +L +  + +  ++SP VIAIEN G K LP
Sbjct: 273 PKAAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAASPLVIAIENGGIKGLP 332

Query: 334 HIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGF 393
            + NA+IL  I+S  NS VY  SR + SM   G  PK L+   K G P  A++ T + G 
Sbjct: 333 SLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFGL 392

Query: 394 LAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFM 453
           L+++ +S   + VF WL  ++ ++  F WM I+ + IRF +A++ Q  S D+LP+ ++  
Sbjct: 393 LSFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQTG 452

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRGP 509
            WGA+Y              T+  P      +   FF +++S+ +    + G +++F   
Sbjct: 453 IWGAWYGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHKLYFARN 512

Query: 510 --LFKKTEDIDLDTDRREIDNDVWE---EDEPKNLWEKF 543
             L    E++D+D+ R+ ID +  +   E+E K +   F
Sbjct: 513 WRLQIGAEEMDIDSGRKIIDEEGLKQEREEEEKAMNSSF 551

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  295 bits (755), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 174/529 (32%), Positives = 274/529 (51%), Gaps = 16/529 (3%)

Query: 24  RSKDVVSLESL---GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGA 80
           R K++  +E      +   +Q+ + L  RH+  +A+GG IGTGLF++    L+  GP   
Sbjct: 88  RYKEMTDVERAVCDAARNSSQLSKNLSIRHLLTLAVGGAIGTGLFVNSGASLNTGGPGSI 147

Query: 81  LIAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFA 140
           LIA+  I T  + +  SLGE+A+  PV   F V+  RF+ P+ G A    Y   W++   
Sbjct: 148 LIAWTLISTCLFTIVNSLGELASAFPVVGGFNVYITRFVEPSFGFAVNISYLAQWAVLLP 207

Query: 141 LELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFI 200
           LEL+     I++W + +   AW+ I +V +  AN+  VK +GE EF ++ +K+LAI GF 
Sbjct: 208 LELAAASITIKYWNNKINSDAWVAIFYVCIALANMLDVKSFGETEFVLSMVKILAIFGFA 267

Query: 201 IYAFIMVCGAGKTGPVGF-RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTE 259
           I   +++CG G  G     +YW +PG +       D    +F G  S  ++AAF+Y GTE
Sbjct: 268 ILGTVLICGGGPVGGFIGAKYWHDPGAF-----VGDTPGAQFKGLCSVFVTAAFSYSGTE 322

Query: 260 LVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY--ISS 317
           LVG++A E+ NPR T+PRA  +                      NDP+L +  S   +++
Sbjct: 323 LVGVSAAESINPRYTIPRASKRSFWLITSSYLLVLTIAGCLVPSNDPRLLNGMSSVDVAA 382

Query: 318 SPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTK 377
           SP VIAIEN G + +P + NA+IL  IIS  NS VY  SR + SM   G  PK   +  +
Sbjct: 383 SPLVIAIENGGIRGVPSLMNAIILIAIISVANSSVYACSRCMVSMAQVGNLPKVFNYIDR 442

Query: 378 SGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALK 437
            G P  A+L T + G L+++ +S     +F WL  ++ ++  F W  I+++HIRF +A+ 
Sbjct: 443 KGRPLVAILATLVFGLLSFVAASDKQEAIFTWLSALSGLSTLFCWFAINISHIRFRRAMC 502

Query: 438 HQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF----NVSDFFTAYVSVI 493
            Q  S D+LP+ +     G++Y A            T+  P      +   FF  Y+S  
Sbjct: 503 AQQRSLDELPYLSLTGVLGSWYGAAVLLFVLVLSFWTSLFPPGSSGPSAESFFEGYLSFP 562

Query: 494 LFFAVWIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWEEDEPKNLWE 541
           +F   +I  +++ R   LF     ID+D+ RR +D +  +E + +   E
Sbjct: 563 IFLICYISHKLYKRDWRLFIPAGQIDVDSGRRALDIEELKEQKLREQAE 611

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  293 bits (751), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 178/521 (34%), Positives = 271/521 (52%), Gaps = 18/521 (3%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           +E QV R LK RHI +IALGG IGTGLFI     LS  GP   LI+YM +    + +   
Sbjct: 63  QEHQVARKLKSRHIQLIALGGAIGTGLFIGSGGALSVCGPAPLLISYMIMSFFVWCIMNF 122

Query: 98  LGEMATFIPVT--SSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTD 155
           L EM   +P++  +S    T  +L+  L    G   F + S+    E++    +IQ+WTD
Sbjct: 123 LTEMVCMMPISGETSMFAMTGTYLNKPLSFMCGINLFYAMSMIAPSEITATAILIQYWTD 182

Query: 156 AVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG--KT 213
           A     +I I  VV VS  + PV F+GE EFW++ IK+  I G +I   ++  G    + 
Sbjct: 183 ANS-AIFISIFIVVTVSLTMLPVHFFGESEFWVSIIKLFCITGLVILGIVIFFGGAPNQD 241

Query: 214 GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGT-ELVGITAGEAANPR 272
             +GF YW++PG + P ++    N G+FL   +++I + F+Y    E+V   A EA +PR
Sbjct: 242 KVLGFHYWKHPGAFNPHLVPG--NTGKFLACWTAIIKSGFSYVLVPEVVVSCAAEAKDPR 299

Query: 273 KTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL----KSEDSYISSSPFVIAIENSG 328
           + +PR   +                      ++ +L     + +S  ++SPFVI I+  G
Sbjct: 300 RNMPRVAQRFVYRLALFYVCGSLTIGIMVGYDNSRLLNAIAAGESNAAASPFVIGIQEVG 359

Query: 329 TKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTT 388
            +VLPHI NA IL++  S G S +Y +SRVL+SM +NG  PK    T + G PY +    
Sbjct: 360 IRVLPHIINACILTSAYSCGTSVLYGASRVLHSMAVNGAVPKIFATTNRFGTPYYSTAAA 419

Query: 389 SLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPF 448
           S+   LAYL  S  +SVVF WL NI  ++GF  WML+ V ++RF + ++H  ++ D +PF
Sbjct: 420 SVFCLLAYLNCSDSSSVVFTWLSNIATISGFVDWMLVCVVYLRFRKVIEHANLT-DKMPF 478

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFNVSDFFTAYVSVILFFAVWIGFQIWFR 507
           + +FM   AY +               F A  +NVSDFF  Y ++ L   ++IG  I+++
Sbjct: 479 RKRFMKPLAYLSCGFFAILSLTNGYAVFVADNWNVSDFFACYTTLGLAAVLYIGAAIYYK 538

Query: 508 GPLFKKTEDIDLDTDRREIDNDVWEEDE----PKNLWEKFW 544
               +  +++  +   +    D  E+ E    PKN  EK W
Sbjct: 539 TIKLRDLDEVAAEIIPKIAMADEEEKGEVPIVPKNWLEKVW 579

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  293 bits (751), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 181/522 (34%), Positives = 272/522 (52%), Gaps = 20/522 (3%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
            + +K  LK RH+ MIA+GG IGTGLF+     L  AGP G LI +   GT+ Y +  ++
Sbjct: 84  RSPLKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTGTMIYSMVMAV 143

Query: 99  GEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW-TDAV 157
           GE+A   PV+  F  +  RF+  + G A  + Y L W IT  LE+      + +W  DA 
Sbjct: 144 GELAVVFPVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSASITVNYWGVDAK 203

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
               ++ + WV  V  NL  VK YGE EF  A IKV+ I+GFII A I++CG G  G   
Sbjct: 204 YRDGFVALFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVILICGGGPVGGYI 263

Query: 218 F-RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
             +YW +PG +       D    +F G+ +  I+A+F++ G+E+VG+   E+ NPRK+VP
Sbjct: 264 GAKYWHHPGAF-----VGDTAGQKFKGFCTVFITASFSFGGSEVVGVAGSESENPRKSVP 318

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPHI 335
            A  +V                     ND +L    S   ++SPFVIA+ N G + LP +
Sbjct: 319 GAAKQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASSVDAAASPFVIAVVNQGIRGLPSV 378

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            N VIL +++S GNS +Y+ SR L ++   G  PK + +  ++G P  A+   S  G +A
Sbjct: 379 INVVILISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAIGIASAFGLIA 438

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++  S     VF+WLL ++ ++  F+W  I + HIRF +AL  QG S D+LPF +     
Sbjct: 439 FVAESSHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRSTDELPFVSTVGIA 498

Query: 456 GAYYAAXXXXXXXXXXXXTAFAPKF---NVSDFFTAYVSVILFFAVWIGFQIWFRG-PLF 511
           G+Y+                  P     N  DFF AY+S  +  A +I  +IW +   L+
Sbjct: 499 GSYWGIFICVLMLIAQFYVGLFPAGASPNAKDFFMAYLSFPIVLAFYIFHKIWKKNWKLY 558

Query: 512 KKTEDIDLDTDRREIDNDVWEED--------EPKNLWEKFWS 545
            K ED+D+DT RRE+D D+ +++          + +W + W 
Sbjct: 559 IKAEDMDIDTGRREVDRDLLKQEVAAERADLAARPIWYRCWK 600

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  293 bits (751), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 171/503 (33%), Positives = 264/503 (52%), Gaps = 12/503 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
            T +K  LK RH+ MIA+GG IGTGLF+   T L  AGP   +I +   G++ Y +  ++
Sbjct: 86  HTPLKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAV 145

Query: 99  GEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW-TDAV 157
            EMA   P++  F  +  RF+  + G AN + Y L W +   LE+      + +W T   
Sbjct: 146 AEMAVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTK 205

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
               ++ + W+V+V  NL  VK YGE EF  + IKV+ +VGFII   ++VCG G TG   
Sbjct: 206 YRDGFVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGYV 265

Query: 218 F-RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
             +YW +PG +            +F G+ S  ++AAF++ G+EL+GI   EA NPRK VP
Sbjct: 266 GAKYWHDPGAF-----VGATAGAQFQGFCSVFVTAAFSFSGSELIGIAGSEAENPRKAVP 320

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIAIENSGTKVLPHI 335
            A  +V                     ND +L  S +   ++SPFVIAI   G + LP +
Sbjct: 321 PAAKQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAASPFVIAITVHGIRGLPSV 380

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            N VIL  ++S GNS +Y  SR L ++   G  PK +++  +SG P   +  +S  G +A
Sbjct: 381 INVVILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFFGLVA 440

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++  S     VF+WLL I+ ++ FF W  I + HIRF  ALK Q  S D+LPF +    +
Sbjct: 441 FVAQSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVSPLGVF 500

Query: 456 GAYYAAXXXXXXXXXXXXTAFAPKFNV---SDFFTAYVSVILFFAVWIGFQIWFRG-PLF 511
           G+Y+               A  P  +    ++FF+AY+S+ +   ++I  ++W +   +F
Sbjct: 501 GSYWGLFLIVLMLAAQFYVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKLWTKNWKIF 560

Query: 512 KKTEDIDLDTDRREIDNDVWEED 534
                +DLDT R+++D D+  ++
Sbjct: 561 IPLGQLDLDTGRKQLDLDLLRQE 583

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  294 bits (752), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 168/511 (32%), Positives = 272/511 (53%), Gaps = 15/511 (2%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           K   +K+ ++PRH+ MIALG  IGTGL +   T L +AGP G LI Y  +G++ Y + Q+
Sbjct: 112 KSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQA 171

Query: 98  LGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
            GEMA  +  +T  +  +    +    G A  ++Y L W     LEL      I++WT +
Sbjct: 172 CGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIM-VCGAGKTGP 215
           V    ++II +V++++ N+   + Y E EF+  C K+L + GF I   I+ V GAG  G 
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGY 291

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G +YW  PG +  G+ + D    RF G V++L++AAF + G+E + IT  E +NPRK +
Sbjct: 292 IGGKYWHEPGAFN-GVHAID----RFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAI 346

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
           P A  ++                     N D  L S      +SP+VIAI + G +V PH
Sbjct: 347 PGAAKQMIYRILFLFLATIIIVGFLVPYNSDQLLGSSGGGTKASPYVIAIASHGVRVAPH 406

Query: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394
             NAVIL +++S  NS  Y S+R+  ++   G APK  ++  ++G P  A+  ++L   +
Sbjct: 407 FVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCVSALFAVI 466

Query: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454
           A+  +S     VF WLL I+ ++  F W  I ++HIRF +A+K QG S  +L FK++   
Sbjct: 467 AFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFKSQTGV 526

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-P 509
           WG+ Y+              A AP    K +   FF  Y+++ +   +++G+++W +   
Sbjct: 527 WGSIYSCIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIVLYVGYKMWNKDWK 586

Query: 510 LFKKTEDIDLDTDRREIDNDV--WEEDEPKN 538
           LF + + IDL + R+  D ++   E+DE + 
Sbjct: 587 LFIRADKIDLTSHRQIFDEELIKQEDDEYRE 617

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  293 bits (749), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 167/499 (33%), Positives = 259/499 (51%), Gaps = 13/499 (2%)

Query: 37  VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQ 96
           +  T + + L  RH+  +A+GG IGTGLF++    L+  GP   +I ++ + T  + V  
Sbjct: 83  INNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVIN 142

Query: 97  SLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
           SLGE+A   PV   F V+  RF+ P+   A    Y   W +   LEL      I++W D 
Sbjct: 143 SLGELAAAFPVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYWNDK 202

Query: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVC-GAGKTGP 215
           +   AW+ I +  +  AN+  VK +GE EF ++ +K+LAI+GF I   ++ C G    G 
Sbjct: 203 INSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGGY 262

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G +YW NPG +            +F G  S  ++AAF+Y G E+  ++A E+ NP++T+
Sbjct: 263 IGGKYWHNPGAF-----VGHSAGSQFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKETI 317

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSPFVIAIENSGTKVLP 333
           P+A  +                      NDP+L +  S +  ++SP VIAIEN G K LP
Sbjct: 318 PKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAASPLVIAIENGGIKGLP 377

Query: 334 HIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGF 393
            + NA+IL  I+S  NS VY  SR + SM   G  PK+L+   K G P  A+L T   G 
Sbjct: 378 SLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFFGL 437

Query: 394 LAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFM 453
           L+++ +S     VF WL  ++ ++  F WM I+++ IRF  A+K QG S D++PF ++  
Sbjct: 438 LSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQSG 497

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG- 508
            WGA+Y              T+  P      +   FF  Y+S+ +  A ++G ++W R  
Sbjct: 498 TWGAWYGVIVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLSLPILIACYVGHKLWKRDW 557

Query: 509 PLFKKTEDIDLDTDRREID 527
            L     ++DLD+ RR +D
Sbjct: 558 RLLVPLMEMDLDSGRRVLD 576

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  291 bits (746), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 172/521 (33%), Positives = 270/521 (51%), Gaps = 22/521 (4%)

Query: 24  RSKDVVSL-ESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALI 82
           +  DVV   E  G+   +++K+ +K RH+ MI+LG  IGTGL +   T L+ AGP G +I
Sbjct: 47  QDDDVVGYDEETGT--SSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLII 104

Query: 83  AYMFIGTLAYMVSQSLGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFAL 141
            Y     + Y + Q+ GE+   +  +T ++  ++   + PALG +  ++Y + W   F L
Sbjct: 105 GYGVASAMLYCIIQAAGELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFPL 164

Query: 142 ELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFII 201
           +L      I++WTD  P   ++ IL+ ++V  NL   K Y E EF     KVL +VGF+I
Sbjct: 165 QLVTAAITIKYWTDTNP-DIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFVI 223

Query: 202 YAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTEL 260
              I+ CG AG  G +G RYW  PG +  G          F G       AAF Y G E+
Sbjct: 224 LGIIINCGGAGNDGYIGARYWHTPGAFSTG----------FKGVCYVFCYAAFAYGGIEV 273

Query: 261 VGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPF 320
           + +TA E  NPRK++P A  KV                     + P+L S  S   +SPF
Sbjct: 274 MVLTASEQENPRKSIPSACKKVIYRILLIYMLTTLIVCFLVPYDAPELTSTGSASRASPF 333

Query: 321 VIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGI 380
           VIAI + G  V+PHI NAVIL  ++S GNS +Y + R+L S+   G APK   +  + G 
Sbjct: 334 VIAIASHGISVVPHIINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQGR 393

Query: 381 PYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQG 440
           P    L    VG LA++ +S     VF WLL I+ ++  F W+ I ++H+RF  A+K QG
Sbjct: 394 PLLCFLVAMFVGLLAFIAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQG 453

Query: 441 ISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILF 495
            S  ++ +K++   WG+++A              A AP     K +  DFF +Y++  + 
Sbjct: 454 RSLGEVGYKSQTGYWGSWFAIIVSLFVLVAQFWVAIAPIGNGGKLSAKDFFQSYLAAPVL 513

Query: 496 FAVWIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWEEDE 535
             ++ G++I+++   L     ++DL++ R+  D D  ++++
Sbjct: 514 IFIYFGYKIYYKDWRLCIPATEVDLNSHRKIFDEDELKQED 554

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  293 bits (749), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 181/527 (34%), Positives = 275/527 (52%), Gaps = 21/527 (3%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G  +  ++K+ L+ RH+ +IALGG IGTGL +  S+ L   GP G  I+Y+ I  + Y +
Sbjct: 98  GDNEPRKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPGGLFISYIIISAVIYPI 157

Query: 95  SQSLGEMATFIP-----VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQV 149
             +LGEM  F+P        S      R++  +LG A G+ YF  + I  A E +    V
Sbjct: 158 MCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGV 217

Query: 150 IQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG 209
           +++WT AVP   WI +  +V+V  N + VK YGE EFW A IK+L IVG II +FI+  G
Sbjct: 218 VEYWTTAVPKGVWITVFLLVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWG 277

Query: 210 AG-KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVGITAGE 267
            G K   +GFRYW++PG +   +    +  G F    + +I  AF +  G ELV +T+ E
Sbjct: 278 GGPKHDRLGFRYWQHPGAFAHHLTGGSL--GNFTDIYTGIIKGAFAFILGPELVCMTSAE 335

Query: 268 AANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDP----KLKSEDSYISSSPFVIA 323
            A+ R+ + +A  +                      NDP     L        SSPFVI 
Sbjct: 336 CADQRRNIAKASRRFVWRLIFFYVLGTLSISVIVPYNDPVLVNALAQGKPGAGSSPFVIG 395

Query: 324 IENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYA 383
           I+N+G KVLPHI N  IL++  SA N+ ++ S+R L +M   G APK L    + G+PY 
Sbjct: 396 IQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRWGVPYV 455

Query: 384 AVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISR 443
           AV  + L   LAYL  S   + VF+W  NI+ ++GF  W+   +A++RF +A+ + G+  
Sbjct: 456 AVAASFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFYNGL-Y 514

Query: 444 DDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF-NVSDFFTAYVSVILFFAVWIGF 502
           D LPFK    P+  +++               F PK+  V+DF  AYV++ +F  +W+G 
Sbjct: 515 DRLPFKTWGQPYTVWFSLIVVSIITITNGYAIFIPKYWKVADFIAAYVTLPIFLVLWLGH 574

Query: 503 QIWFR--GPLFKKTEDIDLDTDRREIDNDVWEEDE----PKNLWEKF 543
           +++ R     +    +ID+     EI+    E +E    P ++ +KF
Sbjct: 575 KLYTRTWHQWWLPVSEIDVTRGLVEIEEKSREIEELRLPPTSIKDKF 621

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  289 bits (740), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 162/501 (32%), Positives = 263/501 (52%), Gaps = 6/501 (1%)

Query: 25  SKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAY 84
           S    S +  GS  E  + R L P  +S++ LG  +GTGL I   T L+  GP+   +AY
Sbjct: 16  SDSASSRDEGGSTNEATLSRELSPGVVSLLTLGSAVGTGLIIGSGTALARGGPISIFLAY 75

Query: 85  MFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELS 144
           +F G++  +V  SL EMA F P+   F  +  +++ PA G A G+ YFL ++I  +  L+
Sbjct: 76  LFTGSILAVVIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNYFLKYAIVLSANLT 135

Query: 145 VVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAF 204
             G VI +W   + +  W+ +L+      N   V+++G++E ++   K+  ++   I   
Sbjct: 136 AFGLVIGYWRPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVAKLTILLLIFIVCL 195

Query: 205 IMVCGAG-KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGI 263
           ++ CG G     +GFRYWR  G + P ++    N G+FLGW + +I + F + G+E++GI
Sbjct: 196 VITCGGGPDHTTIGFRYWRESG-FLPYLVKG--NTGKFLGWWACVIQSIFGFMGSEMIGI 252

Query: 264 TAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVI 322
             GE ANPRKT+P+A   V                     ++ KL  +  +  ++SPFVI
Sbjct: 253 IYGETANPRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLVHAHSTDANASPFVI 312

Query: 323 AIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPY 382
           AI  SG KVLP   NA +L  I S+  +D+YI SR LY +  +G APK      K  IP 
Sbjct: 313 AISTSGIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGAAPKIFLRLNKHKIPM 372

Query: 383 AAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGIS 442
              +  SL+GFLAY+ +   A+ VF ++ +  +V G   W  I VA+I + + +K  G+ 
Sbjct: 373 VGCVVGSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYILVAYIHYDRVVKSHGVR 432

Query: 443 RDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGF 502
            D++PF+  F P+ AY A             +AF  KFN   F T+Y+ +     + +G+
Sbjct: 433 LDEIPFRMPFQPYAAYIALFFVSVITFFNGYSAFILKFNYKLFITSYIGIFANVLLVLGY 492

Query: 503 QIWFRGPLFKKTEDIDLDTDR 523
           +++++   + K E+I  +  +
Sbjct: 493 KLYYKTK-WVKPEEITFEKKQ 512

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  292 bits (748), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 167/545 (30%), Positives = 282/545 (51%), Gaps = 24/545 (4%)

Query: 6   HHXXXXXXXXXXXXXXFSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLF 65
           HH              F  +K  V +  +      ++K+ ++PRH+ M++LG  IGTGL 
Sbjct: 65  HHIETDMNPILSHQSVFDDAK--VEISQVDDELNEKLKKTIQPRHVVMMSLGTGIGTGLL 122

Query: 66  ISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEMA-TFIPVTSSFMVFTQRFLSPALG 124
           +   T L++AGP G +I Y  + +  Y + Q++GEMA  ++ +   F  +    + PAL 
Sbjct: 123 VGNGTTLAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALN 182

Query: 125 AANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANL-APVKFYGE 183
            +  ++Y + W     LEL      IQ+WT  V    +++I ++++++ N+    + Y E
Sbjct: 183 FSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAE 242

Query: 184 VEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPVGFRYWRNPGPW----GPGIISKDVNE 238
            EF     K+L ++GF I   +++CG AG  G +G +YWR+PG +    GP         
Sbjct: 243 TEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFRGSDGPN-------- 294

Query: 239 GRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXX 298
            RF G VS+L++AAF++  TE + ITA E +NPRK +P A  KV                
Sbjct: 295 -RFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVG 353

Query: 299 XXXXXNDPKL-KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSR 357
                +  +L  S  +   +SP+V+A+   G +V+PH  NAVIL ++ S  +S  Y SSR
Sbjct: 354 LLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSR 413

Query: 358 VLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVA 417
           +L ++   G APK  T+  ++G P    L  +++  +A+   S   + VF+WLL I+ ++
Sbjct: 414 MLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLS 473

Query: 418 GFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFA 477
             F W LI ++HIRF +A+K QG S D++ +K++   WG+ YA                 
Sbjct: 474 QVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIV 533

Query: 478 P----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWE 532
           P      +V  FF  Y+++ +F  +++G++IW R   LF + +DIDL + R   D ++  
Sbjct: 534 PVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILR 593

Query: 533 EDEPK 537
           ++  +
Sbjct: 594 QEREE 598

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  292 bits (747), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 169/505 (33%), Positives = 268/505 (53%), Gaps = 17/505 (3%)

Query: 42  VKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEM 101
           + R LK RH+ MIA+GG IG GLF+     L+ AGP G LI +    T+  ++  SLGE+
Sbjct: 83  LSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLGEL 142

Query: 102 ATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW-TDAVPLT 160
           A   PV+  ++ +  RF+  + G AN + Y +   +   LE+      + +W TD     
Sbjct: 143 AVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKYKL 202

Query: 161 AWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPV-GFR 219
           A++ + WVV+VS NL  V+ +GE E   + IKV+ I+GFII   +++ G G    V G +
Sbjct: 203 AFVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVIGGK 262

Query: 220 YWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAI 279
           YW +PGP+       +    +F G  S  ++AAF++ G+EL+G+ A E   PRK++P+A 
Sbjct: 263 YWNDPGPF-----VGNAPSDKFKGVCSVFVTAAFSFAGSELIGLAAAETREPRKSIPKAA 317

Query: 280 NKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISS-SPFVIAIENSGTKVLPHIFNA 338
            +V                     N+  L +     ++ SPFVIA++    +VLP I N 
Sbjct: 318 KQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDAAHSPFVIAMDMHRIRVLPSIINV 377

Query: 339 VILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLE 398
           VIL+ +IS GNS VY SSR + ++  +G  PK   +  + G P  A+  TSL G L ++ 
Sbjct: 378 VILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLFAICFTSLFGLLCFVA 437

Query: 399 SSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAY 458
            +     +FDWLL I+ ++ FF W+ I++AH+RF  ALK QG + ++L F +     G+ 
Sbjct: 438 GAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTTNELSFTSPTGFIGSC 497

Query: 459 YAAXXXXXXXXXXXXTAFAP--------KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-P 509
           YA              A  P        K +   FF  Y+S  +   +++  +IW R   
Sbjct: 498 YAVGLICVVLVAQFWVALYPPSPDGTSAKPSPILFFKQYLSFAVAIVMYLAHKIWSRNWK 557

Query: 510 LFKKTEDIDLDTDRREIDNDVWEED 534
            F K +++D+DT RRE+D ++++E+
Sbjct: 558 FFIKAKEMDIDTGRRELDLELFKEE 582

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  292 bits (747), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 168/517 (32%), Positives = 270/517 (52%), Gaps = 16/517 (3%)

Query: 31  LESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTL 90
           +ES+ S  ++++K+++K RH+ M++LG  IGTGL ++ +  L   GP   +I Y+ +  +
Sbjct: 82  VESITS--DSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFV 139

Query: 91  AYMVSQSLGEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQV 149
            Y + Q+ GEMA   P + ++F  ++  F+S + G A  ++Y   W     LEL      
Sbjct: 140 TYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMT 199

Query: 150 IQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG 209
           IQFW D +    +I+I +V LV  +   VK YGE EF   C K+L I GFII + ++ CG
Sbjct: 200 IQFWNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCG 259

Query: 210 -AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEA 268
            AG  G +G  YW NPG +     + D + GRF      L++A F++ G EL  ++  E 
Sbjct: 260 GAGNDGYIGATYWHNPGAF-----AGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQ 314

Query: 269 ANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK-SEDSYISSSPFVIAIENS 327
           +NPRK+ P A  +                      ND +L  +  S   +SP+V+A    
Sbjct: 315 SNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIH 374

Query: 328 GTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLT 387
           G K++PHI NAVIL +++S  NS +Y   R++ S+   G APK+L +  + G P  A++ 
Sbjct: 375 GVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIV 434

Query: 388 TSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLP 447
             + G +A++ +S    +VF WL  I  ++  F W  I ++H+RF QA+K QG S D+L 
Sbjct: 435 CCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELG 494

Query: 448 FKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILFFAVWIGF 502
           +KA    WG+ Y               A AP     K +   FF  Y++  ++ A + G+
Sbjct: 495 YKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGY 554

Query: 503 QIWFRG-PLFKKTEDIDLDTDRREIDNDVWEEDEPKN 538
            ++ R   L    + IDLD  RR  D ++  +++ +N
Sbjct: 555 MVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEEN 591

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  291 bits (746), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 174/503 (34%), Positives = 264/503 (52%), Gaps = 12/503 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
           +T +K  LK RH+ MIA+GG IGTGL +   T L   GP   LI +   GT+ Y +  +L
Sbjct: 83  QTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMVMAL 142

Query: 99  GEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW-TDAV 157
           GE+A   P++  F  +  RF+  + G AN + Y L W +   LE+      + FW TD  
Sbjct: 143 GELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPK 202

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
               ++ + W+V+V  N+  VK YGE EF  + IKV+ +VGFII   I+ CG G  G   
Sbjct: 203 YRDGFVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYI 262

Query: 218 F-RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
             +YW +PG +     + D    +F G  S  +++AF++ G+ELVG+ A E+ +PRK+VP
Sbjct: 263 GGKYWHDPGAF-----AGDTPGAKFKGLCSVFVTSAFSFAGSELVGLAASESVDPRKSVP 317

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPHI 335
           +A  +V                     NDP L    S   ++SPFVIAI+  G K LP +
Sbjct: 318 KAAKQVFWRITLFYILSLLMVGLLVPYNDPNLIGASSVDAAASPFVIAIKTHGIKGLPTV 377

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            N VIL  ++S GNS +Y  SR + ++      P+   +  + G P   +  TS  G +A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSAFGLIA 437

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++ +S     VF+WLL ++ ++  F W  I + HIRF +AL  QG   D+L FK+    W
Sbjct: 438 FVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVW 497

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP---KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-PLF 511
           G+Y+               A  P     +   FF AY+S  L  A+++G +I+ R   LF
Sbjct: 498 GSYWGLFMVVIMFIAQFYVALFPVGASPSAEGFFEAYLSFPLVVAMYLGHKIYKRNWKLF 557

Query: 512 KKTEDIDLDTDRREIDNDVWEED 534
              ED+D+DT RRE+D ++ +++
Sbjct: 558 IPAEDMDIDTGRREVDLELLKQE 580

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  290 bits (743), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 166/519 (31%), Positives = 262/519 (50%), Gaps = 24/519 (4%)

Query: 41  QVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGE 100
            +K  L+ RHI +IALGGTIGTGLF+  S+ L+N GP   +I+Y+ I T+ Y +    GE
Sbjct: 55  NLKHGLQSRHIQLIALGGTIGTGLFVGTSSTLANCGPAALVISYIVISTIVYPIMNMFGE 114

Query: 101 MATFIPVTSS-------FMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW 153
           M  ++P                 +++  +LG A  + Y+  + +  A E +    ++++W
Sbjct: 115 MVCYLPGNDDDDESVGYCAYLVSKYVDESLGFATSWNYYYCFIVLVATECTAASSIVEYW 174

Query: 154 TDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKT 213
           T  +P    I +   V+   N  PVKFYGE EFW A IK+  I G II AF++ CG    
Sbjct: 175 TSKIPKAVLIFLFLGVIFLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGAPN 234

Query: 214 GP----VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVGITAGEA 268
                 VGF YW+NP  +   + +  +  G FL   ++LI  AF +  G ELV +T+ E 
Sbjct: 235 NEDNSFVGFHYWKNPSSFRDYVTNGSL--GNFLDVYNALIKGAFAFILGPELVSLTSSEC 292

Query: 269 ANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKS----EDSYISSSPFVIAI 324
            + R+ + +A  +                      NDP L +          SSPFVI I
Sbjct: 293 VDQRRNIAKASRRFVYRLMFFYIFGALSISVIVPYNDPTLLNALALNKPGAGSSPFVIGI 352

Query: 325 ENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAA 384
           +N+G  +LPHI N  IL++ +SAGN+ ++ S+R L +MG NG AP+  +   + G+PY A
Sbjct: 353 QNAGITILPHIINFCILTSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRINRHGVPYVA 412

Query: 385 VLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRD 444
           +  + ++  LA+L  S  ++ VF W  NI+ ++GF  W    +A++RF + + + G+  D
Sbjct: 413 LSLSIMIACLAFLNCSASSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRTIDYNGL-YD 471

Query: 445 DLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF-NVSDFFTAYVSVILFFAVWIGFQ 503
            LPFK K   +  +Y+                 PKF N  DF  AY+++ +F  ++ G  
Sbjct: 472 RLPFKTKGQVYLTWYSFVFVGILILTNGYMYIIPKFWNYQDFIAAYITLPVFLVLYFGHI 531

Query: 504 I----WFRGPLFKKTEDIDLDTDRREIDNDVWEEDEPKN 538
           I    W +   +K  ++ID+ T   EI+      DE + 
Sbjct: 532 IYSGRWRQRKWWKPVDEIDVVTGLEEIELKTKIADEERQ 570

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  290 bits (743), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 176/523 (33%), Positives = 282/523 (53%), Gaps = 15/523 (2%)

Query: 24  RSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIA 83
           R  DV +     + +ET++K+ +  RH+ MI+LG  IGTG+ +     L N GP G  I 
Sbjct: 61  RGGDVDAEGQPVAPRETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIG 120

Query: 84  YMFIGTLAYMVSQSLGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALE 142
           Y  +G+  Y + Q+ GEMA ++  ++ +F  +    + PALG +  ++Y L W     LE
Sbjct: 121 YAIMGSCIYCIIQAAGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLE 180

Query: 143 LSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIY 202
           L      I++WT AV    +++I +V+ V  NL   + Y E EF+    KVL I GF I 
Sbjct: 181 LVTATITIKYWTTAVNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFIL 240

Query: 203 AFIMVCG-AGKTGPVGFRYWRNPGP-WGPGIISKDVNEGRFLGWVSSLISAAFTYQGTEL 260
             I+ CG AG  G +G +YW +PG  +G    +K ++   F G ++++++AAF +  TE 
Sbjct: 241 GIIVNCGGAGNDGYLGGKYWHDPGALYG----TKPIHH--FKGIIATMVTAAFAFGATEF 294

Query: 261 VGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSP 319
           + +TA E ANPR+ +P A  K+                     N D  + S  S   +SP
Sbjct: 295 IALTAAEQANPRRAIPSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHASP 354

Query: 320 FVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSG 379
           +VIAI + G KV+PH  NAVIL +++S GNS  Y SSR+L S+     AP +L +  + G
Sbjct: 355 YVIAIASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREG 414

Query: 380 IPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQ 439
            P  A+L + + G +A++ +S     VF WLL I+ ++  F W+ I V+HIRF +AL  Q
Sbjct: 415 RPIRAMLVSCIFGLIAFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQ 474

Query: 440 GISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILF 495
           G S  +L +K++    G+YYA              A AP    K + ++FF  Y+++ + 
Sbjct: 475 GKSLGELGYKSQTGVVGSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPIL 534

Query: 496 FAVWIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWEEDEPK 537
            A++ G+++W R   L+   E IDL + R+  D D+ ++++ +
Sbjct: 535 IALYFGYRVWKRDWKLYIPLEQIDLVSHRKVFDEDLLKQEDAE 577

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  291 bits (746), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 167/502 (33%), Positives = 267/502 (53%), Gaps = 13/502 (2%)

Query: 42  VKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEM 101
           +K+ ++PRH+ MI+LG  IGTGL +   T L NAGP G +I Y  +G++ Y + Q+ GEM
Sbjct: 130 LKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIMGSIIYCIIQATGEM 189

Query: 102 A-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLT 160
           A  +  +   + V+    +    G A  ++Y + W     LEL      I++WT +V   
Sbjct: 190 AIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTASLTIKYWTTSVNSD 249

Query: 161 AWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAF-IMVCGAGKTGPVGFR 219
            ++ I + +++  N+   K Y E EF+  C KVL ++GF I +  I   GAG  G +G  
Sbjct: 250 IFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSITITAGGAGNDGYLGGL 309

Query: 220 YWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAI 279
           YW  PG +       D +   F G   +L++AAF Y GTE + +TA E +NPR  +P A 
Sbjct: 310 YWHTPGAF-----RGDSSIDHFKGICGTLVTAAFAYGGTEFLALTAAEQSNPRAAIPSAA 364

Query: 280 NKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSED-SYISSSPFVIAIENSGTKVLPHIFNA 338
            KV                     +  +L   D S  S+SP+V+A    G +V+PH  NA
Sbjct: 365 KKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSASPYVLAASLHGVRVVPHFINA 424

Query: 339 VILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLE 398
           VIL +++S GNS  Y SSR+L S+   G APK+  +  + G P  A+L ++L G +A+  
Sbjct: 425 VILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLMSALFGVIAFCA 484

Query: 399 SSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAY 458
           +S   + VF WLL I+ ++  F W  I ++HIRF  A+K QG S  ++ + A+   WG++
Sbjct: 485 ASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGYLAQTGVWGSW 544

Query: 459 YAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-PLFKK 513
           YA              A AP    + +  +FF  Y+++ +   +++G++I+++   L  K
Sbjct: 545 YALFMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGYKIYYKDWTLLIK 604

Query: 514 TEDIDLDTDRREIDNDVWEEDE 535
            EDIDL + R+  D D+ +E++
Sbjct: 605 AEDIDLQSHRQIFDEDLLKEED 626

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  291 bits (745), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 167/500 (33%), Positives = 266/500 (53%), Gaps = 16/500 (3%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           K  ++K ++KPRH+ MI+LG  IGTG+ +   T L+N+GP G +I Y  +G+  Y + Q+
Sbjct: 119 KSEELKHSIKPRHVIMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQA 178

Query: 98  LGEMAT-FIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
            GEMA  +  +   F  +    + PALG +  ++Y + W     LEL      I++WT  
Sbjct: 179 TGEMAVLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTK 238

Query: 157 VPLTAWIIILWVVLVSAN-LAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTG 214
           V    +++I +V+++  N L     Y E EF+    K+L ++GF I   I++CG AG  G
Sbjct: 239 VDPDVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKILMLLGFFILGIILICGGAGDDG 298

Query: 215 PVGFRYWRNPGPW-GPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
            +G RYW +PG + G   I       RF G VS+L++AAF +  +E++G+TA E +NPRK
Sbjct: 299 YIGGRYWHDPGAFRGEHAID------RFKGVVSTLVNAAFAFGLSEMIGVTASEQSNPRK 352

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVIAIENSGTKVL 332
            +P A  K+                     N D  L S    + +SP+V+A+   G +V+
Sbjct: 353 AIPSAAKKMIYRIVCIYLGSVVIVGFLVPWNSDQLLGSSGGGVKASPYVLAVSTHGVRVV 412

Query: 333 PHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVG 392
           PH  NAVIL +++S  NS  Y SSR+L  +   G APK   +  + G P   +   +LV 
Sbjct: 413 PHFINAVILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVDREGRPTMGMCVAALVN 472

Query: 393 FLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKF 452
            +++  +S     VF WLL I+ ++  F W  I ++HIRF +A+  QG S  ++ FK++ 
Sbjct: 473 VISFCATSPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAMAVQGRSLGEIGFKSQC 532

Query: 453 MPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG 508
             WG++YA              A AP    + +V  FF  Y++  +  A++ G++I+ + 
Sbjct: 533 GVWGSWYAFIMMMLILIAQFWVAIAPIGEGRLDVQAFFENYLAAPILIALYFGYKIYTKD 592

Query: 509 -PLFKKTEDIDLDTDRREID 527
             LF + +DIDLD +R   D
Sbjct: 593 WRLFIRAKDIDLDINRDVFD 612

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  290 bits (741), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 163/507 (32%), Positives = 270/507 (53%), Gaps = 13/507 (2%)

Query: 37  VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQ 96
           +  + + + L  RH+  +A+GG IGTGLF++    L+  GP   +I ++ + T  + V  
Sbjct: 84  IDGSNLNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLVIGWVIVSTALFTVIN 143

Query: 97  SLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
           SLGE+A   PV   F V+  RF+ P++  +    Y + W +   LEL      I++W D 
Sbjct: 144 SLGELAAAYPVVGGFSVYMTRFIDPSIAFSINLNYLVQWLVLLPLELVAASITIRYWNDK 203

Query: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVC-GAGKTGP 215
           +   AW+ I + V+   N+  VK +GE EF ++ IK+LAI+GF I   ++ C G    G 
Sbjct: 204 INSDAWVSIFYTVIGLLNMLDVKSFGETEFVLSFIKILAIIGFTILGIVLSCGGGPVGGY 263

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G +YW +PG +            +F G  S  ++AAF+Y G E++ ++A E+ +PRKT+
Sbjct: 264 IGGKYWHDPGAF-----VGHTAGSQFKGLCSVFVTAAFSYSGIEMIAVSAAESIDPRKTI 318

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY--ISSSPFVIAIENSGTKVLP 333
           P A  +                      +DP+L +  S   ++SSP VIAIEN G K LP
Sbjct: 319 PVAAKRTFWLITASYVTILTLIGCLVPYDDPRLLNGSSSVDVASSPLVIAIENGGIKGLP 378

Query: 334 HIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGF 393
            + NA+IL  ++S  NS VY  SR + SM + G  PK L    K G P  A L T   G 
Sbjct: 379 SLMNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGRPINATLVTLFFGL 438

Query: 394 LAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFM 453
           ++++ +S   + VF WL  ++ ++  F WM I+++HIRF +A+  QG S +++P+ ++  
Sbjct: 439 ISFVAASDKQAEVFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQGRSLEEMPYLSQVG 498

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG- 508
            +G++Y              T+  P    + N + FF  Y+S+ +  A ++G + +F+  
Sbjct: 499 VYGSWYGCIILFLVLIAAFWTSLFPVGSSQANATTFFEGYLSLPILLACYVGHKFYFKNW 558

Query: 509 PLFKKTEDIDLDTDRREIDNDVWEEDE 535
            LF    +IDLD+ +R+ID ++  E++
Sbjct: 559 RLFTPYNEIDLDSGKRDIDLELLREEK 585

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  290 bits (743), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 168/506 (33%), Positives = 272/506 (53%), Gaps = 14/506 (2%)

Query: 41  QVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGE 100
           ++K+ +KPRH+ MI+LG  IGTG+ +   T L+N+GP G +I Y  +G+  Y + Q+ GE
Sbjct: 108 ELKKTIKPRHVVMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGE 167

Query: 101 MAT-FIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPL 159
           +A  +  +T  F  +    + PA G A  ++Y + W     LEL      I++WT  V  
Sbjct: 168 LAVLYTKLTGGFNAYPSMLIDPAFGFAVAWVYCIQWLCVCPLELVTASMTIKYWTTKVDP 227

Query: 160 TAWIIILWVVLVSAN-LAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPVG 217
             +++I + +++  N L     Y E EF+    K+L + GF I   +++CG AG  G +G
Sbjct: 228 DVFVVIFYCLILCINVLGGAAGYAEAEFFFNSFKILMLTGFFILGIVVICGGAGNDGYIG 287

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
            R W NPG +       D    RF G VS+L++AAF +  +E +G+TA E +NPRK +P 
Sbjct: 288 TRLWHNPGSF-----RGDKPVDRFKGVVSTLVNAAFAFGMSEFLGVTASEQSNPRKAIPS 342

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVIAIENSGTKVLPHIF 336
           A  K+                     + D  L S  +   +SP+V+AI   G +V+PH  
Sbjct: 343 AAKKMLYRIICIYLGSVTIVGFLVPYDSDQLLGSSGAATKASPYVLAISLHGVRVVPHFI 402

Query: 337 NAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAY 396
           NAVIL +++S GNS  Y SSR L S+   G AP +L +  ++G P  A   ++LVG +A+
Sbjct: 403 NAVILLSVLSVGNSAFYSSSRQLLSLSQLGYAPSFLNYVDRNGRPLKAYCVSALVGVIAF 462

Query: 397 LESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWG 456
             +S     VF WLL I+ ++  F W  I ++H+RF +A++ QG S  ++ FK++   +G
Sbjct: 463 CATSPKEDQVFVWLLAISGLSQLFTWFSICLSHLRFRRAMRVQGRSMGEVGFKSQVGIYG 522

Query: 457 AYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-PLF 511
           + Y+             TA  P    K +V  FF  Y+++ +F  ++ GF+IW +   LF
Sbjct: 523 SLYSCVMMVLILIAQFWTALVPVGEGKPDVQAFFENYLAMPIFIVLYFGFKIWKKDWRLF 582

Query: 512 KKTEDIDLDTDRREIDNDVWEEDEPK 537
            + EDIDL + R   D ++ ++++ +
Sbjct: 583 IRAEDIDLVSHREIFDEELLKQEDEE 608

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  289 bits (739), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 171/514 (33%), Positives = 268/514 (52%), Gaps = 17/514 (3%)

Query: 26  KDVVSLESLGSVKETQVKRALKP----RHISMIALGGTIGTGLFISISTPLSNAGPVGAL 81
           +D + + S  SV +  + ++L      RH+  +A+GG IG GLF++    L++ GP   +
Sbjct: 58  EDNIDITSQSSVTKEDINKSLNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLV 117

Query: 82  IAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFAL 141
           I ++ I T  + V  SLGE+A   PV   F V+  RF+ P+   A    Y   W +   L
Sbjct: 118 IDWVIISTCLFTVINSLGELAAAFPVVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLPL 177

Query: 142 ELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFII 201
           EL      I++W   +   AW+ I + V+  AN+  VK +GE EF ++ +K+LAI+GF I
Sbjct: 178 ELVAASITIKYWNSTINSDAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIGFTI 237

Query: 202 YAFIMVC-GAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTEL 260
              ++ C G  K G +G +YW NPG +         +  +F G  S  ++AAF+Y G E+
Sbjct: 238 LGIVLSCGGGPKGGYLGGKYWHNPGAF-----VGHTSGTKFKGLCSVFVTAAFSYSGIEM 292

Query: 261 VGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSS 318
             ++A E+ +PRKT+P+A  +                      +DP+L S  S +  ++S
Sbjct: 293 TAVSAAESKDPRKTIPKAAKRTFWLITASYVTILTLVGCLVPYDDPRLMSGTSSVDAAAS 352

Query: 319 PFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKS 378
           P VIAIEN G K L  + NA+IL +IIS  NS VY  SR + SM   G  PK L    K 
Sbjct: 353 PLVIAIENGGIKGLDSLMNAIILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKVDKR 412

Query: 379 GIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKH 438
           G P  A L T   G L+++ +S   + VF WL  ++ ++  F WM I+++HIRF QA+  
Sbjct: 413 GRPINATLVTLFFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQAMIK 472

Query: 439 QGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVIL 494
           Q  S D++P+ ++   WG+ Y              T+  P      +V  FF  Y+S+ +
Sbjct: 473 QNRSLDEMPYLSQTGVWGSLYGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGYLSLPI 532

Query: 495 FFAVWIGFQIWFRGPLFKKT-EDIDLDTDRREID 527
               +IG +++F+   +  T E++DLDT R+ +D
Sbjct: 533 LIVCYIGHKLYFKNWSWVVTLEEMDLDTGRKALD 566

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  289 bits (739), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 170/513 (33%), Positives = 265/513 (51%), Gaps = 14/513 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
           ++++K+++K RH+ M+ LG  IGTGL ++ +  L   GP   +I Y  +  + Y + Q+ 
Sbjct: 88  DSKLKKSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGGPAALVIGYFLVSFVTYFMIQAA 147

Query: 99  GEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           GEMA   P + ++F  ++  F+S   G A  ++Y   W     LEL      I+FW D +
Sbjct: 148 GEMAVTYPTLPANFNAYSSIFISKPFGFATVWVYCFQWLTVLPLELITAAMTIKFWNDTI 207

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPV 216
               +I+I +V L+  +   VK YGE EF   C K+L I GFII + ++ CG AG  G +
Sbjct: 208 NPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCKILMIAGFIILSVVINCGGAGNDGYI 267

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           G +YWRNPG +     + D + GRF      L++A F++ G EL  ++  E ANPRKT P
Sbjct: 268 GGKYWRNPGAF-----AGDTSAGRFKNVCYILVTAYFSFGGMELFALSVQEQANPRKTTP 322

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK-SEDSYISSSPFVIAIENSGTKVLPHI 335
            A  +                      ND +L  +  S   +SP+V+A    G KV+PHI
Sbjct: 323 VAAKRSIYRILVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKVVPHI 382

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            NAVIL ++IS  NS +Y   R++ S+   G  PK+L +  + G P  A++  S+ G + 
Sbjct: 383 INAVILISVISVANSSLYAGPRLMCSLAQQGYGPKFLDYVDREGRPLIALIVCSVFGVIG 442

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++ +S    VVF WL  I  ++  F W  I ++H+RF QA+K QG S D+L +KA    W
Sbjct: 443 FVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIW 502

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILFFAVWIGFQIWFRGPL 510
           G+ Y               A AP     K +   FF +Y++  ++ A ++G+ I+ R   
Sbjct: 503 GSAYGVFFNILVFIAQFWVALAPLNNGGKCSAESFFQSYLAFPIWIAFYLGYMIYNRDFT 562

Query: 511 FKKTED-IDLDTDRREIDNDVWEEDEPKNLWEK 542
           F    D IDLD  R   D ++  +++ +N   K
Sbjct: 563 FLNPLDKIDLDFHRHIYDPELMRQEDLENEERK 595

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  289 bits (739), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 173/517 (33%), Positives = 281/517 (54%), Gaps = 16/517 (3%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
           ET++K+ +  RH+ M++LG  IGTG+ +     L N GP G +I Y  +G+  Y + Q+ 
Sbjct: 87  ETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCLYCIIQAA 146

Query: 99  GEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           GE+A ++  ++ +F  +    +  A G +  ++Y L W     LEL      I++WT +V
Sbjct: 147 GELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITIKYWTTSV 206

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPV 216
               ++ I +V+++  N+   + Y E EF+  C KVL I+GF I   I+ CG AG  G +
Sbjct: 207 NPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGGAGNDGYI 266

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           G RYW NPG +     +K ++   F G +S++++AAF +  TE + +TA E ANPR+ +P
Sbjct: 267 GGRYWNNPGAF---YGTKPIHH--FKGIISTMVTAAFAFGATEFIALTAAEQANPRRAIP 321

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK-SEDSYISSSPFVIAIENSGTKVLPHI 335
            A  KV                     N P+L  S  S   +SP+VIA+ + G +V+PH 
Sbjct: 322 SAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHASPYVIAVASHGVRVVPHF 381

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            NAVIL +++S GNS  Y SSR+L ++     AP +L +  +SG P  A+L + + G ++
Sbjct: 382 INAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPMRAMLVSCVFGLIS 441

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++ +S     VF WLL I+ ++  F W+ I V+HIRF +AL  QG    +L +K++    
Sbjct: 442 FVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKPIGELGYKSQTGVA 501

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-PL 510
           G+YYA              A AP    K + + FF  Y+++ LF  ++ GF+IW R   L
Sbjct: 502 GSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVLYFGFKIWKRDWRL 561

Query: 511 FKKTEDIDLDTDRREIDNDVWEEDE---PKNLWEKFW 544
           +   E IDLD+ R+  D ++ ++++    +N+  K W
Sbjct: 562 YIPLEQIDLDSHRKTFDEELLKQEDAEYEENIRNKGW 598

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  288 bits (737), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 179/513 (34%), Positives = 266/513 (51%), Gaps = 15/513 (2%)

Query: 42  VKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEM 101
           +K  LK RH+ M+A+GG IG+GLF+  ST L  AGP G +I +    T+ Y +  +LGE+
Sbjct: 95  LKHTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMALGEL 154

Query: 102 ATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW-TDAVPLT 160
           A   PV+  F  +  RF+  + G A+ + Y L W  T  LE+      + +W T      
Sbjct: 155 AVVFPVSGGFTTYATRFIDESFGFASNFNYALQWLATLPLEIVSASITVNYWQTPERYRD 214

Query: 161 AWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGF-R 219
            ++ + W+V+V  NL  V+ +GE EF  + IKVL ++GFII   ++V G G  G     R
Sbjct: 215 GFVALFWLVIVIINLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFVGGR 274

Query: 220 YWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAI 279
           YW NPG +       D    +F G  S  ++AAF++ G+ELVGITA EAANPRK+VPRA 
Sbjct: 275 YWHNPGAF-----VGDNAGTQFKGVCSVFVTAAFSFAGSELVGITAAEAANPRKSVPRAA 329

Query: 280 NKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPHIFNA 338
            +V                      DP+L    S   S+SPFVIAI   G + LP + N 
Sbjct: 330 KQVVWRIVLFYMGSLIMIGLLVPYTDPRLIGASSVDASASPFVIAIVTHGIRGLPSVINV 389

Query: 339 VILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLE 398
           VIL  ++S GNS ++  SR + ++   G  P+   +  + G P   ++  S  G +A++ 
Sbjct: 390 VILIAVLSVGNSAIFAGSRTIAALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGLIAFIA 449

Query: 399 SSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAY 458
           +S     VF WL+ ++ ++  F W  I + HIRF  ALK QG S ++LPF +     G+ 
Sbjct: 450 ASKKQGEVFAWLMALSGLSSLFTWGGICLCHIRFRMALKAQGRSTNELPFVSPAGIIGSS 509

Query: 459 YAAXXXXXXXXXXXXTAFAP---KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-PLFKKT 514
           +               A  P   K +   FF +Y+S  +  A + G +I+ +   LF K 
Sbjct: 510 WGLFMLLLMFIAQFYVALFPPGSKPSAEVFFESYLSFPIVLAFYFGHKIYKKNWKLFIKA 569

Query: 515 EDIDLDTDRREIDNDVWE---EDEPKNLWEKFW 544
           ED+D+DT RRE D ++ +   E+E   L  K W
Sbjct: 570 EDMDIDTGRRETDLELLKQEIEEEKAILATKGW 602

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  288 bits (736), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 180/496 (36%), Positives = 263/496 (53%), Gaps = 12/496 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
            + +KR LK RH+ MIA+GG IGTGLF+     L  AGP G LI +   GT+ Y +  ++
Sbjct: 74  NSPLKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWALTGTMIYCMVMAM 133

Query: 99  GEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW-TDAV 157
           GE+A   PV+  F  +  RF+  + G AN + Y L W +   LE+      + +W TD  
Sbjct: 134 GELAVTFPVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVAASITVNYWGTDPK 193

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
               ++ + +VV+VS N+  VK YGE EF  + IKV+ ++GFII   I+VCG G  G   
Sbjct: 194 YRDGFVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFIILGIILVCGGGPVGGYI 253

Query: 218 FR-YWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
               W NPG +      K     RF G  S  ++AAF++ G+ELVG+ + E ANPRK++P
Sbjct: 254 GGANWHNPGAFVGNTAGK-----RFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSLP 308

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPHI 335
           RA  +V                     ND +L    S   ++SPFV+AI+N G K LP +
Sbjct: 309 RAAKQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAASPFVLAIKNHGIKGLPSV 368

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            N VIL  ++S GNS V+  SR L ++   G  PK   +  + G P   +  TS  G L+
Sbjct: 369 VNVVILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFFGLLS 428

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++ +S     VFDWLL ++ ++  F WM I + H+RF +AL  QG S D+L F +    W
Sbjct: 429 FIAASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELSFVSPAGVW 488

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP---KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-PLF 511
           G+ Y               A  P     +  DFF +Y+S+ +   ++IG + + R   LF
Sbjct: 489 GSIYGTVLIMLILAAQFWIALFPIGSPPDAKDFFESYLSLPVVLVMYIGHKCYKRNWKLF 548

Query: 512 KKTEDIDLDTDRREID 527
            + E+ID+DT RRE+D
Sbjct: 549 IRAENIDIDTGRREVD 564

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  287 bits (734), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 175/523 (33%), Positives = 261/523 (49%), Gaps = 23/523 (4%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
           +  +K+ LK  HI +IA+GG IGTGLF+  S+ L   GP G  I+Y  + T+ Y V  +L
Sbjct: 49  DHNLKKGLKSAHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLFISYCIMSTIIYPVMNAL 108

Query: 99  GEMATFIP-------VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQ 151
            EM  F+P          S      R++  +LG A G+ Y   + I  A E +    V+ 
Sbjct: 109 AEMVCFLPGLPDENETGGSISTLCTRYVDSSLGFAVGWNYVYCYVILVAAECTAASGVVT 168

Query: 152 FWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG 211
           +WT AVP  AWI I   ++V  N   V+FYG  E     +K+  I+G II + ++  G G
Sbjct: 169 YWTTAVPKAAWITIFLGIIVVLNCTAVEFYGTSEAIFCSLKIFCILGIIIVSIVLFFGGG 228

Query: 212 KT-GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVGITAGEAA 269
                +GFR+W++PG W   +   D   GR    ++ +I A F +  G ELV +T+ EA 
Sbjct: 229 PNHDRLGFRFWKDPGAWAYHL--ADGGAGRLSDIITGVIRAGFAFILGPELVVLTSTEAQ 286

Query: 270 NPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY----ISSSPFVIAIE 325
           + R+ + +A  +                      NDP L +  S       SSPFVI I+
Sbjct: 287 DSRRNIEKAARRFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALSQGKPGAGSSPFVIGIQ 346

Query: 326 NSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAV 385
           N+G KVLPHI N  ILS+  S+GNS +Y ++R L S+   G APK      + G+PY  V
Sbjct: 347 NAGIKVLPHIINVCILSSAWSSGNSFMYATTRSLLSLSQEGYAPKIFNRVNRWGVPYTGV 406

Query: 386 LTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDD 445
              +    LAYL  S   + VF+W  NI+ ++GF  W+   VA++RF +A+    +  D 
Sbjct: 407 AFATAFSCLAYLNVSSSTADVFNWFSNISTISGFLGWICSGVAYLRFRKAVFFNNL-YDR 465

Query: 446 LPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIW 505
           LPFK  F P+  ++               +F   +N  DF  AY+++ LF  +W+G + +
Sbjct: 466 LPFKTPFQPYFTWFYIILIAIICLINGYESFV-HWNYKDFIAAYITLPLFLILWLGHKAY 524

Query: 506 FR--GPLFKKTEDIDLDTDRREIDNDVWEEDE----PKNLWEK 542
            R          +ID+ T  REI+ +  E +     P+NLWEK
Sbjct: 525 TRTWSQWMISVSEIDVTTGLREIEEETKELNARRIPPRNLWEK 567

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  288 bits (736), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 173/526 (32%), Positives = 265/526 (50%), Gaps = 26/526 (4%)

Query: 22  FSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGAL 81
           F R  D       GS     +KR+LK RH+ MIA+GG+IGTGLF+     ++  GP+  +
Sbjct: 65  FQRCIDSFKPPLDGSFDTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVV 124

Query: 82  IAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFAL 141
           I +   G+        LGE+    PV  +F  ++ RFL P+L      +Y + W     L
Sbjct: 125 IGWAIAGSQIIGTIHGLGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPL 184

Query: 142 ELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFII 201
           E+      +Q+W  ++    W+ I +  +VS NL   + +GE EF  + +KVL I GFII
Sbjct: 185 EIISSAMTVQYWNQSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFII 244

Query: 202 YAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTEL 260
              +++CG G     VG +YW +PG    G          F G +S L+ A+++  GTE+
Sbjct: 245 LCIVLICGGGPDHDFVGAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGTEM 294

Query: 261 VGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPF 320
           V + +GE  +P K +P AI +                       +  L    S +++SPF
Sbjct: 295 VCLASGE-TDP-KELPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSS-VNNSPF 351

Query: 321 VIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGI 380
           VIAI+    KVLP I NAVIL +I+S GNS ++ SSR L SM   GL P++  +  ++G 
Sbjct: 352 VIAIKLHQIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGR 411

Query: 381 PYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQG 440
           P   ++T SL G LA+L  S   S VFDWL+ I  +A    W+ I+++HIRF  A+K QG
Sbjct: 412 PLTGIITNSLFGLLAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQG 471

Query: 441 ISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-------KFNVSDFFTAYVSVI 493
            S D+L F +    WG+ Y+A             A  P             FF +Y+  +
Sbjct: 472 RSLDELEFVSAVGIWGSAYSAVINSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCAL 531

Query: 494 LFFAVWIGFQIWFRGPLFK-----KTEDIDLDTDRREIDNDVWEED 534
           +   +++G +I++R    K         IDL+TDR+ ID ++ +++
Sbjct: 532 IMIVLFVGHKIFYRYKTGKWWSMLPLNKIDLETDRKNIDIEILKQE 577

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  286 bits (733), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 177/522 (33%), Positives = 266/522 (50%), Gaps = 20/522 (3%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
           +T +K  LK RH+ MIA+GG IGTGL +   T L   GP   LI +   GT+ Y +  +L
Sbjct: 83  QTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMAL 142

Query: 99  GEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW-TDAV 157
           GE+A   P++  F  +  RF+  + G AN + Y L W +   LE+      + FW TD  
Sbjct: 143 GELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPK 202

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
               ++ + W+ +V  N+  VK YGE EF  + IKV+ +VGFII   I+ CG G TG   
Sbjct: 203 YRDGFVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGYI 262

Query: 218 F-RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
             +YW +PG +     + D    +F G  S  ++AAF++ G+ELVG+ A E+  PRK+VP
Sbjct: 263 GGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVEPRKSVP 317

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPHI 335
           +A  +V                     ND  L    S   ++SPFVIAI+  G K LP +
Sbjct: 318 KAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAASPFVIAIKTHGIKGLPSV 377

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            N VIL  ++S GNS +Y  SR + ++      P+  ++  + G P   +  TS  G +A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGLIA 437

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++ +S     VF+WLL ++ ++  F W  I + HIRF +AL  QG   D+L FK+    W
Sbjct: 438 FVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLDELSFKSPTGVW 497

Query: 456 GAYYAAXXXXXXXXXXXXTAFAPKFN---VSDFFTAYVSVILFFAVWIGFQIWFRG-PLF 511
           G+Y+               A  P  +      FF AY+S  L   ++IG +I+ R   LF
Sbjct: 498 GSYWGLFMVIIMFIAQFYVAVFPVGDSPSAEGFFEAYLSFPLVMVMYIGHKIYKRNWKLF 557

Query: 512 KKTEDIDLDTDRREIDNDVWEED--------EPKNLWEKFWS 545
              E +D+DT RRE+D D+ +++          K  W + W+
Sbjct: 558 IPAEKMDIDTGRREVDLDLLKQEIAEEKAIMATKPRWYRIWN 599

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  284 bits (727), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 162/476 (34%), Positives = 257/476 (53%), Gaps = 6/476 (1%)

Query: 32  ESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLA 91
           E++G   +T ++R  K RH+ M+A+ G IGTGL I   T L   GP   LIA++F G+L 
Sbjct: 37  EAIGESSQT-LQRGFKQRHVDMLAIAGAIGTGLVIGTGTALKRGGPGSLLIAFIFTGSLL 95

Query: 92  YMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQ 151
             V  SL EMA+F P+  SF  +  R++ PALG A G+ YFL ++I  A ELS +G ++Q
Sbjct: 96  IGVLMSLAEMASFAPMDKSFSGYATRYVDPALGFATGWNYFLKYAIALASELSAIGLLVQ 155

Query: 152 FWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG 211
           +W + + +  +I++  VVL+S N   +KFYGEVEFW A +K L ++   +   ++ CG G
Sbjct: 156 YWREDLSIAIFIVVFLVVLLSLNFMNIKFYGEVEFWSALLKFLVLIICFVTGLVLTCGGG 215

Query: 212 KTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAAN 270
            +   +GFRYWR    + P ++      GRFLGW + +I + + Y G+E +G+  GEA N
Sbjct: 216 PSKETIGFRYWREYA-FVPYLVKG--TTGRFLGWWACVIQSCYAYIGSETIGVVFGEAPN 272

Query: 271 PRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIAIENSGT 329
           P+KT+P A   V                     +D  L  ++ S  S SPFVIA  N+G 
Sbjct: 273 PKKTIPAATRNVIFRITGFYIVGVLILGLIISPHDKTLANAKTSDASGSPFVIAFTNAGI 332

Query: 330 KVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTS 389
           K LP   NA+++  I SA N+ +Y+ SR  Y +  +G+APK      + G+P+   L   
Sbjct: 333 KGLPSFINAMLIMFIASAANTALYVCSRTAYGLAKDGMAPKIFLAQNRYGVPFNGCLLAG 392

Query: 390 LVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFK 449
           L+  L+++  S+ +SV+F +L +   V G   W+ + +++I + +A     + RD +PF+
Sbjct: 393 LISLLSFMNISNSSSVIFGYLTSSVTVFGTLNWLSVLISYIGYERARVFHDVPRDRIPFR 452

Query: 450 AKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIW 505
             F P+ AY               +AF   F    F  +Y+ + +F    + ++ W
Sbjct: 453 MWFQPYSAYVCLFFVSLIIFFNGYSAFIAGFKYKSFIVSYIGIAVFIGNTLFWKFW 508

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  285 bits (730), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 168/513 (32%), Positives = 271/513 (52%), Gaps = 22/513 (4%)

Query: 41  QVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGE 100
            + + L  RH+  +A+GG+IG GLF++    L++ GP   +I ++ I T  + V  +LGE
Sbjct: 91  NLNKDLSIRHLITLAVGGSIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGE 150

Query: 101 MATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLT 160
           +A   PV   F V+  RF+ P++  A    Y   W +   LEL      I++W D +   
Sbjct: 151 LAAAYPVVGGFNVYITRFVDPSVAFAINLNYLAQWLVLLPLELVAASITIKYWNDTINSD 210

Query: 161 AWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVC-GAGKTGPVGFR 219
           AW+ I + V+  AN+  VK +GE EF ++ +K+LAI+GF I   ++ C G  + G +G  
Sbjct: 211 AWVAIFYSVIALANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLACGGGPQGGFLGGH 270

Query: 220 YWRNPGPW---GPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           YW +PG +    PG         +F G  S  ++AAF+Y G EL  ++A E+ +PRKT+P
Sbjct: 271 YWHDPGSFVGDKPGT--------QFKGLCSVFVTAAFSYSGIELTAVSAAESKDPRKTIP 322

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSPFVIAIENSGTKVLPH 334
           +A  +                      +DP+L +  S +  ++SP VI+I+N+G K L  
Sbjct: 323 KATKRTFWLVTASYVTILTIIGCLVPFDDPRLLNGSSSVDAAASPLVISIKNAGIKGLDS 382

Query: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394
           + NA+IL +I+S  NS VY  SR + SM   G  PK L+   K G P  A+L+T   G L
Sbjct: 383 LMNAIILISIVSVANSAVYACSRCMVSMAHIGNLPKVLSRVDKRGRPVNAILSTLFFGLL 442

Query: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454
           +++ +S   + VF WL  ++ ++  F WM I+ +HIRF  A+K Q  + D+LP+ ++   
Sbjct: 443 SFIAASDKQAEVFTWLSALSGLSTIFCWMAINYSHIRFRAAMKVQNKTLDELPYLSQCGV 502

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-P 509
            G++Y              T+  P      +V+ FF  Y+S+ +  A ++G +++ R   
Sbjct: 503 IGSWYGVIVLFLVLVASFWTSLFPLGSGTADVTSFFEGYLSLPILIACYVGHKLYVRNLQ 562

Query: 510 LFKKTEDIDLDTDRREIDNDVWEEDEPKNLWEK 542
           +  K ED+DL+T R+ ID     E   + L EK
Sbjct: 563 VLVKLEDMDLETGRKHIDA---HEHRAEILAEK 592

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  285 bits (730), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 161/509 (31%), Positives = 265/509 (52%), Gaps = 14/509 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
           ++++K+++K RH+ M++LG  IGTGL ++ +  L   GP   +I Y+ +  + Y + Q+ 
Sbjct: 88  DSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFITYFMIQAA 147

Query: 99  GEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           GEMA   P + ++F  ++  F+S   G A  ++Y   W+    LEL      IQFW D +
Sbjct: 148 GEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWTTVLPLELITASMTIQFWNDKI 207

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPV 216
               +I+I +V L+  +   VK YGE EF   C K+L I GFI+ + ++ CG AG  G +
Sbjct: 208 NPDIYILIFYVFLLFVHFFGVKAYGETEFIFNCCKILMIAGFIVLSVVINCGGAGNDGYI 267

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           G  YW  PG +     + D +  RF      L++A F++ G EL  ++  E  NPRK+ P
Sbjct: 268 GGAYWHKPGAF-----AGDTSIARFKNVCYILVTAYFSFGGMELFVLSVQEQTNPRKSTP 322

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIAIENSGTKVLPHI 335
            A  +                      ND +L  +  S   +SP+V+A    G +++PHI
Sbjct: 323 VAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLLGAGGSATHASPYVLAASIHGVRIVPHI 382

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            NAVIL +++S  NS +Y   R++ S+   G APK+L +  + G P  A++   ++G +A
Sbjct: 383 INAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVIGVIA 442

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++ +S    +VF WL  I  ++  F W  I ++H+RF QA+K QG S ++L +KA    W
Sbjct: 443 FVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLNELGYKATTGIW 502

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-P 509
           G+ Y +             A AP     K N   FF +Y++  ++   +IG+ I+ R   
Sbjct: 503 GSIYGSFFNILVFIAQFWVALAPLGNGGKCNAEAFFESYLAAPIWLIFYIGYMIYNRDFT 562

Query: 510 LFKKTEDIDLDTDRREIDNDVWEEDEPKN 538
           L    + IDLD  RR  D ++  +++ +N
Sbjct: 563 LLNPLDKIDLDFHRRVYDPELMRQEDEEN 591

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  285 bits (730), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 169/510 (33%), Positives = 269/510 (52%), Gaps = 15/510 (2%)

Query: 36  SVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVS 95
           + K   +K+ +K RH+ MI+LG  IGTGL +   T L + GP G+ I ++ +G   Y V 
Sbjct: 84  NAKHENLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVI 143

Query: 96  QSLGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW- 153
           Q+ GE+A  +  +   F  +    + PALG A  ++Y L W   F LEL      I+FW 
Sbjct: 144 QAAGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFWP 203

Query: 154 -TDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGA-G 211
            + +V    ++ I +V+++  N    + Y E EF+    KVL ++GF I   ++  GA G
Sbjct: 204 GSRSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAVG 263

Query: 212 KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271
            +G +G +YWR+PG  G        +   F G V++L++AAF+   +E V +TA E ANP
Sbjct: 264 TSGYIGGKYWRDPGSLG-----GRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQANP 318

Query: 272 RKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK-SEDSYISSSPFVIAIENSGTK 330
           RK++P A  K+                     +  +L  S DS +  SP+VIA+   G  
Sbjct: 319 RKSIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVSPYVIAVRMHGVN 378

Query: 331 VLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSL 390
           V+P   NAVIL +++S GNS  Y SSR+L+S+     APK   +  ++G P  A++ + L
Sbjct: 379 VVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISIL 438

Query: 391 VGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKA 450
            G + ++ +S     VF WLL I+ ++  F W  I ++HIRF +AL  QG S D+L FKA
Sbjct: 439 FGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFKA 498

Query: 451 KFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWF 506
           +    G+Y +A             +  P    + +   FFT Y+++ +F   + G++IW 
Sbjct: 499 QTGIIGSYVSAIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYKIWN 558

Query: 507 RG-PLFKKTEDIDLDTDRREIDNDVWEEDE 535
           +   LF + + IDL + RR  D DV ++++
Sbjct: 559 KDWRLFIRADQIDLVSHRRIFDADVLKQED 588

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  285 bits (728), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 168/511 (32%), Positives = 265/511 (51%), Gaps = 13/511 (2%)

Query: 37  VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQ 96
           + E+ +K+++K RH+ M+ LG  IGTGL ++ ++ L  +GP   ++AY  +  + Y + Q
Sbjct: 96  ISESHLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYGLVSFVTYFMIQ 155

Query: 97  SLGEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTD 155
           + GEMA   P +  +F  +   F+S   G A  +++ L W     LEL      I++W D
Sbjct: 156 AAGEMAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELITSSLTIKYWND 215

Query: 156 AVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTG 214
            +    +++I +V L+  +   V+ YGE EF     K+L I GFII++ ++ CG AG  G
Sbjct: 216 KINSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSIVVNCGGAGHDG 275

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
            +G +YW +PG +     +   N GRF G    L++A F+Y GTEL  ++  E  NPRK+
Sbjct: 276 YIGGKYWHDPGAF-----TSHTNIGRFKGICFILVTAYFSYGGTELYVLSVNEQENPRKS 330

Query: 275 VPRAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
            P+A  + +                     ND  + S  S   +SP+V+A    G +++P
Sbjct: 331 TPQAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSHGSATHASPYVLAASIHGVRIVP 390

Query: 334 HIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGF 393
           H  NAVIL ++IS  NS +Y S R+L S+   G APK+LT+  + G P  A+ T SL G 
Sbjct: 391 HFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRPLTALATCSLFGV 450

Query: 394 LAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFM 453
           + +  +S+    VF WL  I  ++  F W  I ++H+RF QA+K QG   ++L +KA   
Sbjct: 451 IGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGRDLNELGYKAVSG 510

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP---KFNVSDFFTAYVSVILFFAVWIGFQIWFRGPL 510
            WG+ Y               A AP   K     FF +Y++  +FF  + G+ +W +   
Sbjct: 511 VWGSVYGVFFNILVFFAQFWVALAPPGSKPTALSFFESYLAFPIFFTFYFGYMLWNKDFT 570

Query: 511 FK-KTEDIDLDTDRREIDND-VWEEDEPKNL 539
           F    E IDLD  RR  D + + +E E K +
Sbjct: 571 FLIPLESIDLDFHRRVYDPEFIRQEREEKKI 601

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  284 bits (727), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 178/506 (35%), Positives = 266/506 (52%), Gaps = 18/506 (3%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
            + ++  LK RH+ MIA+GG IGTGLF+     L  AGP G LI +   GT+ + +  +L
Sbjct: 85  RSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWGITGTMIFTMVMAL 144

Query: 99  GEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVP 158
           GE+A   PV+  F+ +  RF+  + G AN + Y   W +   LE+      + +W   V 
Sbjct: 145 GELAVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVAASITVDYWETPVR 204

Query: 159 LT-AWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
            T  ++ + W+V+V  N+  V+ YGE EF  + IKV+A++GFII   I+VCG G  G   
Sbjct: 205 YTDGFVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIILGIILVCGGGPVGGYV 264

Query: 218 F-RYWRNPGPWG---PGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
             RYW +PG +    PG         RF G+ S  ++AAF++ G+ELVGI + E+ NPRK
Sbjct: 265 GGRYWHDPGAFAGHSPG--------RRFKGFCSVFVTAAFSFAGSELVGIASAESKNPRK 316

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIAIENSGTKVL 332
           +VP+A  +V                      DP+L  S     S+SPFVIAI   G   L
Sbjct: 317 SVPQAAKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASASPFVIAIVTHGISGL 376

Query: 333 PHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVG 392
           P + N VIL +++S GNS +Y  SR L ++   G  PK + +  + G P   +   S  G
Sbjct: 377 PSVVNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPLVGIAICSGFG 436

Query: 393 FLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKF 452
            +A++ +S+    +F+WLL I+ ++ F  W  I   HIRF  ALK  G S D+LPFK+  
Sbjct: 437 LIAFVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDELPFKSPV 496

Query: 453 MPWGAYYAAXXXXXXXXXXXXTAFAP---KFNVSDFFTAYVSVILFFAVWIGFQIWFRG- 508
              G+Y+               A  P     N  DFF+AY++  +  A +I  ++W R  
Sbjct: 497 GIIGSYWGMCLAVLMLVAQFYNALFPIGSSPNAYDFFSAYLAAPIVLAFYIAHKLWKRNW 556

Query: 509 PLFKKTEDIDLDTDRREIDNDVWEED 534
            L    +DID+DT RRE D ++ +++
Sbjct: 557 KLLIPLKDIDIDTGRRETDINLLKQE 582

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  283 bits (725), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 173/502 (34%), Positives = 265/502 (52%), Gaps = 13/502 (2%)

Query: 41  QVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGE 100
           Q+ + L  RH+  +A+GG IGTGLF++    LS+ GP   +I ++ I T  + V  SLGE
Sbjct: 95  QMNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPASLVIDWVIISTCLFTVVNSLGE 154

Query: 101 MATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLT 160
           +A   PV   F V+  RF+ P+ G A    Y   W +   LEL      I++W D +   
Sbjct: 155 LAAAFPVVGGFNVYITRFIDPSFGFAVNINYLAQWLVLLPLELVAASITIRYWNDKINSD 214

Query: 161 AWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVC-GAGKTGPVGFR 219
           AW+ I +  +  AN+  VK +GE EF ++ IK+LAIVGF I   ++ C G  K G +G +
Sbjct: 215 AWVAIFYAAIAFANMLDVKSFGETEFILSMIKILAIVGFTILGIVLSCGGGPKGGYIGGK 274

Query: 220 YWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAI 279
           YW +PG +       + +  +F G  S  ++AAF+Y G EL  ++A E+ NPR+T+P+A 
Sbjct: 275 YWHDPGAF-----VGETSGTKFKGLCSVFVTAAFSYSGMELTAVSAAESLNPRETIPKAA 329

Query: 280 NKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSPFVIAIENSGTKVLPHIFN 337
            +                      N+PKL +  S +  +SSP VIAIEN G + LP + N
Sbjct: 330 KRTFWLITLSYVTILTLIGCLVPYNNPKLLNGSSSVDAASSPLVIAIENGGIRGLPSLMN 389

Query: 338 AVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYL 397
           A+IL  I+S  NS VY  SR + SM      P++L    + G P  A L T   G L+++
Sbjct: 390 AIILIAIVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRKGRPLNATLLTLFFGLLSFI 449

Query: 398 ESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
            +S     VF WL  ++ ++  FAWM I+++HIRF QA+ HQGIS D+LP+ +     G+
Sbjct: 450 AASDKQEEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAHQGISLDELPYISMTGVSGS 509

Query: 458 YYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRGP-LFK 512
           +Y              T+  P      + + FF  Y+S  +    ++G +++ R   L  
Sbjct: 510 WYGVIVLFLVLVASFWTSLFPLGGKGADATSFFEGYLSFPILIVCYVGHKLYIRKKRLLI 569

Query: 513 KTEDIDLDTDRREIDNDVWEED 534
              D+DL +DR+ +D +V  E+
Sbjct: 570 DVADMDLVSDRKVVDVEVCREE 591

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  284 bits (727), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 160/508 (31%), Positives = 266/508 (52%), Gaps = 13/508 (2%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           K+  +++ +KPRH+ +++LG  IGTGL +   + L  AGP G +I Y  +G+  Y + Q+
Sbjct: 127 KDDHLQKTIKPRHVLLMSLGTGIGTGLLVGNGSALHKAGPGGLVIGYAIMGSCLYCIIQA 186

Query: 98  LGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
            GEMA  +  +  +F  +    +  A G +  ++Y L W     LEL      IQ+WT  
Sbjct: 187 CGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTT 246

Query: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIM-VCGAGKTGP 215
           V    +++I +V+++  N+   K Y E EF+    KVL + GF I A ++   GAG  G 
Sbjct: 247 VNADVFVVIFYVLIIFINVFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGY 306

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G +YW NPG +       D +  RF   +S+  +AAF +  +E + I A E +NPR+ +
Sbjct: 307 IGAKYWHNPGAF-----RGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAI 361

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYIS-SSPFVIAIENSGTKVLPH 334
           P A   +                     N  +L    S  + +SP+VIA+ + G +V+PH
Sbjct: 362 PSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPH 421

Query: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394
             NAVIL +++S  NS  Y S R+LYS+   G AP +  +  + G P  A++ ++L   +
Sbjct: 422 FINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVI 481

Query: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454
           A+   S     VF WLL I+ ++  F W+ I V+HIRF +A+K QG S D++ FK++   
Sbjct: 482 AFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGV 541

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-P 509
           WG+ YAA             + AP      +  +FF  Y+++ +   ++ G++I  R   
Sbjct: 542 WGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKICKRDWK 601

Query: 510 LFKKTEDIDLDTDRREIDNDVWEEDEPK 537
           LF + +DIDL + R+  D ++ +++E +
Sbjct: 602 LFIRAKDIDLVSHRKIYDGELIKQEEEE 629

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  283 bits (723), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 177/512 (34%), Positives = 273/512 (53%), Gaps = 17/512 (3%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           G  +  ++K+ L+ RH+SMIA+GG++GTGL I   + L  AGP   LIAY  +G + + V
Sbjct: 52  GKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFTV 111

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
              LGEMA +IP+   F  +  R+  PALG A G+ Y   + +    +L+    VIQFW 
Sbjct: 112 MSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFWI 170

Query: 155 DAVPLT--AWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGK 212
            A  ++   WI ++  V+V  N   V+F+GE EFW++  KVL ++  +I   ++  G G 
Sbjct: 171 PAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGGP 230

Query: 213 T-GPVGFRYWRNPGPWGPGIISKDVN----EGRFLGWVSSLISAAFTYQGTELVGITAGE 267
           T   +GFRYW +PG +      KD +     G+F+ ++S  + A F Y GTEL GI A E
Sbjct: 231 THDRLGFRYWSDPGAFKE-YSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVAAE 289

Query: 268 AANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSS---PFVIAI 324
             +PR+ VPRAI                        NDP L    S   S+   P+V+AI
Sbjct: 290 CKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVVAI 349

Query: 325 ENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAA 384
           EN+   VLP++FNA +L+ + SA NSD+Y+ SR LY + ++G APK    T K G+PY A
Sbjct: 350 ENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPYNA 409

Query: 385 VLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRD 444
           +   +L   LAY+  S  A   F + +N+T++ G  +W+ I + +I F +A + QGI + 
Sbjct: 410 LACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIPKS 469

Query: 445 DLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPK-FNVSDFFTAYVSVILFFAVWIGFQ 503
            L + A   P+  + A              AF  K  +V  F T Y+ + ++   +IG++
Sbjct: 470 TLSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEVDVPTFITGYIGLPIYIFCFIGYK 529

Query: 504 IWFRGPLFKKTEDIDLDTDRREIDNDVWEEDE 535
           I  +   +  ++++DL T +  ID    EE+E
Sbjct: 530 IVHKTK-WIPSKEVDLFTFKEAID---LEEEE 557

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  282 bits (721), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 171/520 (32%), Positives = 270/520 (51%), Gaps = 17/520 (3%)

Query: 27  DVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMF 86
           + +S+ES     +  +K+A+K RH+ M+ LG  +GTGL ++ +  LS  GP   +I Y+ 
Sbjct: 55  EEMSMES----TDRHLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGALVIGYIL 110

Query: 87  IGTLAYMVSQSLGEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSV 145
           +  + Y + Q+ GEMA   P +  SF  +T  F+S  +G A  +++ + W     LEL  
Sbjct: 111 VSFVTYFMIQAAGEMAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTVLPLELIT 170

Query: 146 VGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFI 205
               IQ+W D++    WI+I +V L+  ++  VK YGE+EF     K+L I GFII++ +
Sbjct: 171 GTMTIQYWNDSINADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILFIGGFIIFSIV 230

Query: 206 M-VCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGIT 264
           +   GAG  G +G +YW+NPG +     +   + GRF      L++A F+Y GTEL  ++
Sbjct: 231 VNAGGAGTDGYIGAKYWKNPGSF-----ASSTSAGRFKDVCYVLVTAYFSYGGTELYVLS 285

Query: 265 AGEAANPRKTVPRAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIA 323
             E ANPR++ P+A  + +                     ND  + +  S   +SP+V+A
Sbjct: 286 VNEQANPRRSTPKAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAGGSSTHASPYVLA 345

Query: 324 IENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYA 383
               G KV+PHI NAVIL  + S GNS +Y + R+  S+   G APK L +  + G P  
Sbjct: 346 ASIHGVKVVPHIINAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYIDREGRPII 405

Query: 384 AVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISR 443
           A+   ++VG +A+  +S     VF WL  I A++  F W  I ++HIRF  A+K QG   
Sbjct: 406 ALAACAVVGVIAFAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMAMKVQGKDL 465

Query: 444 DDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP---KFNVSDFFTAYVSVILFFAVWI 500
           ++L +KA    WG+ +               A +P     +   FF +Y++  L+   + 
Sbjct: 466 NELGYKALTGVWGSMWGFGFCVLVFIAQFWVALSPPGGTISAEGFFESYLAFPLWLFFYF 525

Query: 501 GFQIWFRGPLF-KKTEDIDLDTDRREIDND-VWEEDEPKN 538
            + +W R   F  K EDIDLD  RR  D + + +EDE + 
Sbjct: 526 AYMLWKRDFTFLTKLEDIDLDAHRRIYDPEFLRQEDEERK 565

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  282 bits (721), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 176/526 (33%), Positives = 266/526 (50%), Gaps = 26/526 (4%)

Query: 22  FSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGAL 81
           F R+ D       GS   + +K+ LK RH+ MIA+GG+IGTGLFI     L+  GP+  +
Sbjct: 66  FQRAIDSFKPPEDGSFDTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQALATGGPLAVI 125

Query: 82  IAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFAL 141
           I +   G+        LGE+    PV  +F  ++ RFL P++      +Y + W     L
Sbjct: 126 IGWAIAGSQIIGTIHGLGEITVRFPVVGAFANYSTRFLDPSISFVVSTIYVIQWFFVLPL 185

Query: 142 ELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFII 201
           E+      +Q+W +++    W+ I +V +VS NL  V+ +GE EF  + IKV+ I GFI+
Sbjct: 186 EIISSAMTVQYWNESIDPVVWVAIFYVTIVSINLFGVRGFGEAEFIFSTIKVITISGFIL 245

Query: 202 YAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTEL 260
              I++ G G     VG RYW NPG    G          F G +S ++ A+++  GTE+
Sbjct: 246 LCIILIAGGGPDHVYVGSRYWHNPGCLANG----------FPGVLSVMVVASYSLGGTEM 295

Query: 261 VGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPF 320
             + +GE  +P K +P AI +V                      +  L    S + +SPF
Sbjct: 296 TCLASGE-TDP-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSS-VDNSPF 352

Query: 321 VIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGI 380
           VIAI+    KVLP I NAVIL +I+S GNS ++ SSR L SM    L P +  +  ++G 
Sbjct: 353 VIAIKIHHIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQHLLPWWFGYIDRAGR 412

Query: 381 PYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQG 440
           P   ++T SL G LA+L  S   S VFDWL+ I  +A    W+ I+V+HIRF  A+K QG
Sbjct: 413 PLVGIITNSLFGLLAFLVKSGSMSEVFDWLMAIAGLATCIVWLSINVSHIRFRLAMKAQG 472

Query: 441 ISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-------KFNVSDFFTAYVSVI 493
            S ++L F +    WG+ Y+A             +  P       +     FF +Y+  +
Sbjct: 473 RSLNELEFVSAVGIWGSVYSAIINCLILVAQFYISLWPIGGWKNSEDRAKKFFQSYLCAL 532

Query: 494 LFFAVWIGFQIWF---RGPL--FKKTEDIDLDTDRREIDNDVWEED 534
           +   +WIG +I++    G +  F    +IDLD  R+ ID DV +++
Sbjct: 533 IMVCIWIGHKIYYWRQTGKIWAFTPLAEIDLDEGRKNIDLDVLKQE 578

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  281 bits (719), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 167/513 (32%), Positives = 261/513 (50%), Gaps = 18/513 (3%)

Query: 37  VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQ 96
           V +T +K+A+K RH+ M+++G  IGTGL ++ +  L  +GP   +I Y+ +  + Y + Q
Sbjct: 48  VTKTHLKKAMKSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQ 107

Query: 97  SLGEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTD 155
           + GEMA   P +  SF  +T  F+S   G A  +++F+ W   F LEL      +++W D
Sbjct: 108 AAGEMAVAYPTLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPLELITASLTVKYWND 167

Query: 156 AVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTG 214
            +    +III +  L+  +   VK YGE EF     KVL + GFII + ++ CG AG  G
Sbjct: 168 KINADVFIIIFYAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDG 227

Query: 215 PVGFRYWRNPGPW--GPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPR 272
            +G +YW +PG +  GP I        RF G    L+SA F+Y G EL  ++  E  NPR
Sbjct: 228 YIGAKYWHDPGSFADGPPIT-------RFKGVCFILVSAYFSYGGAELFSLSVNEQENPR 280

Query: 273 KTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYIS-SSPFVIAIENSGTKV 331
           K+ P A  +                      N  +L    S  + +SP+V+A      KV
Sbjct: 281 KSTPAAAKQSIYRILIIYLATMILIGFNVPHNSDELMGAGSAATHASPYVLAASLHSVKV 340

Query: 332 LPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLV 391
           +PH  NAVIL ++IS  NS +Y + R++ S+   G APK+L +  + G P   ++  +L 
Sbjct: 341 VPHFINAVILISVISVANSALYAAPRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALF 400

Query: 392 GFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAK 451
           G + ++ +S     VF WL  I  ++  F W  I ++HIRF QA+K  G S D++ FKA 
Sbjct: 401 GVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKAV 460

Query: 452 FMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILFFAVWIGFQIWF 506
              WG+YY               A +P     K +   FF +Y++  ++   + G+ I+ 
Sbjct: 461 TGIWGSYYGCAFNILVFIAQFWVALSPPGSGGKCDAEAFFQSYLAAPIWLVFYFGYMIYK 520

Query: 507 RG-PLFKKTEDIDLDTDRREIDNDVWEEDEPKN 538
           R   +    E IDLD  RR  D D  ++++ +N
Sbjct: 521 RDFTILNPLEKIDLDFHRRIYDPDFIKQEDEEN 553

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  281 bits (720), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 182/540 (33%), Positives = 267/540 (49%), Gaps = 24/540 (4%)

Query: 25  SKDVVSLESLG-SVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIA 83
           + D+  +E +        +K  LK RH+ MIA+GG IGTGLF+   T L  AGP G LI 
Sbjct: 63  TDDMSDIEKIAHRTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIG 122

Query: 84  YMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALEL 143
           +   GT+ Y +  ++GE++   P++  F  +  RF+  + G AN + Y L W     LE+
Sbjct: 123 WGLTGTMIYCMVMAMGELSVVFPISGGFTTYATRFIDESFGFANNFNYMLQWLCVLPLEI 182

Query: 144 SVVGQVIQFW-TDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIY 202
                 + +W TD      ++ + WVV+V  NL  VK YGE EF  + IKVL ++GFII 
Sbjct: 183 VAASITVNYWGTDPKYRDGFVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVIGFIIM 242

Query: 203 AFIMVCGAGKTGPVGF-RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELV 261
             ++ CG G  G     +Y+ +PG +       D    RF G  S  ++AAF++ G+EL+
Sbjct: 243 GIVLNCGGGPEGGYIGGKYFHDPGAF-----VGDTAGARFQGVCSVFVTAAFSFAGSELI 297

Query: 262 GITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPF 320
           GI A E+A PRK+VP+A  +V                      D +L    S   ++SPF
Sbjct: 298 GIAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSVDAAASPF 357

Query: 321 VIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGI 380
           VIAI + G + LP + N VIL  ++S GNS VY  SR L ++      PK   +  +SG 
Sbjct: 358 VIAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYIDRSGR 417

Query: 381 PYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQG 440
           P   +  TS  G +A++  S     VF WLL ++ ++  F W  I   HIRF  AL  QG
Sbjct: 418 PLFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAALTAQG 477

Query: 441 ISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP---KFNVSDFFTAYVSVILFFA 497
            S D+LPFKA    +G+ +               A  P   K +   FF +Y+S  +  A
Sbjct: 478 RSTDELPFKAPAGIYGSMWGLFMIVLMFMAQFYVALFPPGGKPSAEVFFQSYLSFPVVLA 537

Query: 498 VWIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWEED--EPKNL---------WEKFWS 545
            + G +++ R   L      +D+DT RRE+D DV  ++  E K +         W  FW 
Sbjct: 538 FYFGHKLYARNWKLLIPLSKLDIDTGRREMDLDVLRQEIAEEKQMMSTRPWWYRWYSFWC 597

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  281 bits (720), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 163/517 (31%), Positives = 269/517 (52%), Gaps = 16/517 (3%)

Query: 31  LESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTL 90
           +ES+ S  ++++K+++K RH+ M++LG  IGTGL ++ +  L   GP   +I Y+ +  +
Sbjct: 82  IESITS--DSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFV 139

Query: 91  AYMVSQSLGEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQV 149
            Y + Q+ GEMA   P + ++F  ++  F+S   G A  ++Y   W     LEL      
Sbjct: 140 TYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWLTVLPLELITASMT 199

Query: 150 IQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG 209
           IQ+W D +    +I+I ++ L+  ++  VK YGE EF   C K+L I GFII + ++ CG
Sbjct: 200 IQYWNDKLNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMIAGFIILSVVINCG 259

Query: 210 -AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEA 268
            AG  G +G  YW NPG +     + D +  RF      L++  F++ G EL  ++  E 
Sbjct: 260 GAGDDGYIGGAYWHNPGAF-----AGDTSIARFKNVCYILVTGYFSFGGMELFALSVQEQ 314

Query: 269 ANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK-SEDSYISSSPFVIAIENS 327
           +NPRK+ P A  +                      ND +L  +  S   +SP+V+A    
Sbjct: 315 SNPRKSTPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIH 374

Query: 328 GTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLT 387
           G K++PHI NAVIL +++S  NS +Y   R++ S+   G APK+L +  + G P  A++ 
Sbjct: 375 GVKIVPHIINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVDREGRPLRALIV 434

Query: 388 TSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLP 447
             + G +A++ +S    +VF WL  I  ++  F W  I ++H+RF QA+K QG S D+L 
Sbjct: 435 CCIFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELG 494

Query: 448 FKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILFFAVWIGF 502
           +KA    WG+ Y               A AP     + +V  FF +Y++  ++   + G+
Sbjct: 495 YKATTGIWGSVYGFFFNILVFIAQFWVALAPLGNDGRCSVESFFESYLAAPIWLTFFFGY 554

Query: 503 QIWFRG-PLFKKTEDIDLDTDRREIDNDVWEEDEPKN 538
            I+ R   L    + IDLD  RR  D ++  +++ +N
Sbjct: 555 MIYNRDFTLLNPLDKIDLDFHRRIYDPELIRQEDQEN 591

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  281 bits (719), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 172/516 (33%), Positives = 269/516 (52%), Gaps = 13/516 (2%)

Query: 27  DVVSLESLG-SVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYM 85
           ++  LE +      + ++  LK RH+ MIA+GG IGTGLF+     L  AGP G LI + 
Sbjct: 72  NLTDLEKIAIKTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWS 131

Query: 86  FIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSV 145
             GT+ + +  +LGE+A   PV+  F  +  RF+  + G A  + Y L W +   LE+  
Sbjct: 132 ITGTMIFTMVMALGELAVMFPVSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVA 191

Query: 146 VGQVIQFWTDAVPLT-AWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAF 204
               + +W   V  T  ++ + W+V+V  N+  V+ YGE EF  + IKV A++GFII   
Sbjct: 192 ASITVAYWETPVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGI 251

Query: 205 IMVCGAGKTGPVGF-RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGI 263
           ++VCG G  G     RYW NPG +         +  +F G+ S  ++AAF++ G+EL+G+
Sbjct: 252 VLVCGGGPVGGYVGARYWHNPGAF-----VGSTSGQKFHGFCSVFVTAAFSFAGSELIGL 306

Query: 264 TAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVI 322
              EA NPRK VP A  +V                     NDP+L  S     S+SPFVI
Sbjct: 307 AGSEAKNPRKAVPSAAKQVFWRILLFYIICLLLIGFLVPYNDPRLISSSSVDASASPFVI 366

Query: 323 AIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPY 382
           AI   G   LP + N VIL +++S GNS +Y  SR L ++   G  PK +++  + G P 
Sbjct: 367 AIVTHGISGLPSVINVVILISVLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPL 426

Query: 383 AAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGIS 442
             +  +S  G +A++ +S+  + +F+WLL I+ ++ FF W  I + HIRF  ALK QG  
Sbjct: 427 VGIAISSTFGLIAFVAASNKQNEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGRG 486

Query: 443 RDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP---KFNVSDFFTAYVSVILFFAVW 499
            D+LPF +     G+Y+               A  P     +  +FF+AY++  +  A +
Sbjct: 487 TDELPFVSPAGVIGSYWGLFLNILMLIAQFYIALFPIGGSPSAYEFFSAYLAAPVILAFY 546

Query: 500 IGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWEED 534
           I  ++W +        ED+D+DT RR+ D ++ +++
Sbjct: 547 IAHKLWKKNWKFLIPLEDVDIDTGRRDTDVNLLKQE 582

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  280 bits (717), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 187/549 (34%), Positives = 284/549 (51%), Gaps = 33/549 (6%)

Query: 27  DVVSLESLGSVKETQ------VKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGA 80
           D     SL   K+ Q      +K+ LK RH+ +IALGGTIGTGL +  S  L+  GP G 
Sbjct: 49  DYSETSSLDEEKQQQPEENGKLKQGLKSRHVQLIALGGTIGTGLLVGSSQTLATCGPAGL 108

Query: 81  LIAYMFIGTLAYMVSQSLGEMATFIPV-------TSSFMVFTQRFLSPALGAANGYMYFL 133
             +Y+ I T  Y +  + GEM  ++P        +S+++V  ++++  +LG A+ + Y+ 
Sbjct: 109 FTSYLIICTFIYPIMNAFGEMVCYLPGNGSDSAGSSAYLV--EKYVDRSLGFASSWNYYY 166

Query: 134 SWSITFALELSVVGQVIQFWTDA--VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACI 191
            + I  A E +    V+++W  A  VP  AWI I    +V+ N+ PV FYGE EFW A I
Sbjct: 167 CFVILVATECTAAAGVVEYWAWALKVPKGAWITIFLFCVVALNMLPVNFYGESEFWFASI 226

Query: 192 KVLAIVGFIIYAFIMVCGAGKT-GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLIS 250
           K+L I+G II +FI+  G G +   +GFRYW+ PG +   I   D   G FL   + +I 
Sbjct: 227 KILCILGLIILSFILFWGGGPSHDRLGFRYWQRPGAFADHI--TDGTGGNFLDVYTGVIK 284

Query: 251 AAFTY-QGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK 309
             F +  G ELV +T+ E  + R+ + +A  +                      NDP L+
Sbjct: 285 GGFAFVLGPELVSLTSSECHDQRRNIAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQ 344

Query: 310 S----EDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLN 365
           +          SSPFVI I+N+G KVLPHI N  I+++  SAGN+ ++ SSR L +M  +
Sbjct: 345 NALAQSKPGAGSSPFVIGIQNAGIKVLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASH 404

Query: 366 GLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLI 425
           G APK+ +   + G+PY AV  + L   LAYL  S   + VF+W  NI+ ++GF  W+  
Sbjct: 405 GHAPKFFSKINRFGVPYVAVGFSFLFCCLAYLNVSSSTANVFNWFSNISTISGFIGWICA 464

Query: 426 SVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF-NVSD 484
            VA+IRF +A+    +  D LP+K     +  +Y+               F P+F +  D
Sbjct: 465 CVAYIRFRKAIIFNDL-YDRLPYKGFAQKYLIWYSLFMVSLITLTNGYQIFIPRFWDYKD 523

Query: 485 FFTAYVSVILFFAVWIGFQIWFRG--PLFKKTEDIDLDTDRREIDNDVWEEDE----PKN 538
           F  AY+++ +F  +WIG ++  R     +   + ID+ T   EI+    E DE    P N
Sbjct: 524 FIAAYITLPVFIVLWIGHKLVTRSWRQWYIPVDKIDVFTGLEEIEELTNELDEKRVPPNN 583

Query: 539 LWEKFWSAV 547
            W+KF  A+
Sbjct: 584 AWDKFLDAL 592

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  279 bits (714), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 167/521 (32%), Positives = 271/521 (52%), Gaps = 14/521 (2%)

Query: 23  SRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALI 82
           SRS D+   E + S   T++++ ++ RH+ M++LG  IGTGL ++ +  L   GP G LI
Sbjct: 45  SRSGDLEDGE-INSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLI 103

Query: 83  AYMFIGTLAYMVSQSLGEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFAL 141
            Y+ +  ++Y++  + GEMA   P +  +F  ++  F+S   G A  +++ L W   F L
Sbjct: 104 GYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPL 163

Query: 142 ELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFII 201
           EL     VI++W  +V    +++I ++ ++  +    + YGE EF     KVL IVGF+I
Sbjct: 164 ELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVI 223

Query: 202 YAFIMVCGA-GKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTEL 260
              ++  GA G TG +G RYWRNPG +  G         +  G    L++A F++ G EL
Sbjct: 224 VGILINVGAIGDTGYIGDRYWRNPGSFVSG-----TPLDKLKGTAYVLVTAYFSFGGMEL 278

Query: 261 VGITAGEAANPRKTVPRAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSP 319
             ++  E  NP+  +P A  K V                     +D  + S  + +  SP
Sbjct: 279 YALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSP 338

Query: 320 FVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSG 379
           +V+AIE  G KVLPHI NAVIL ++IS GNS +Y + R+L ++   G APK L +  + G
Sbjct: 339 YVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREG 398

Query: 380 IPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQ 439
            P  +++  ++ G +A+  +S     +F WL  I  ++  F W  I ++H RF QA+K Q
Sbjct: 399 RPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQ 458

Query: 440 GISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILF 495
           G S + L ++A    WG+ YA              A  P    K +V  FF  Y++  L+
Sbjct: 459 GRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLW 518

Query: 496 FAVWIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWEEDE 535
             +++G+ ++ R   L    + +DLDT RR  D +V +++E
Sbjct: 519 LIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEE 559

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  278 bits (712), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 164/523 (31%), Positives = 267/523 (51%), Gaps = 22/523 (4%)

Query: 22  FSRSKDVVSLESLGSVKET--QVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVG 79
           F R +DV  +    +   T  ++K+ +K RH+ MI LG  IGTGL +   + L+ AGP G
Sbjct: 43  FRRGRDVDLMCKADAEDGTTAKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAG 102

Query: 80  ALIAYMFIGTLAYMVSQSLGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSIT 138
            ++ Y+    + Y++ ++ GE+   +  +T ++  ++   + PA+G +  ++Y + W   
Sbjct: 103 LILGYVVSSAMLYLIVEAAGELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTV 162

Query: 139 FALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVG 198
           F L+L     +IQ+WTD  P   ++ I++ V+V  NL   K Y E EF+    KVL I+G
Sbjct: 163 FPLQLVTAAMIIQYWTDINP-DIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIG 221

Query: 199 FIIYAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQG 257
           F+I   ++ CG AG +G +G +YW  P P+  G          F G       AAF Y G
Sbjct: 222 FVILGVVINCGGAGTSGYIGDKYWHEPRPFMNG----------FKGLCFVFCYAAFAYGG 271

Query: 258 TELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISS 317
            E++ ++A E  NPRK++  A  KV                     + P L SE S   +
Sbjct: 272 IEVMVLSASEQENPRKSISSACKKVIYRIVLIYLLTTVIVCFLVPADHPSLASEGS--RA 329

Query: 318 SPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTK 377
           SP VIA+   G K++PHI NAVIL  ++S GNS +Y + R+L S+   G APK  T+  +
Sbjct: 330 SPLVIAVSFHGVKIVPHIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDR 389

Query: 378 SGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALK 437
            G P  A     + G LA+L +S     VF WLL I+ ++  F WM I ++HIRF  A+K
Sbjct: 390 QGRPLPAFFVAMVFGLLAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMK 449

Query: 438 HQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVI 493
            QG S  ++ +KA+   WG++ A              A +P      +   FF +Y++  
Sbjct: 450 AQGRSMGEVGYKARTGYWGSWIAVVTAFLILIAQFWVAISPVETKGVDARSFFQSYLAFP 509

Query: 494 LFFAVWIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWEEDE 535
           +    + G++I+ +   +     ++DL + R+  D D  ++++
Sbjct: 510 ILLLAYFGYKIYHKDWRICIPASEVDLISHRQVFDEDELKQED 552

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  279 bits (714), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 169/526 (32%), Positives = 264/526 (50%), Gaps = 26/526 (4%)

Query: 22  FSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGAL 81
           F R  D       GS   + +KR LKPRH+ MIA+GG+IGTGLF+     ++  GP+G +
Sbjct: 58  FQRCVDSFKSPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVV 117

Query: 82  IAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFAL 141
           I +   G+        LGE+    PV  +F  +  RFL P++      +Y L W     L
Sbjct: 118 IGWAIAGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPL 177

Query: 142 ELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFII 201
           E+      +Q+W  ++    W+ I + V+VS NL  V+ +GE EF  + IK + + GFII
Sbjct: 178 EIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFII 237

Query: 202 YAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTEL 260
              +++CG G     +G +YW +PG    G          F G +S L+ A+++  G E+
Sbjct: 238 LCVVLICGGGPDHEFIGAKYWHDPGCLANG----------FPGVLSVLVVASYSLGGIEM 287

Query: 261 VGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPF 320
             + +GE  +P K +P AI +V                      +  L    S + +SPF
Sbjct: 288 TCLASGE-TDP-KGLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLGGSS-VDNSPF 344

Query: 321 VIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGI 380
           VIAI+    K LP I NAVIL +++S GNS ++ SSR L SM   GL P +  +  ++G 
Sbjct: 345 VIAIKLHHIKALPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGR 404

Query: 381 PYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQG 440
           P   ++  SL G LA+L  S   S VF+WL+ I  +A    W+ I+++HIRF  A+K QG
Sbjct: 405 PLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQG 464

Query: 441 ISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-------KFNVSDFFTAYVSVI 493
            S D+L F +    WG+ Y+A             +  P       K     FF  Y+  +
Sbjct: 465 KSLDELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWTSGKERAKIFFQNYLCAL 524

Query: 494 LFFAVWIGFQIWFRGPL-----FKKTEDIDLDTDRREIDNDVWEED 534
           +   ++I  +I+++         K  +DIDL+TDR++ID ++ +++
Sbjct: 525 IMLFIFIVHKIYYKCQTGKWWGVKALKDIDLETDRKDIDIEIVKQE 570

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  279 bits (714), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 164/509 (32%), Positives = 261/509 (51%), Gaps = 14/509 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
              +K+++K RH+ M++LG  IGTGL ++ +  L  AGP   +I Y+ +  + Y + Q+ 
Sbjct: 83  NNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFVTYFMVQAA 142

Query: 99  GEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           GEM    P +  +F  +   F+S + G A  +++ + W     LEL      I++W D +
Sbjct: 143 GEMGVTYPTLPGNFNAYNSIFVSKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWNDTI 202

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPV 216
               +I I +V L+  +   VK YGE EF     K+L I GFII + I+ CG AG  G +
Sbjct: 203 NADVFIAIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSVIINCGGAGVDGYI 262

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           G  YWRNPG +  G      +  RF G    L++A F++ G EL  ++  E ANPRK+ P
Sbjct: 263 GGEYWRNPGSFADG-----SSATRFKGICFILVTAYFSFGGIELFVLSINEQANPRKSTP 317

Query: 277 RAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHI 335
            A  + +                     ND  + S  S   +SP+V+A    G KV+PHI
Sbjct: 318 VAAKRSIYRILIIYLLTMILIGFNVPHDNDQLMGSGSSATHASPYVLAASIHGVKVIPHI 377

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            NAVIL ++IS  NS +Y + R++ S+   G APK+L +  + G P  A++  S VG + 
Sbjct: 378 INAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSFVGLVG 437

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++  S      F WL  I  ++  F W  I ++HIRF +A+K QG S D++ +K+    W
Sbjct: 438 FVACSSQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKSNTGIW 497

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-P 509
           G+YY               A +P     K +V  FF +Y++  L+  +++G+ I+ +   
Sbjct: 498 GSYYGVIFNILVFMAQFWVALSPPGSDGKCDVESFFQSYLAAPLWIFMYLGYMIYNKDFT 557

Query: 510 LFKKTEDIDLDTDRREIDNDVWEEDEPKN 538
           L    + IDLD  RR  D ++  +++ +N
Sbjct: 558 LLNPLDKIDLDFHRRVYDPEIMRQEDEEN 586

>Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)
          Length = 523

 Score =  277 bits (708), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 166/505 (32%), Positives = 258/505 (51%), Gaps = 25/505 (4%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
            T VKRALK RHIS++ALGG IG G  +     L   GP+  L+ ++ IG +A+ V +S+
Sbjct: 29  NTGVKRALKNRHISLLALGGIIGPGCLVGAGNALQKGGPLALLLGFVIIGIIAFAVMESI 88

Query: 99  GEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVP 158
           GEM T  P    F    +RF S AL A  GY Y + +    A E + +  ++QFW   VP
Sbjct: 89  GEMITLYPSGGGFTTLARRFHSDALSAVCGYAYVIVFFAVLANEYNTLSSILQFWGPQVP 148

Query: 159 LTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPV-G 217
           L A+ +I W+V     L  V  +GE E+W++ +K+L ++ + I++ I + G  +  P  G
Sbjct: 149 LYAYTLIFWIVFEIFQLIGVGVFGETEYWLSLLKILGLIVYYIFSIIYMSGGVRNKPAFG 208

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           F YW++PG    G          F G     +  +  Y GTE V +TA E+ NP K+VP 
Sbjct: 209 FHYWKDPGSLSHG----------FKGIAVVFVFCSSFYSGTESVALTATESKNPTKSVPY 258

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           A+ +                      NDP L S ++ +  SP  IAI  +G     H+ N
Sbjct: 259 AVRQTLWRIVVVYIGIAIFYGSTVPFNDPNL-SVNTKVLKSPIAIAISRAGWAGGSHLVN 317

Query: 338 AVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYL 397
           A IL + ISA N  +YI SR L ++   GLAPK+L WT K G+P  A+   + +G ++ +
Sbjct: 318 AFILFSCISAINGSLYIGSRTLTNLAYEGLAPKFLAWTDKRGVPIPAITIFNALGLISLM 377

Query: 398 ESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
             S GAS  + +++N++ V  F  W +IS  H+R  +A   QG   ++LP+KA F PW  
Sbjct: 378 NMSVGASNAYSYIVNLSGVGVFIVWGVISYTHLRLRKAWVAQGRLLEELPYKALFYPWTP 437

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYV----SVILFFAVWIGFQIWFRGPLFKK 513
            ++             T+  P F   +F  AY+    ++IL+  V +     F+   F+ 
Sbjct: 438 IFSLISNIFLALIQGWTSLVP-FKAPEFVDAYILLPAAIILYVGVCV-----FKNHNFRI 491

Query: 514 TE--DIDLDTDRR-EIDNDVWEEDE 535
            +   ++LD  RR +++ND  +++ 
Sbjct: 492 VDLTSVNLDEGRRKDMENDQSDQES 516

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  279 bits (713), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 177/529 (33%), Positives = 275/529 (51%), Gaps = 19/529 (3%)

Query: 22  FSRSKDVVSLESLGSVK-ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGA 80
           F  S+D+    S+ SV+  ++ K+++K RH+ M++LG  IGTGL ++    L   GP G 
Sbjct: 62  FDASQDLEG-ASINSVRSNSKFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGPAGL 120

Query: 81  LIAYMFIGTLAYMVSQSLGEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITF 139
           LI Y  +  +AY++ Q+ GEMA   P +  +F V++  F+S + G A  ++Y L W    
Sbjct: 121 LIGYSLVSVVAYIMMQAAGEMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWLTVL 180

Query: 140 ALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGF 199
            LEL      I++W  ++   A+I I + V+V  +      YGE EF  +  KV  I GF
Sbjct: 181 PLELITASLTIKYWNSSINPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSMIAGF 240

Query: 200 IIYAFIMVCGAGKTGPVGF-RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGT 258
           II + ++ CG   TG      YWRNPG +  G        G F G    L++A F+Y G 
Sbjct: 241 IILSIVINCGGAGTGGYIGGEYWRNPGAFAGG-----SPIGHFKGIAYVLVTAYFSYGGM 295

Query: 259 ELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL--KSEDSYIS 316
           EL  +T  E ANPRK VP A  K                      N  +L   S  S   
Sbjct: 296 ELFALTVNEQANPRKAVPSATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSGKSATH 355

Query: 317 SSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTT 376
           +SP+VIA+ + G KV+PHI NAVIL +++S GNS +Y + R+L S+   G APK  ++  
Sbjct: 356 ASPYVIAVASHGVKVVPHIINAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYVD 415

Query: 377 KSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQAL 436
           ++G P  A++  S+ G L+++ +S     VF WL  I  ++  F W  I ++H+RF  A+
Sbjct: 416 RAGRPLVALVGCSIFGLLSFVAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRDAM 475

Query: 437 KHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVS 491
           K+QG S  +L +K+K   WG+ YA              A AP     K +   FF +Y++
Sbjct: 476 KYQGYSLSELGYKSKTGYWGSIYAIFFNIIVFVAQFWVALAPIGNGGKADAEAFFQSYLA 535

Query: 492 VILFFAVWIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDV--WEEDEPK 537
             ++ + ++G++I+ +   L    ++IDL++ R   D  +   E+DE K
Sbjct: 536 FPIWISCYVGYKIYSKEWKLLVPLDEIDLNSHRHIFDKHILQQEDDEHK 584

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  278 bits (712), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 166/526 (31%), Positives = 266/526 (50%), Gaps = 26/526 (4%)

Query: 22  FSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGAL 81
           F R  D       GS   + +KR LKPRH+ MIA+GG+IGTGLF+     ++  GP+G +
Sbjct: 58  FQRCVDSFKPPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVV 117

Query: 82  IAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFAL 141
           + +   G+        LGE+    PV  +F  +  RFL P++      +Y L W     L
Sbjct: 118 LGWTIAGSQIIGTVHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPL 177

Query: 142 ELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFII 201
           E+      +Q+W  ++    W+ I + V+VS NL   + +GE EF  + +K + + GFII
Sbjct: 178 EIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSINLFGARGFGEAEFAFSTVKAITVGGFII 237

Query: 202 YAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTEL 260
              +++CG G     +G +YW +PG    G          F G +S L+ A+++  G E+
Sbjct: 238 LCIVLICGGGPDHEFIGAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGIEM 287

Query: 261 VGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPF 320
             + +GE  +P K +P AI +V                      +  L    S + +SPF
Sbjct: 288 TCLASGE-TDP-KGLPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSS-VDNSPF 344

Query: 321 VIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGI 380
           VIAI+    KVLP I NAVIL +++S GNS ++ SSR L SM   GL P +  +  ++G 
Sbjct: 345 VIAIKLHHIKVLPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGR 404

Query: 381 PYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQG 440
           P   ++  SL G LA+L  S   S VF+WL+ I  +A    W+ I+++H+RF  A+K QG
Sbjct: 405 PLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHVRFRLAMKAQG 464

Query: 441 ISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-------KFNVSDFFTAYVSVI 493
            S D+L F +    WG+ Y+A             +  P       K     FF  Y+  +
Sbjct: 465 KSLDELEFVSAVGIWGSVYSALINCLILIAQFYCSLWPIGGWTSSKERAKIFFQNYLCAL 524

Query: 494 LFFAVWIGFQIWFRGPL-----FKKTEDIDLDTDRREIDNDVWEED 534
           +   +++  +I++R  +      K+ +DIDL+TDR++ID ++ +++
Sbjct: 525 IMVFIFVIHKIYYRCQMGKWWGVKELKDIDLETDRKDIDIEIVKQE 570

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  278 bits (712), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 171/503 (33%), Positives = 268/503 (53%), Gaps = 12/503 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
           +T +K  LK RH+ MIA+GG IGTGL +     L   GP   LI +  +GT+ Y +  +L
Sbjct: 82  QTPLKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWGSMGTMIYAMVMAL 141

Query: 99  GEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW-TDAV 157
           GE+A   P++  F  +  RF+  + G A  + Y L W +T  LE+      + +W TD  
Sbjct: 142 GELAVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVSASITVNYWGTDPK 201

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KTGPV 216
               ++ + W+V+V  N+  VK YGE EF  + IKV+ I+GFII   I+ CG G + G +
Sbjct: 202 YRDGFVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGIILNCGGGPEKGYI 261

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           G +Y+ +PG +     + D    +F G  S  ++AAF++ G+ELVG+ A E+ +PRK+VP
Sbjct: 262 GGKYFHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVDPRKSVP 316

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPHI 335
           +A  +V                     ND +L    S   ++SPFVIAI   G K LP +
Sbjct: 317 KAAKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSVDAAASPFVIAIVTHGIKGLPSV 376

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            N VIL  ++S GNS ++  SR   ++   G  P+   +  + G P   ++ TS VG +A
Sbjct: 377 VNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPLVGIIITSAVGLIA 436

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++ +S+    VF+WLL ++ ++  F W  I + HIRF +AL  QG S D+L FK+    W
Sbjct: 437 FVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRSVDELSFKSPTGVW 496

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP---KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-PLF 511
           G+Y+               A  P     +   FF AY+S  L  A++IG +I+ R   L 
Sbjct: 497 GSYWGLFMIVIMFIAQFYVALFPVNGSPSAEGFFEAYLSFPLVLAMYIGHKIYKRNWKLL 556

Query: 512 KKTEDIDLDTDRREIDNDVWEED 534
               ++D+D+ RRE+D ++ +++
Sbjct: 557 IPAGEMDIDSGRREVDLELLKQE 579

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  278 bits (710), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 167/504 (33%), Positives = 258/504 (51%), Gaps = 24/504 (4%)

Query: 41  QVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGE 100
            + + L  RH+  +A+GG+IGTGLF++  T L+  GP   +I ++ I +  + V  +LGE
Sbjct: 77  NLNKDLDIRHLLTLAIGGSIGTGLFVNSGTSLNTGGPASLIIGWVIISSALFTVINALGE 136

Query: 101 MATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLT 160
           +A   P+   F V+  RF+ P+   A    Y + W ++  LEL      I++W   +   
Sbjct: 137 LAATFPIVGGFNVYMTRFVDPSFAFAVNLNYLILWIVSLPLELVAASITIRYWNREINSD 196

Query: 161 AWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIM-VCGAGKTGPVGFR 219
           AW+ I +V +   N+  VKF+ E EF ++ IK+LAIVGF I   ++ V G    G +G +
Sbjct: 197 AWVTIFFVFIALLNMMDVKFFSEAEFVMSIIKILAIVGFFILGIVLAVGGGPTGGYIGGK 256

Query: 220 YWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAI 279
           YW +PG +       D    RF G  S  + AAF+Y G E+  ++A E+ NPRKT+P+A 
Sbjct: 257 YWNDPGAF-----HGDSAGSRFKGLCSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPKAT 311

Query: 280 NKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSPFVIAIENSGTKVLPHIFN 337
            +                      ND +L S  S +  S+SP VIAIEN+G K LP + N
Sbjct: 312 KRTFWVITFSYISILTLIGILVPYNDKRLLSGSSSVDASASPLVIAIENAGIKGLPSLMN 371

Query: 338 AVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYL 397
           A+IL  ++S  NS VY+ SRV+ SM L    PK  +   K G P  ++  T  VG L+++
Sbjct: 372 AIILIALLSVANSCVYVCSRVMVSMALTNTLPKVFSKVDKRGRPLYSIFATLFVGLLSFI 431

Query: 398 ESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
            +S     VF WL  I  ++  F W+ I++AHIRF  ALK Q  S D+L + ++   WG+
Sbjct: 432 AASDKQEEVFTWLSAICGLSTIFCWIGINLAHIRFRAALKFQNRSLDELAYISQSGIWGS 491

Query: 458 YYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG----- 508
           +Y               +  P      +   FF  Y+S  +  A +IG +++ +      
Sbjct: 492 WYGVIILVLVLIASFWVSLFPVGESSADAEAFFEGYLSFPILIASYIGHKVYIKNWKWVI 551

Query: 509 PLFKKTEDIDLDTDRREIDNDVWE 532
           PL    E+ID+D  ++   N +W 
Sbjct: 552 PL----EEIDIDLGKK---NTIWN 568

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  278 bits (711), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 171/500 (34%), Positives = 260/500 (52%), Gaps = 17/500 (3%)

Query: 42  VKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEM 101
           +KR LK RH+ MIA+GG IGTGLF+     L+ AGP G LI +   GT+ Y +  ++GE+
Sbjct: 76  LKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAMGEL 135

Query: 102 ATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW-TDAVPLT 160
           A   P+   F  +  RF+  + G A   +Y L W +   LE+      + +W T      
Sbjct: 136 AVTFPIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYRD 195

Query: 161 AWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGF-R 219
            ++ + +VV+V+ N   VK YGE EF  + IKV+ ++G+II   I+VCG G  G     R
Sbjct: 196 GFVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGGR 255

Query: 220 YWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAI 279
            W NPG +  G          F G  S  ++AAF++ G+ELVG+ A E ANPRK++P A 
Sbjct: 256 LWHNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSLPSAA 305

Query: 280 NKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPHIFNA 338
            +V                        +L  + S   ++SPFVI+I+N+G K LP + N 
Sbjct: 306 KQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINV 365

Query: 339 VILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLE 398
           VIL  ++S GNS V+  SR + ++   G  PK   +  ++G P   ++ T + G L+++ 
Sbjct: 366 VILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLSFIA 425

Query: 399 SSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAY 458
           +S     VFDWLL ++ ++  F W  I + HIR  +AL  Q  +  +L F A    WG+ 
Sbjct: 426 ASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPTGVWGSV 485

Query: 459 YAAXXXXXXXXXXXXTAFAP---KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-PLFKKT 514
           Y               A  P   K + S FF AY+S  +  A +IG +IW +   LF + 
Sbjct: 486 YGFVLIILILMAQFWIALFPIGDKPSASAFFEAYLSFPILIAFYIGHKIWKKNWKLFIRA 545

Query: 515 EDIDLDTDRREIDNDVWEED 534
           ++ID+DT RRE D +  +++
Sbjct: 546 KNIDIDTGRRETDIEALKQE 565

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  277 bits (709), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 171/522 (32%), Positives = 261/522 (50%), Gaps = 26/522 (4%)

Query: 22  FSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGAL 81
           F R  D       GS   + +KR LK RH+ MIA+GG+IGTGLFI     L+  GP+  +
Sbjct: 43  FQRCVDSFKPPVDGSFDTSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVI 102

Query: 82  IAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFAL 141
           I +   G+        LGE+    PV  +F  ++ RFL P++      +Y + W     L
Sbjct: 103 IGWTIAGSQIVGTIHGLGEITVRFPVVGAFADYSTRFLDPSISFVVSTIYVIQWFFVLPL 162

Query: 142 ELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFII 201
           E+      IQ+W  ++    W+ I + V+VS NL   + +GE EF  + IK + I GFII
Sbjct: 163 EIIASAITIQYWNSSIDPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFII 222

Query: 202 YAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTEL 260
              +++CG G     +G +YW +PG    G          F G +S L+ A+++  GTE+
Sbjct: 223 LCIVLICGGGPDHEFIGAKYWHDPGALAHG----------FPGVLSVLVVASYSLGGTEM 272

Query: 261 VGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPF 320
             + +GE  +P K +P AI +V                      +  L    S + +SPF
Sbjct: 273 TCLASGE-TDP-KELPSAIKQVFWRILFFFLASLTLVGFLVPYTNENLLGGSS-VDNSPF 329

Query: 321 VIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGI 380
           VIAI+    K LP I NAVIL +I+S GNS ++ SSR L SM   GL P++  +  ++G 
Sbjct: 330 VIAIKLHHIKALPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGR 389

Query: 381 PYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQG 440
           P A ++T SL G LA+L  S   S VFDWL+ I  +A    W+ I+++HIRF  A+K Q 
Sbjct: 390 PLAGIVTNSLFGLLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQN 449

Query: 441 ISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSD-------FFTAYVSVI 493
            + D+L F +    WG+ Y+A             +  P    +D       FF +Y+  +
Sbjct: 450 KTLDELEFVSAVGIWGSAYSALINVLILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCAL 509

Query: 494 LFFAVWIGFQIWFRGPL-----FKKTEDIDLDTDRREIDNDV 530
           +   ++   ++++R         K  +DIDL+T R+ +D DV
Sbjct: 510 IMLLIFCIHKVYYRVSFGKWWDVKPLKDIDLETGRKNVDIDV 551

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  278 bits (710), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 168/530 (31%), Positives = 271/530 (51%), Gaps = 18/530 (3%)

Query: 22  FSRSKDVVSLESLGSVK----ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGP 77
           F R++D    +     K     + +K+A+K RH+ M+ +G  IGTGL ++ ++ LS  GP
Sbjct: 51  FKRAQDSTENDLEDGTKPLGDASHLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGP 110

Query: 78  VGALIAYMFIGTLAYMVSQSLGEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWS 136
              +I Y+ +  + Y + Q+ GEMA   P +  +F  +T  F+S   G A  +++F+ W 
Sbjct: 111 GSLVIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWL 170

Query: 137 ITFALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAI 196
             F LEL      I++W D +    +I+I +V L+  +   VK YGE EF     KVL I
Sbjct: 171 TVFPLELITASLTIKYWNDKINADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMI 230

Query: 197 VGFIIYAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY 255
            GFII + ++ CG AGK G +G +YWR+PG +  G    D  E +F G    L++A F+Y
Sbjct: 231 AGFIILSIVINCGGAGKDGYIGAKYWRDPGSFAEG----DSVE-KFKGICYILVTAYFSY 285

Query: 256 QGTELVGITAGEAANPRKTVPRAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY 314
            G EL  ++  E  NPRK+ P+A  + +                     ND  + S  S 
Sbjct: 286 GGAELFSLSVNEQENPRKSTPQAAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSGGSA 345

Query: 315 ISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTW 374
             +SP+V+A    G KV+PH  NAVIL ++IS  NS +Y S R++ S+   G APK+L +
Sbjct: 346 THASPYVLAASIHGVKVVPHFINAVILISVISVANSALYASPRLMCSLAEQGYAPKFLDY 405

Query: 375 TTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQ 434
             + G P  A++  ++ G + ++ +S     VF WL  I  ++  F W  I ++H+RF Q
Sbjct: 406 VDREGRPLRALILCAVFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQ 465

Query: 435 ALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAY 489
            +K  G S +++ F+A    WG+ Y               A AP     K +   FF +Y
Sbjct: 466 CMKLHGRSEEEIGFRAVTGIWGSMYGISFNMLVFIAQFWVALAPPSLHGKVDAESFFQSY 525

Query: 490 VSVILFFAVWIGFQIWFRGPLFKKTED-IDLDTDRREIDNDVWEEDEPKN 538
           ++  ++   + G+ ++ R   F    D IDL+  RR  D ++  +++ +N
Sbjct: 526 LAAPIWLFFYFGYMLYKRDFTFLVPLDKIDLNFHRRIYDPELIRQEDEEN 575

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  276 bits (707), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 171/503 (33%), Positives = 252/503 (50%), Gaps = 21/503 (4%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
            T VKRALK RHIS++ALGG IG G  +     LS  GP+  L+ +  IG +A+ V +S+
Sbjct: 41  NTGVKRALKNRHISLLALGGIIGPGCLVGAGNALSKGGPLSLLLGFGIIGIVAFAVMESI 100

Query: 99  GEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVP 158
           GEM T  P  S F   ++RF S AL A +GY Y + +    A E + +  ++QFW   VP
Sbjct: 101 GEMITLYPSGSGFSTLSRRFHSDALSAVSGYAYVVVFFAVLANEYNTLSSILQFWGPQVP 160

Query: 159 LTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPV-G 217
           L  +I+I  V      +  V  +GE E+W+A  K++ ++ + I++ I + G  K  P  G
Sbjct: 161 LYGYILIFSVAFQVFQMLGVGIFGEFEYWLAWFKIIGLIAYYIFSIIYISGGIKNRPAFG 220

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           F YW NPG    G          F G     +  +  Y GTE V + A E+ NP K VP 
Sbjct: 221 FHYWNNPGALADG----------FKGIAVVFVFCSSFYSGTESVALAATESRNPGKAVPI 270

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           AI +                      ND  L +    +  SP  IAI  +G +   H+ N
Sbjct: 271 AIKQTFWRIIIVYLGIAVFYGATVPYNDTSLGAHTKAL-KSPIAIAITRAGWEGGVHLVN 329

Query: 338 AVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYL 397
           A IL T +SA N  +YI SR L  +   GLAPK+L WT K G+P  A+   + +G ++ +
Sbjct: 330 AFILITCVSAINGSLYIGSRTLIYLAHEGLAPKFLKWTDKRGVPIPAITLFNALGLVSLM 389

Query: 398 ESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
             S GAS  + +++N++ V  F  W +IS+ H+RF +A   QG S  +LP+K+   PWG 
Sbjct: 390 NVSVGASNAYSYIVNLSGVGVFIVWGIISLTHLRFRKAWDLQGRSASELPYKSLLFPWGP 449

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYV----SVILFFAVWIGFQIWFRGPLFKK 513
            ++             T F P F+  DF  AY+    +VIL+  + +   +   G     
Sbjct: 450 IFSLAANIFLGLIQGWTTFVP-FSAKDFVDAYILLPAAVILYIVISL---VKIGGFKLVD 505

Query: 514 TEDIDLDTDRRE-IDNDVWEEDE 535
              +DL+  RRE +D+D  +ED 
Sbjct: 506 LRTVDLEEGRREDLDSDGTDEDS 528

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  276 bits (707), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 180/521 (34%), Positives = 275/521 (52%), Gaps = 26/521 (4%)

Query: 23  SRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALI 82
           S S  V  LE    ++E+ + R+L PRHI+MI++ G IGTGL++S +  L   GP    I
Sbjct: 39  SISDAVTDLEDHDKIRES-LNRSLSPRHINMISVAGVIGTGLYLSTAKSLHVGGPGSLFI 97

Query: 83  AYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALE 142
            Y  +G + Y+    LGEM+TF+P++ SF  + ++F   +   A    Y+ + +++ A +
Sbjct: 98  NYTIMGGVVYLTMLCLGEMSTFMPISGSFCSYAKKFGCESFAFALMCNYWFNDAVSVASD 157

Query: 143 LSVVGQVIQFWTDA---VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGF 199
           L+ +  V+ +W  +    P  A  ++ WV L+  N+  V+ YGE E+W+A +KV+AIV F
Sbjct: 158 LTALQLVLDYWKSSQHNFPYWAASLLFWVFLLGLNVIHVRVYGEAEYWLALLKVIAIVIF 217

Query: 200 IIYAFIMVCGAGKTGP-VGFRYWR-NPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQG 257
            I A ++  G       +GF+YW     P+  G          F G+V+  +S+AF+Y G
Sbjct: 218 FILAIVVNVGHNPDHEYIGFKYWSYKEAPFVNG----------FKGFVTIFVSSAFSYGG 267

Query: 258 TELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISS 317
           TE + +TAGEA NP +  PR +  V                     + P L ++   + +
Sbjct: 268 TESITLTAGEARNPIRNTPRIVKTVFWRILIFYVATMFFISMNIPYDYPNLSTKS--VMT 325

Query: 318 SPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLA-PKYLTWTT 376
           SPF I  + +GTK      NAVIL++I+SAGN  ++  SRVLY+MGL G   PK +T T 
Sbjct: 326 SPFTIIFQMAGTKAAGSFMNAVILTSIVSAGNHALFAGSRVLYNMGLEGFVFPKLITKTN 385

Query: 377 KSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQAL 436
           +   PY AV+ T  VG L +  S  GA  ++ WL NI  V+   AW+ I+V  IRF + L
Sbjct: 386 RYRAPYVAVILTWAVGGLCFGASFIGAGTLWTWLQNIVGVSNQVAWLSIAVTSIRFRKGL 445

Query: 437 KHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFF 496
             QG ++ +L FK    P+G Y+              +AF P ++ SDFF+ Y+ + +F 
Sbjct: 446 AQQGKTQ-ELQFKNWTYPYGPYFLVIFVTLIILVQGWSAFDP-WSTSDFFSYYLELFVFP 503

Query: 497 AVWIGFQIW--FRGPLFKKTEDIDLDTDRREIDNDVWEEDE 535
             W+   IW  F+   F K ED+D  TDR        EE+E
Sbjct: 504 TCWL---IWWIFKRDRFVKPEDMDFITDRYIQSPQEIEENE 541

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  280 bits (715), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 167/508 (32%), Positives = 265/508 (52%), Gaps = 16/508 (3%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           +  Q+K+ +KPRH+ M++LG  IGTGL +   TPL+ AGP   +I Y  +GT  Y + Q+
Sbjct: 146 ENAQLKQTIKPRHVIMMSLGTGIGTGLLVGNGTPLAQAGPAPLVIGYGIMGTCLYCIIQA 205

Query: 98  LGEMAT-FIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
            GE+A  +  V  SF  F    + P    A  ++Y + W     LEL      I++WT  
Sbjct: 206 CGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTK 265

Query: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGA-GKTGP 215
           V    +++I +V+++  N    K Y E EF+  C KV+ ++GF I A  +  GA G  G 
Sbjct: 266 VDPDVFVVIFYVLILLINFFGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGY 325

Query: 216 VGFRYWRNPGPW-GPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
           +G +YW +PG + G   I       RF G + + ++AAF +  TE + +TA E +NPRK 
Sbjct: 326 IGAKYWNDPGAFRGQTKIE------RFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKA 379

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVIAIENSGTKVLP 333
           +P A  KV                     N D  + S     S+SP+V+A    G  V+ 
Sbjct: 380 IPSAAKKVAYRILLIFLTSIILIGFLVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQ 439

Query: 334 HIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGF 393
           H  NAVIL +++S  NS  Y SSR+L  +   G APK+  +  ++G P  ++L  +++  
Sbjct: 440 HFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCAAIIAV 499

Query: 394 LAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFM 453
           +A+  +S   + VF WLL I+ ++  F W  I V+HIRF + ++ QG S  +L F+A+  
Sbjct: 500 IAFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTG 559

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG- 508
             G+YYAA             A  P      +  +FF  Y+++ +  A+++GF++W R  
Sbjct: 560 VLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDF 619

Query: 509 PLFKKTEDIDLDTDRREIDNDVW-EEDE 535
            LF + ++IDL + R   D ++  +EDE
Sbjct: 620 RLFIRAKNIDLISHRIIFDEELLRQEDE 647

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  276 bits (706), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 166/502 (33%), Positives = 254/502 (50%), Gaps = 21/502 (4%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
            + VKRALK RHIS++ALGG IG G  I     L+  GP+  L+ +  IG + + + +S+
Sbjct: 39  HSGVKRALKNRHISLLALGGIIGPGCLIGAGNALNKGGPLALLLGFGIIGLVCFSIMESI 98

Query: 99  GEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVP 158
           GE+ T  P    F+   +RF S  L A +GY Y + +    A E + +  ++QFW   VP
Sbjct: 99  GELVTLYPSGGGFITLARRFHSEGLSAVSGYAYIVVFFAVLANEYNTISSILQFWGPQVP 158

Query: 159 LTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGA--GKTGPV 216
           +  + +I W   +   L  V  +GE E+W+A  K+L +V F I++ + + G   GK  P+
Sbjct: 159 IYGYTLIFWFFFLVFQLIGVGAFGECEYWLAWFKILGLVAFYIFSIVYMSGGIPGKP-PI 217

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           GF+YW+NPG    G          F G     +  +  Y GTE V + A E+ NPRK VP
Sbjct: 218 GFQYWKNPGALSHG----------FRGIAVVFVFCSTFYSGTESVALAATESRNPRKAVP 267

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIF 336
            A+ +                      NDP L ++   +  SP  IA+  +G     H+ 
Sbjct: 268 LAVRQTFWRILIVYLGISFFYGVTVPYNDPTLGAQTKSL-KSPISIALSRAGWAGGVHLV 326

Query: 337 NAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAY 396
           NA IL T ISA NS +YI SR L  +   GLAP+ L WT K G+P  A++  + +G ++ 
Sbjct: 327 NAFILMTCISAINSSLYIGSRTLSHLAHEGLAPRILAWTDKRGVPVPALIVFNALGLISL 386

Query: 397 LESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWG 456
           +  S GAS  +++++N++ V  F  W  IS+ H+RF +A   QG S  +LP++A F PW 
Sbjct: 387 MNVSVGASNAYNYIVNLSGVGVFIVWSAISITHLRFRKAWVAQGRSLSELPYRALFYPWT 446

Query: 457 AYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFK--KT 514
             ++             T+  P F   DF  AY+ +     +++G   W +   FK    
Sbjct: 447 TIFSLAANIFLALIQGWTSLVP-FVAKDFVDAYILLPAAGLLYVGINFW-KNRNFKTVNI 504

Query: 515 EDIDLDT-DRREIDNDVWEEDE 535
             I+L+   RR++D D   +DE
Sbjct: 505 HGINLEEGQRRDLDED--SDDE 524

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  277 bits (709), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 166/513 (32%), Positives = 260/513 (50%), Gaps = 26/513 (5%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           GS     +K++LK RH+ MIA+GG+IGTGLFI     L+  GP+  +I +   G+     
Sbjct: 71  GSFHTGNLKKSLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAVAGSQIVGT 130

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
              LGE+    PV  +F  +T RFL P++      +Y L W     LE+      +Q+W 
Sbjct: 131 IHGLGEITVRFPVVGAFASYTTRFLDPSISFVVSTIYVLQWFFVLPLEIIASAITVQYWN 190

Query: 155 DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
           D++    ++ I + V+VS NL   + +GE EF  + +K++ I GFII   +++ G G   
Sbjct: 191 DSIDPVVFVAIFYCVIVSINLFGARGFGEAEFIFSTVKIITICGFIILCIVLIAGGGPDH 250

Query: 215 P-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
             +G +YW NPG    G          F G +S L+ A+++  GTE+  + +GE  +P K
Sbjct: 251 EYIGAKYWHNPGSLAHG----------FKGVLSVLVVASYSLGGTEMTCLASGE-TDP-K 298

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
            +P AI +V                      +P L    S + +SPFVIAI+    KVLP
Sbjct: 299 ELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNPNLLGGSS-VDNSPFVIAIKIHNIKVLP 357

Query: 334 HIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGF 393
            I NAVIL +I+S GNS ++ SSR L SM    L P +  +  ++G P   ++  SL G 
Sbjct: 358 SIVNAVILVSILSVGNSCIFASSRTLCSMAHQHLIPWWFGYIDRAGRPLTGIIINSLFGL 417

Query: 394 LAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFM 453
           LA+L  S   + VFDWL+ I  +A    W+ I++ H+RF  A+K Q  + D+L F +   
Sbjct: 418 LAFLVKSSSVTEVFDWLMAIAGLATCIVWLSINICHVRFRLAMKAQNRTLDELEFVSAVG 477

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAPKFNVSD-------FFTAYVSVILFFAVWIGFQIWF 506
            WG+ Y+              A  P    +D       FF  Y+  ++   ++IG +I++
Sbjct: 478 IWGSVYSGIVNALILVAQFYIALWPIGGWTDSGTRAKKFFQNYLCALILIVLFIGHKIYY 537

Query: 507 RGPL-----FKKTEDIDLDTDRREIDNDVWEED 534
           R        +   +DIDLDTDR+ +D ++ +++
Sbjct: 538 RVTTGHWWEYIALKDIDLDTDRKNVDIEIIKQE 570

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  278 bits (711), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 160/515 (31%), Positives = 267/515 (51%), Gaps = 14/515 (2%)

Query: 32  ESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLA 91
           +SL   K   +KR +KPRH+ M++L   IGTGL +     L+  GP G  I Y  +G+  
Sbjct: 92  QSLLPEKGASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCL 151

Query: 92  YMVSQSLGEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVI 150
           Y + Q+ GE+A   P +T +F  +    + PA+  A   +Y + W   F LE+      I
Sbjct: 152 YSIIQAAGELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITI 211

Query: 151 QFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG- 209
           ++W  ++    W +I +V+++  N+     Y E +F+    K+L   GF I   I+ CG 
Sbjct: 212 KYWNTSINPNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGG 271

Query: 210 AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAA 269
           AG +  +G +YW +PG +     + D    RF   VS+L++AAF +  +E V +TA E A
Sbjct: 272 AGDSVYIGGKYWNDPGAF-----NGDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQA 326

Query: 270 NPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIAIENSG 328
           NPRK +P A  +V                     N P+L  S  S + SSP+VIA+ + G
Sbjct: 327 NPRKAIPSAAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAVASHG 386

Query: 329 TKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTT 388
            KV+P   NAVIL +++S GN   Y SSR+L  +   G APK+  +  + G P  A++  
Sbjct: 387 VKVVPSFINAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVG 446

Query: 389 SLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPF 448
           +LVG + ++ +S     VF WL+ ++ ++  F W  I ++H+RF +A++ Q  S  +L F
Sbjct: 447 ALVGCICFVSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGF 506

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILFFAVWIGFQ 503
           +++   WG+YY               A  P       +  +FF  Y+++ +F A++ GF+
Sbjct: 507 RSQVGVWGSYYGIFMMILVFIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFGFK 566

Query: 504 IWFRG-PLFKKTEDIDLDTDRREIDNDVWEEDEPK 537
           IW +   L+    +IDL + R+  D ++ ++++ +
Sbjct: 567 IWKKDWRLYIPASEIDLISHRKIFDEEILKQEDEE 601

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  275 bits (704), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 179/546 (32%), Positives = 272/546 (49%), Gaps = 29/546 (5%)

Query: 22  FSRSKDVVSLESLGSVKETQ-------VKRALKPRHISMIALGGTIGTGLFISISTPLSN 74
           FS   DV+     GS  + +       + R LK RHI +IALG  IGTGLFI     LS 
Sbjct: 28  FSSVNDVIGDSDQGSYSDIENFKPPQKIVRGLKTRHIQLIALGSAIGTGLFIGSGGALSV 87

Query: 75  AGPVGALIAYMFIGTLAYMVSQSLGEMATFIPV--TSSFMVFTQRFLSPALGAANGYMYF 132
            GP   LIAY+ I    + +   + EM   IP+   +S     + +L+  +    G+  F
Sbjct: 88  CGPAPLLIAYIIISFFVWSIMNQMTEMVCLIPLPGEASLYSLAKTYLNSPISFMCGWNLF 147

Query: 133 LSWSITFALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIK 192
            + ++    E++    ++Q+WTDA     +I I  VV +   + PVK +GE EFW++ IK
Sbjct: 148 YAMAMIVPAEITACALLVQYWTDANS-AIFISIFIVVSILLTMLPVKVFGESEFWVSSIK 206

Query: 193 VLAIVGFIIYAFIMVCGAG--KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLIS 250
           +L IVG II   ++  G G  +   +GF YW+NPG + P +   + N GRFL   +++I 
Sbjct: 207 ILTIVGLIIVGIVIFFGGGPAQDHVLGFHYWKNPGAFNPHL--AEGNTGRFLAVWTAIIK 264

Query: 251 AAFTYQGT-ELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL- 308
           + F++    E V   + E   PR+ +P+A  +                      N+ +L 
Sbjct: 265 SGFSFVLVPETVTSCSAECIAPRRNMPKACQRFIYRLAIFYIVGTLVVGVIVGFNNDRLI 324

Query: 309 ---KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLN 365
              +S  S  ++SPFVI I+ +G K+LPHI NA IL++  S G   +Y SSR LYSM L 
Sbjct: 325 NAIQSGKSDAAASPFVIGIQEAGIKILPHIINACILTSAYSCGTGLLYGSSRTLYSMALR 384

Query: 366 GLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLI 425
           G APK      + G PY +    SL  FLAYL  S  ASVVF+WL NI  ++GF +W+ +
Sbjct: 385 GDAPKIFAKVNRFGTPYYSTGLASLFSFLAYLNCSKSASVVFNWLSNIATISGFVSWIFV 444

Query: 426 SVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-KFNVSD 484
           S+ +IRF + +    ++ D +PF+  F    AY                 F    +NVSD
Sbjct: 445 SMTYIRFRKVINALDLN-DRVPFRRPFQVPLAYLTCGFFFILSLTNGYAVFVKGNWNVSD 503

Query: 485 FFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDID------LDTDRREIDNDVWEEDEPKN 538
           FF +YV++     +++    +++   F+  ++I+      +D    E  NDV     P+N
Sbjct: 504 FFASYVTIGFVIFLYLVGSFYYKQWTFRDFKEIEVEILPKIDIADEEERNDVIP--VPRN 561

Query: 539 LWEKFW 544
             EK W
Sbjct: 562 FMEKVW 567

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  275 bits (703), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 177/528 (33%), Positives = 281/528 (53%), Gaps = 14/528 (2%)

Query: 25  SKDVVSLESLG-SVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIA 83
           ++ + SLE    S++E   +R L PR +SMI +GG IGT LF+SI T + + GP   LIA
Sbjct: 27  AETIRSLEGQAPSLEERIARRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIA 86

Query: 84  YMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALEL 143
           +     +   +SQ +  M T++PVT SF+ FT+RF+  + G + G+ YF+  +     E+
Sbjct: 87  FCLWSVVFIGLSQCMCVMVTYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEI 146

Query: 144 SVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYA 203
           + V  V++FWTD +P  A I IL  +  S NL  V  +GE EF+++  KV+  +G I + 
Sbjct: 147 TAVCLVVEFWTDKIPKAALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFT 206

Query: 204 FIMVCGAGKTGPV-GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVG 262
            +++ G      V GF+ W NPG +    ISK  + G+F G++S LI A + + G + +G
Sbjct: 207 IVVMAGGNPQHKVLGFKNWSNPGAFAE-YISKG-SAGKFHGFMSCLIFALYVFWGVDYLG 264

Query: 263 ITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDP---KLKSEDSY-ISSS 318
             A EA NPRK +P +  KV                     ND    K  SE +    +S
Sbjct: 265 NAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGAS 324

Query: 319 PFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKS 378
           P+V A++  G  VLPHI N +IL++IISAGNS +Y +SRVL+ + L G APK L   TK 
Sbjct: 325 PYVSAMKTLGIGVLPHIVNVLILTSIISAGNSSLYSASRVLHRLALEGQAPK-LFKITKR 383

Query: 379 GIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKH 438
           G+P    +   LV  LAYL  S+  + V  W LN+   A    ++ I +++++F +  K 
Sbjct: 384 GVPIYCCVAVLLVCGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKA 443

Query: 439 QGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFNVSDFFTAYVSVILFFA 497
           Q I    LP+ + F+P+  +++               F    +++  F  +Y  +  F  
Sbjct: 444 QNIDLKTLPYSSSFLPYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIV 503

Query: 498 VWIGFQIWFRGPLFKKTEDIDLDTDRREI--DNDVWEEDEPK-NLWEK 542
           ++ G +++ +   F K  ++DL +   E+  ++  WEE+ PK NL +K
Sbjct: 504 LFAGHKLY-KKTRFVKPVEMDLFSGIAELAEEDAYWEENPPKMNLLDK 550

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  276 bits (706), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 162/509 (31%), Positives = 262/509 (51%), Gaps = 14/509 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
              +K+++K RH+ M++LG  IGTGL ++ +  LS AGP   +I Y+ +  + Y + Q+ 
Sbjct: 83  NNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAA 142

Query: 99  GEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           GEM    P +  +F  +   F+S + G A  +++ + W     LEL      +++W D +
Sbjct: 143 GEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTI 202

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPV 216
               +I+I +V L+  +   VK YGE EF     K+L + GFII + ++ CG AG  G +
Sbjct: 203 NADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYI 262

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           G +YWR+PG +  G         RF G    L+SA F++ G EL  ++  E +NPRK+ P
Sbjct: 263 GGKYWRDPGSFAEG-----SGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTP 317

Query: 277 RAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHI 335
            A  + V                     ND  + S  S   +SP+V+A      +V+PHI
Sbjct: 318 VAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHI 377

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            NAVIL ++IS  NS +Y + R++ S+   G APK+L +  + G P  A++  SLVG + 
Sbjct: 378 INAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSLVGVVG 437

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++  S      F WL  I  ++  F W  I ++HIRF +A+K QG S D++ +KA    W
Sbjct: 438 FVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIW 497

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILFFAVWIGFQIWFRGPL 510
           G+YY               A +P     K +   FF +Y++  L+  +++G+ ++ R   
Sbjct: 498 GSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFT 557

Query: 511 FKKTED-IDLDTDRREIDNDVWEEDEPKN 538
           F    D IDLD  RR  D ++  +++ +N
Sbjct: 558 FLNPLDKIDLDFHRRVYDPEIMRQEDEEN 586

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  276 bits (707), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 166/524 (31%), Positives = 265/524 (50%), Gaps = 16/524 (3%)

Query: 25  SKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAY 84
           S D   LE   +  + Q K+ +K RH+ M++LG  IGTGL +S    LS AGP   +IAY
Sbjct: 77  SPDHNDLEKTTTAHQEQ-KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAY 135

Query: 85  MFIGTLAYMVSQSLGEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALEL 143
             +  + Y + Q+ GEMA   P +  SF  +T  F+S   G A  +++ + W     LEL
Sbjct: 136 GLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLEL 195

Query: 144 SVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYA 203
                 I++W  ++    ++II +V L+  +   V+ YGE EF     K+L I GFII+A
Sbjct: 196 ITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFA 255

Query: 204 FIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVG 262
            ++ CG AGK G +G +YW +PG +     +      RF G   +L++A F+Y G EL  
Sbjct: 256 IVVNCGGAGKDGYIGGKYWHDPGAF-----ASSNGASRFKGICYNLVNAYFSYGGNELFV 310

Query: 263 ITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL--KSEDSYISSSPF 320
           ++  +  NPRK+ P A                         N  +L   S  + + +SP+
Sbjct: 311 LSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPY 370

Query: 321 VIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGI 380
           V+A    G KV+PHI NAVIL  +IS  NS +Y   R+L S+   G AP++L++  + G 
Sbjct: 371 VLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGR 430

Query: 381 PYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQG 440
           P  A+L ++LVG + +  +S     VF WL  I+ ++  F W  I  +HIRF +A+K Q 
Sbjct: 431 PLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQN 490

Query: 441 ISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILF 495
            S D L +KA    WG+Y+               A +P     K + + FF +Y+++ ++
Sbjct: 491 KSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIW 550

Query: 496 FAVWIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWEEDEPKN 538
              + G+  W++   +      +DLD  R+  D +   +++ +N
Sbjct: 551 LVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLEN 594

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  275 bits (702), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 164/510 (32%), Positives = 258/510 (50%), Gaps = 21/510 (4%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
            E  + +A++ RH+ MI+LG  IGTGL +   + LS +GP+G +I Y+    + +++ Q+
Sbjct: 80  DENDLNKAIRSRHLIMISLGTGIGTGLLVGTGSVLSQSGPLGLIIGYIVSSLMVFLIIQA 139

Query: 98  LGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
            GE+   +  V  +F  +    + PA G A  ++Y + W I   L+L      IQFW   
Sbjct: 140 AGELGIVYSNVVGNFTRYPTILVDPAFGFAISFLYTIQWMIVLPLQLVTAAMTIQFWNVG 199

Query: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPV 216
           V L  +++  +VV+V  NL   + Y E EF+    K++ + GF+I   I+  G    GP 
Sbjct: 200 VNLDVFVLASFVVVVLINLGGARGYVEAEFFCNLCKIVMLTGFVILGIIITAGGIPNGPD 259

Query: 217 GF---RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
           G+   +YWRNPG +  G          F G  S    AAF+Y G E + ++A E  NP K
Sbjct: 260 GYIGGKYWRNPGLFANG----------FKGVCSVFCYAAFSYGGVETLVLSAAEQKNPLK 309

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIAIENSGTKVL 332
           ++P A  KV                       P L  S  S   SSPFVIAI + G  V+
Sbjct: 310 SIPSATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMGSSGSGSHSSPFVIAIASHGVSVV 369

Query: 333 PHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVG 392
           PH+ NAVIL +++S  NS +Y++ R+L S+   G APK+L +  K G P    L   L G
Sbjct: 370 PHLINAVILISVLSVANSALYVAPRLLLSLAQGGSAPKFLNYIDKRGRPTTCTLVVVLFG 429

Query: 393 FLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKF 452
            + ++ +S    VVF WLL+I+ +   F W+ I V+HIRF  A++ QG    ++ +KA+ 
Sbjct: 430 MIGFVAASDKREVVFTWLLSISGLGQIFIWISICVSHIRFRDAMRVQGHPLTEIAYKAQT 489

Query: 453 MPWGAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILFFAVWIGFQIWFR 507
             WG+Y A              A AP     K + ++FF  Y++  +    ++GF+++++
Sbjct: 490 GYWGSYVAIALALFVLVCQFWVAIAPVGAHGKLDATNFFQNYLAFPVVLCAYLGFKVYYK 549

Query: 508 G-PLFKKTEDIDLDTDRREIDNDVWEEDEP 536
              L    + I+LD +R     +   ED+P
Sbjct: 550 QWQLLIPADKIELDNNRNVYVPEEALEDKP 579

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  276 bits (705), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 170/511 (33%), Positives = 270/511 (52%), Gaps = 25/511 (4%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
           E  +K+ +KPRH+ MI+LG  IGTGL +   + L  AGP G +  Y  +GT  Y + QS 
Sbjct: 107 EDNLKQTIKPRHVIMISLGTGIGTGLLVGNGSALVKAGPAGLVTGYAIMGTCVYCIIQSA 166

Query: 99  GEMAT-FIPVTSSFMVFTQRFLSPA------LGAANGYMYFLSWSITFALELSVVGQVIQ 151
           GEMA  +  +   F  +    + P       LG     +  LS+ I +  +        +
Sbjct: 167 GEMAVVYSKLNGGFNAYPTMLVEPGFWVCCRLGVLFTMVDCLSFGIGYCFD------DYK 220

Query: 152 FWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIM-VCGA 210
           +WT  V    +++I +V+++  N+   + Y E EF+  C KVL + GF I   I+ V GA
Sbjct: 221 YWTTRVDPDVFVVIFYVLIIVINVFGARGYAEAEFFFNCCKVLMMAGFFILGIIINVGGA 280

Query: 211 GKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAAN 270
           G  G +G  YWRNPG +       D     F G V++L++AAF + GTE + +TA E +N
Sbjct: 281 GNDGYLGNIYWRNPGAF-----RGDKGIDHFKGVVATLVTAAFAFGGTEFIALTAAEQSN 335

Query: 271 PRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIAIENSGT 329
           PRK +P A  KV                       P+L  S  +  ++SP+VIA+ + G 
Sbjct: 336 PRKAIPSAAKKVLYRIVLVYLTSIILIGFLVPFTSPELLGSGSAATAASPYVIAVASHGV 395

Query: 330 KVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTS 389
           +V+PH  NAVIL +++S GNS  Y SSR+L S+   G APK+  +  + G P  A++ ++
Sbjct: 396 RVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSKQGYAPKWFDYVDREGRPSRAMIVSA 455

Query: 390 LVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFK 449
           L G +A+  +S   + VF WLL I+ ++  F W+ I ++HIRF  A+K QG S  ++ FK
Sbjct: 456 LFGVIAFCATSPKETEVFTWLLAISGLSQIFTWISICLSHIRFRAAMKAQGRSMGEVGFK 515

Query: 450 AKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIW 505
           A+   WG+YY+              A AP    + +  +FF  Y+++ +    + G++IW
Sbjct: 516 AQTGIWGSYYSIFLMILTLIGQFWVAIAPIGTAELSARNFFENYLAMPILIGFYFGYKIW 575

Query: 506 FRG-PLFKKTEDIDLDTDRREIDNDVWEEDE 535
            +   L+ K EDIDL + R+  D ++ ++++
Sbjct: 576 KKDWTLYIKAEDIDLISHRQIFDEELLKQED 606

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  276 bits (705), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 167/525 (31%), Positives = 275/525 (52%), Gaps = 12/525 (2%)

Query: 24  RSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIA 83
           +++D    +SL S++E   +R L PR +SMI +GG IGT LF+SI T +   GP   LIA
Sbjct: 100 QNRDSPKSQSL-SLEERIARRKLLPRQVSMIGIGGAIGTALFVSIGTKIIQGGPGSLLIA 158

Query: 84  YMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALEL 143
           +     +   +S+ +  M T++PVT SF+ FT+RF+  + G A G+ YF+  +     E+
Sbjct: 159 FCLWSVVFIGLSKCMCVMVTYLPVTGSFVHFTERFVDQSCGFAVGWTYFVCQAANVCFEI 218

Query: 144 SVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYA 203
           + V  V+++WTD +P  A I +L ++  S NL  V F+GE EF+++  KV+  +G II+ 
Sbjct: 219 TAVCLVVEYWTDKIPKAALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFT 278

Query: 204 FIMVCGAGKTGPV-GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVG 262
            +++ G      V GF+ W NPG +   I   D + GRF G++S L+ A + + G + +G
Sbjct: 279 VVVMAGGNPQHTVLGFKNWSNPGAFAEYI--SDGSVGRFHGFMSCLVFALYVFWGVDYLG 336

Query: 263 ITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL----KSEDSYISSS 318
             A EA NPRK +P +  KV                     NDP +    K       +S
Sbjct: 337 NAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIKEGAVGAGAS 396

Query: 319 PFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKS 378
           P+V A++  G +VLPHI N +IL++IISAGNS +Y +SRVL+ + L+  AP+    TTK 
Sbjct: 397 PYVSAMKTLGIRVLPHIVNILILTSIISAGNSSLYSASRVLHRLALDNQAPRIFKVTTKK 456

Query: 379 GIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKH 438
           G+P    +   ++  LAYL  S+  + V  W LN+   A    ++ I V++++F +    
Sbjct: 457 GVPVYCCIAVLVICGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICVSYLQFRKGCLA 516

Query: 439 QGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-KFNVSDFFTAYVSVILFFA 497
           Q +    LP+ +  +P+ A+++             T F    ++   F  +Y  +  F  
Sbjct: 517 QNVDLKSLPYYSSSLPYLAWHSLFWLVLMLLVNGYTVFLKGSWDTQSFVFSYFMIPFFLV 576

Query: 498 VWIGFQIWFRGPLFKKTEDIDLDTDRREI--DNDVWEEDEPKNLW 540
              G ++ ++G    +  ++DL T   E+  ++  W E+ P   W
Sbjct: 577 FLFGHKL-YKGTKSVRPLEMDLFTGIEELADEDRYWAENPPTLNW 620

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  275 bits (702), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 169/513 (32%), Positives = 256/513 (49%), Gaps = 26/513 (5%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           GS     +K++LK RH+ MIA+GG+IGTGLFI     L+  GP+  +I +   GT     
Sbjct: 66  GSFHSDNLKKSLKARHLIMIAIGGSIGTGLFIGSGKALAVGGPLALIIGWTVAGTQMVGT 125

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
              LGE+    PV  +F  +  RFL P++      +Y L W     LE+      +++W 
Sbjct: 126 IHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWG 185

Query: 155 DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KT 213
            +VP  AW+ I +  +   NL  V+ +GE EF  + IKVL I+GFII   +++CG G K 
Sbjct: 186 SSVPPVAWVAIFYAFIALVNLLGVRGFGEAEFIFSLIKVLTIIGFIILCVVLICGGGPKH 245

Query: 214 GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
             VG +YW +PGP   G          F G  +  + A+++  GTE+  + +GE  +P K
Sbjct: 246 EFVGAKYWSDPGPLANG----------FKGVAAVFVIASYSLGGTEMACLASGE-TDP-K 293

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
            +P AI +V                      +  L    S + +SPFVIAI   G K LP
Sbjct: 294 ELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLMGGSS-VDNSPFVIAIRLHGIKALP 352

Query: 334 HIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGF 393
            + NAVIL +++S GNS ++ SSR L SM   GL P+   +  ++G P   +LT    G 
Sbjct: 353 SVVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRIFGYIDRAGRPLVGILTNLAFGL 412

Query: 394 LAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFM 453
           LA+L  S  +  VF WL+ I  +A    W+ I+V+HIRF  A+K QG+S D+L F +   
Sbjct: 413 LAFLVKSSSSDDVFTWLMAIAGLATCVVWLSINVSHIRFRMAMKAQGVSLDELEFVSAVG 472

Query: 454 PWGAYYAAXXXXXXXXXXXXTAF-------APKFNVSDFFTAYVSVILFFAVWIGFQIWF 506
            +G+ Y+A             +        +P     +FF  Y+  ++   ++ G +I++
Sbjct: 473 VYGSVYSATINVLILVAQFYVSLWPVGGWSSPSTRTENFFQNYLCSLILLLLFAGHKIYY 532

Query: 507 RGPL-----FKKTEDIDLDTDRREIDNDVWEED 534
           R        FK   DIDL TD R  D ++ + +
Sbjct: 533 RISTGKWWGFKALRDIDLLTDMRVTDTELSKHE 565

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  275 bits (702), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 163/508 (32%), Positives = 266/508 (52%), Gaps = 18/508 (3%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
           + ++K+ +K RHI+MI+LG  IGTGL ++    L   GP G +I Y+   T+ Y V Q+ 
Sbjct: 73  QKKMKQTMKSRHITMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVTTSTMLYCVIQAC 132

Query: 99  GEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
            E+  ++  +  ++  +    +      A  ++Y L W+I   LEL      I++W D++
Sbjct: 133 CELGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSSMTIKYWNDSI 192

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
               ++ I +  +V  +    + Y E EF     KVL +VGFII    + CGA K+G +G
Sbjct: 193 NPDVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISVNCGASKSGYIG 252

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
            +YW  PG +   +  K ++   F G  S  + +AF Y G+E + +TA E  NPRK+VP+
Sbjct: 253 GKYWHTPGAF---VGEKAIDH--FKGICSVWVQSAFAYGGSEFIALTAAEQTNPRKSVPK 307

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISS--SPFVIAIENSGTKVLPHI 335
           A  +                      + P L       +S  SPFVIA  + G KV+PHI
Sbjct: 308 ATKRWLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQAASHASPFVIAAASHGVKVVPHI 367

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            NAVIL ++IS GNS  Y + R+L S+   G+ PK  T+  + G P   +L  ++ G ++
Sbjct: 368 INAVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLVTMLFVAIFGLIS 427

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++ +S     VF WL  I +++  F W  IS++HIRF  A+K QG S  +L +KA    W
Sbjct: 428 FVAASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSLGELGYKANTGYW 487

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVS--VILFFAVWIGFQIWFRG 508
           G++YA              A AP     K +V++FF  Y++  V++FF  + G+++W+R 
Sbjct: 488 GSWYAIAFNIIVLAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVFF--YFGYKLWYRD 545

Query: 509 -PLFKKTEDIDLDTDRREIDNDVWEEDE 535
             LF   + +DL++ R+  D D+ ++++
Sbjct: 546 WKLFIPADKVDLESHRKIFDADLIKQED 573

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  274 bits (700), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 166/526 (31%), Positives = 267/526 (50%), Gaps = 29/526 (5%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           GS     +KR LK RH+ MIA+GG+IGTGLFI     L+  GP+  LI +   GT     
Sbjct: 61  GSFDPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVGT 120

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
              LGE+    PV  +F  ++ RFL P++      +Y L W     LE+      ++FWT
Sbjct: 121 IHGLGEVTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFWT 180

Query: 155 DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
            +V    W+ + + +++S NL  V+++G+ +F  + IK++ I GFII   +++ G G T 
Sbjct: 181 TSVDPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPTH 240

Query: 215 P-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
             +G RYW +PG    G          F G  + +++A+++  G+E+  + +GE  +P K
Sbjct: 241 EFIGARYWHDPGALANG----------FKGVAAVMVTASYSLGGSEMTCLASGE-TDP-K 288

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
            +P AI ++                      + +L    S +++SPFVIAI+    +VLP
Sbjct: 289 EIPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLG-GSNVNNSPFVIAIKMHNIRVLP 347

Query: 334 HIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGF 393
           HI N VIL +I+S GNS ++ SSR L SM   GL P+   +  ++G P   +LT SL G 
Sbjct: 348 HIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNSLFGL 407

Query: 394 LAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFM 453
           LA+L  S     VF WL+ +  +A    W+ I+V+HIRF  A+K QG S D+L F +   
Sbjct: 408 LAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEFVSAVG 467

Query: 454 PWGAYYAAXXXXXXXXXXXXTAF-------APKFNVSDFFTAYVSVILFFAVWIGFQIWF 506
            WG+ Y+              +         P+     FF  Y+  ++   +++  +I++
Sbjct: 468 MWGSVYSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILLFMFVAHKIYY 527

Query: 507 R---GPLFK--KTEDIDLDTDRREIDNDVWEED---EPKNLWEKFW 544
           R   G  +K     +IDL++ R+ ID +V + +     K + E+ W
Sbjct: 528 RSTTGQWWKILPLAEIDLESGRKNIDIEVVKHEVAARKKYISEQRW 573

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  274 bits (701), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 161/513 (31%), Positives = 270/513 (52%), Gaps = 17/513 (3%)

Query: 37  VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQ 96
           + + +++R+++PRH++M+++   IGTGL ++    L   GP G +I Y  +  +AY++ Q
Sbjct: 74  LTDGRLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGLIIGYAAVSVVAYIMMQ 133

Query: 97  SLGEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTD 155
           + GEMA   P +  +F  ++  F+S   G A+ ++Y L W   F LEL      I++WTD
Sbjct: 134 AAGEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVFPLELITASLTIKYWTD 193

Query: 156 AVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTG 214
           +V    +I I +V ++  +    + YGE EF     KVL I GF+I A ++ CG AG +G
Sbjct: 194 SVNADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIAGFVILAIVINCGGAGNSG 253

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
            +G RYW +PG +  G  +      +F G+   L++  F+Y GTEL  +T  E ++PR+ 
Sbjct: 254 YIGARYWHDPGAFAVGDPAS-----KFKGFCYVLVTGYFSYGGTELYAMTVNEQSSPRRA 308

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSE--DSYISSSPFVIAIENSGTKVL 332
           +  A  +                         +L      S   +SP+V+A+   G KV+
Sbjct: 309 IHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGKSATHASPYVLAVSLHGVKVV 368

Query: 333 PHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVG 392
           PHI NAVIL  ++S GNS +Y   RVL ++   G APK+L +  ++G P  A++  S++G
Sbjct: 369 PHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLAYIDRAGRPLMALIACSVIG 428

Query: 393 FLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKF 452
            LA++ +S     VF WL  I  ++  F W  I ++HIRF QA+K+ G S   L +K+  
Sbjct: 429 LLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFRQAMKYHGYSLSQLGYKSIT 488

Query: 453 MPWGAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILFFAVWIGFQIWFR 507
             WG+ Y               A AP     K +V  FF +Y++  L+F  ++G+ + + 
Sbjct: 489 GLWGSIYGVCFNILVFVAQFWVALAPIGNNGKTDVLSFFQSYLAFPLWFVFFLGYMV-YS 547

Query: 508 GP--LFKKTEDIDLDTDRREIDNDVWEEDEPKN 538
           G   + +  +DID++  R   D +  E+++ ++
Sbjct: 548 GEWMILRPLKDIDINHFRCVYDEERIEQEKLEH 580

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  274 bits (700), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 169/526 (32%), Positives = 263/526 (50%), Gaps = 26/526 (4%)

Query: 22  FSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGAL 81
           F R  D       GS   + +KR LKPRH+ MIA+GG+IGTGLF+     ++  GP+G +
Sbjct: 58  FQRCVDSFKPPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVV 117

Query: 82  IAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFAL 141
           + +   G+        LGE+    PV  +F  +  RFL P++      +Y L W     L
Sbjct: 118 LGWTIAGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPL 177

Query: 142 ELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFII 201
           E+      +Q+W  ++    W+ I +V++VS NL  V+ +GE EF  + IK + + GFII
Sbjct: 178 EIIAAAMTVQYWNSSIDPVVWVAIFYVIIVSINLFGVRGFGEAEFAFSTIKAITVCGFII 237

Query: 202 YAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTEL 260
              +++ G G     VG +YW +PG    G          F G +S L+ A+++  G E+
Sbjct: 238 LCIVLIFGGGPDHEYVGAKYWYDPGCLANG----------FPGILSVLVVASYSLGGIEM 287

Query: 261 VGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPF 320
             + +GE  +P K +P AI +V                      +  L    S + +SPF
Sbjct: 288 TCLASGE-TDP-KGLPSAIKQVFWRILFFFLVSLTLVGFLVPYTNQNLLGGSS-VDNSPF 344

Query: 321 VIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGI 380
           VIAI+    KVLP I N VIL +++S GNS ++ SSR L SM   GL P +  +  ++G 
Sbjct: 345 VIAIKLHHIKVLPSIVNVVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGR 404

Query: 381 PYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQG 440
           P   ++  SL G LA+L  S     VF+WL+ I  +A    W+ I+V+HIRF  A+K QG
Sbjct: 405 PLVGIMANSLFGLLAFLVKSGSMGDVFNWLMAIAGLATCIVWLSINVSHIRFRMAMKAQG 464

Query: 441 ISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPK---FNVSD----FFTAYVSVI 493
              D+L F +    WG+ Y+A             +  P     N SD    FF  Y+  +
Sbjct: 465 KKLDELEFVSAVGIWGSAYSALINCLILLAQFYCSLWPIGGWKNSSDRAKIFFQNYLCAL 524

Query: 494 LFFAVWIGFQIWFRGPL-----FKKTEDIDLDTDRREIDNDVWEED 534
           +   ++I  +I+++         K  +DIDL+TDR+ ID ++ +++
Sbjct: 525 IVLFIFIAHKIYYKCQTGQWWGIKALKDIDLETDRKNIDIEIVKQE 570

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  275 bits (704), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 167/531 (31%), Positives = 271/531 (51%), Gaps = 22/531 (4%)

Query: 23  SRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALI 82
           +R KD  +L +      T + + L  RH+  +A+GG IGTGLF++  + L+  GP   +I
Sbjct: 128 ARDKDEETLLA------TDMNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVI 181

Query: 83  AYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALE 142
            ++ + T  + V  SLGE+A   PV   F V+  +F+ P+   A    Y L W +   LE
Sbjct: 182 GWVIVSTALFTVINSLGELAAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLE 241

Query: 143 LSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIY 202
           L      I++W  ++   AW+ I +V +  AN+  VK +GE EF ++ +K+LAI+GF I 
Sbjct: 242 LVAASITIRYWNSSINSDAWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFIL 301

Query: 203 AFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELV 261
             ++ CG G +   +G +YW +PG +  G  S      +F G  S  ++AAF++ G E+ 
Sbjct: 302 GIVLDCGGGPSHEYIGGKYWHDPGAF-VGTTSG----SKFKGLCSVFVTAAFSFSGIEMT 356

Query: 262 GITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYI--SSSP 319
            ++A E+ NPR+T+P+A  +                      NDP+L +  S +  +SSP
Sbjct: 357 AVSAAESRNPRETIPKAAKRTFWLITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASSP 416

Query: 320 FVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSG 379
            VIAIEN     LP + NA+IL  I+S  NS VY  SR + SM      PK      + G
Sbjct: 417 LVIAIENGHIHGLPSLMNAIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRG 476

Query: 380 IPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQ 439
            P  A+      G L+++ +S   + VF WL  ++ ++  F WM I++ HIRF Q +  Q
Sbjct: 477 RPIPAICFVLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQ 536

Query: 440 GISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILF 495
            IS D+LPF ++   WG+ Y              T+  P    K N + FF  Y+S  + 
Sbjct: 537 QISLDELPFLSQTGIWGSIYGIVILFLVLVASFWTSLFPVGSSKANATSFFEGYLSFPIL 596

Query: 496 FAVWIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWEED---EPKNLWEK 542
              +I  +++F+    +     +DL + R+++D +V  E+   E ++L ++
Sbjct: 597 LGCYIAHKVYFKNWRWYIPASKMDLHSGRKQVDLEVVREELRLEKEHLAQR 647

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  276 bits (705), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 164/512 (32%), Positives = 269/512 (52%), Gaps = 19/512 (3%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           K  ++K+ +KPRH+ MI+LG  IGTGL + + + L  AGP G +I +  +G+  Y + Q+
Sbjct: 154 KSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQA 213

Query: 98  LGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
           +GE+A  +  +   F  +    +  A   A  ++Y + W     LEL      I++WT  
Sbjct: 214 VGELAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKYWTTK 273

Query: 157 VPLTAWIIILWVVLVSANL-APVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTG 214
           V    ++II +++++  NL      Y E EF     K++ ++GF I    ++CG AG  G
Sbjct: 274 VDPDIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGGAGTDG 333

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
            +G +YW +PG      +  D +  RF G +++L++AAF +  +E +G+TA E +NPRK 
Sbjct: 334 YIGAKYWHDPGA-----LRGDTSIQRFKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKA 388

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVIAIENSGTKVLP 333
           +P A  K+                     N D  L S  S + +SP+V+AI   G +V+P
Sbjct: 389 IPSAAKKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKASPYVLAISTHGVRVVP 448

Query: 334 HIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGF 393
           H  NAVIL +++S  NS  Y SSR+L S+   G APK  ++  + G P   + T ++ G 
Sbjct: 449 HFINAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAAIFGV 508

Query: 394 LAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFM 453
           +A+  +S     VF WLL I+ ++  F WM I ++HIRF +A+  QG S  +L F+++  
Sbjct: 509 IAFCATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFRSQVG 568

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP-------KFNVSDFFTAYVSVILFFAVWIGFQIWF 506
            +G+ YAA             A  P       K +  +FF  Y+++ +  A + G++IW 
Sbjct: 569 WYGSAYAAIMMFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAFYFGYKIWK 628

Query: 507 RG-PLFKKTEDIDLDTDRREIDNDV--WEEDE 535
           +   LF + ++IDL + R   D ++   EEDE
Sbjct: 629 KDWKLFIRAKNIDLISHRNIFDEELIKQEEDE 660

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  273 bits (699), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 161/509 (31%), Positives = 260/509 (51%), Gaps = 14/509 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
             ++K+++K RH+ M++LG  IGTGL ++ +  L  AGP   +I Y+ +  + Y + Q+ 
Sbjct: 83  NNRLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVMVSFVTYFMVQAA 142

Query: 99  GEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           GEM    P +  +F  +   F+S + G A  +++ + W     LEL      I++W D +
Sbjct: 143 GEMGVTYPTLPGNFNAYNSIFISKSFGFATTWIFCIQWLTVLPLELITSSMTIKYWNDKI 202

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPV 216
               +I+I +V L+  +   VK YGE EF  +  K+L I GFII + ++ CG AG  G +
Sbjct: 203 NSDVFIVIFYVFLLFIHFFGVKAYGETEFIFSSCKILMIAGFIILSVVINCGGAGVDGYI 262

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           G +YWR+PG +  G         RF G    L++A F++ G EL  ++  E +NPRK+ P
Sbjct: 263 GGKYWRDPGSFAEG-----NGATRFKGICFILVTAYFSFGGIELFVLSINEQSNPRKSTP 317

Query: 277 RAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHI 335
            A  + V                     ND  + S  +   +SP+V+A      +V+PHI
Sbjct: 318 VAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHASPYVLAASIHKVRVVPHI 377

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            NAVIL ++IS  NS +Y + R++ S+   G APK+L +  + G P  A+    LVG + 
Sbjct: 378 INAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLDYIDREGRPLRALFVCCLVGVIG 437

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++  S      F WL  I  ++  F W  I ++HIRF +A+K QG S D++ +KA    W
Sbjct: 438 FVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIW 497

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILFFAVWIGFQIWFRGPL 510
           G+YY               A +P     K N   FF +Y++  L+  +++G+ ++ R   
Sbjct: 498 GSYYGVFFNILVFMAQFWVALSPIGNGGKCNAQAFFESYLAAPLWLCMYLGYMLYERDFT 557

Query: 511 FKKTED-IDLDTDRREIDNDVWEEDEPKN 538
           F    D IDLD  RR  D ++  ++  +N
Sbjct: 558 FLNPLDKIDLDYHRRVYDPEIIRQENEEN 586

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  273 bits (697), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 160/526 (30%), Positives = 266/526 (50%), Gaps = 27/526 (5%)

Query: 24  RSKDVVSL----ESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVG 79
            S+DV  L    E  G+   T++K+++K RH+ MI+LG  IGTGL +     L+ AGP G
Sbjct: 50  ESEDVKELKGENEECGAA--TKMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGPAG 107

Query: 80  ALIAYMFIGTLAYMVSQSLGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSIT 138
            +I Y     + Y + Q+ GE+   +  +  ++  ++   + PALG +  ++Y + W   
Sbjct: 108 LVIGYAVASIMLYCIIQAAGELGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWMTV 167

Query: 139 FALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVG 198
             L+L      +++WT+A P   ++ + +VV++  N+   K Y E EF     KVL I G
Sbjct: 168 LPLQLVTAAMTVRYWTNANP-DIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKVLMIAG 226

Query: 199 FIIYAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQG 257
           F+I    + CG AG +G +G +YW +PG +  G          F G       AAF+Y G
Sbjct: 227 FVILGIAINCGGAGTSGYIGAKYWHSPGSFAAG----------FKGVCYVFCYAAFSYGG 276

Query: 258 TELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL--KSEDSYI 315
            E++ +TA E  NPRK++P A  KV                     N  +L   S +S  
Sbjct: 277 IEVMVLTASEQENPRKSIPNACKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGESAS 336

Query: 316 SSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWT 375
            +SP VIA+ + G K++PHI NAVIL ++IS GNS +Y + R+L S+   G APK+L + 
Sbjct: 337 HASPLVIAVASHGVKIVPHIINAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYV 396

Query: 376 TKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQA 435
            + G P      T LV  +A++ +S     +F WLL I+ ++  F W  I ++H+RF  A
Sbjct: 397 DRQGRPLICFAITLLVALIAFVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDA 456

Query: 436 LKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYV 490
           +  QG+S   + +K++   WG+++A              A AP     + N   FF  Y+
Sbjct: 457 MHAQGLSLGQIGYKSQTGYWGSWFAIVISVLVLIAQFWVAIAPIGEEGRLNAETFFQNYL 516

Query: 491 SVILFFAVWIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWEEDE 535
           +  +    + G++++ +   L     ++DL + R   D ++  +++
Sbjct: 517 AFPILLGAYFGYKVYHKDWRLCIPASEVDLSSHRNISDEEILRQED 562

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  273 bits (699), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 163/507 (32%), Positives = 259/507 (51%), Gaps = 12/507 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
           +T +K+A+K RH+ M+ LG  IGTGL ++ +  L   GP   +I Y  +  + Y++ Q+ 
Sbjct: 88  DTHLKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFGGPAALVIGYGLVSMVTYIMIQAA 147

Query: 99  GEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           GEMA   P +  +F  +   F+S   G A  +++ + W     LEL     +I++WT+ V
Sbjct: 148 GEMAVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASLIIKYWTEKV 207

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPV 216
               +++I +V L+  +   VK YGE EF     K+L I GFII++ ++ CG AG  G +
Sbjct: 208 NADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKILMIAGFIIFSIVVNCGGAGHDGYI 267

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           G +YW +PG +     ++     RF G    L+S  F+Y GTEL  ++  E  NPRK+ P
Sbjct: 268 GGKYWHSPGAFAGTNAAE-----RFKGVCYVLVSGYFSYGGTELYVLSVNEQENPRKSTP 322

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK-SEDSYISSSPFVIAIENSGTKVLPHI 335
            A  +                      ND +L  +  S   +SP+V+A    G +V+PHI
Sbjct: 323 IAAKQSIYRILVIYLLTMILIGFTVPFNDDQLMGAGGSATHASPYVLAASIHGVRVVPHI 382

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            NAVIL  +IS  NS +Y + R+L S+   G APK++T+  + G P  A+L  ++ G +A
Sbjct: 383 INAVILIAVISVANSSLYAAPRLLCSLAEQGYAPKFMTYVDREGRPLYALLACAVFGVIA 442

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           +   S     VF WL  I  ++  F W  I ++H+RF QA+K QG   +++ + A    W
Sbjct: 443 FSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHVRFRQAMKLQGRDLNEVGYIANTGYW 502

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP---KFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFK 512
           G+ Y               A AP         FF +Y++  ++ A + G+ IW +   F 
Sbjct: 503 GSVYGVVFNILVFIAQFWVALAPPKSPITAQSFFESYLAFPIWIAFYFGYMIWNKDYTFL 562

Query: 513 KTED-IDLDTDRREIDNDVWEEDEPKN 538
              D IDLD  RR  D +V ++++ +N
Sbjct: 563 NPLDKIDLDHHRRIYDPEVLKQEDMEN 589

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  273 bits (699), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 172/501 (34%), Positives = 260/501 (51%), Gaps = 14/501 (2%)

Query: 42  VKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEM 101
           ++  LK R  +MIA+GG IG+GLF+  ST L   GP G +I +    T+ Y +  +LGE+
Sbjct: 103 LQHTLKGRQQTMIAIGGAIGSGLFVGSSTALRTGGPAGLIIGWGLTSTMIYSMVMALGEL 162

Query: 102 ATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW-TDAVPLT 160
           A   PV   F  +  RF+  + G AN + Y L W +   LE+      + +W T      
Sbjct: 163 AVVFPVAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEIVSASITVNYWGTPTRYRD 222

Query: 161 AWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGF-R 219
            ++ + W+V+V  N+  VK +GE EF  + IKV  ++GFII   ++VCG G  G     +
Sbjct: 223 GFVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTTVIGFIILGIVLVCGGGPKGGFVGAK 282

Query: 220 YWRNPGPW-GPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRA 278
           YW +PG + G G      +  +F G  S  ++AAF++ G+EL+GITA EAANPRK++P A
Sbjct: 283 YWHDPGAFVGHG------SGAQFKGVCSVFVTAAFSFAGSELIGITAAEAANPRKSIPGA 336

Query: 279 INKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPHIFN 337
             +V                     ND +L    S   ++SPFVIAI   G K LP + N
Sbjct: 337 AKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGASSVDAAASPFVIAIVTHGIKGLPSVIN 396

Query: 338 AVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYL 397
            VIL  ++S GNS ++  SR + ++   G  PK   +  +SG P   +  TS  G LA++
Sbjct: 397 VVILIAVLSVGNSAIFACSRTIAALSDQGFLPKVFGYIDRSGRPLVGIAITSTFGLLAFV 456

Query: 398 ESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
            +S     VF+WLL ++ ++  F W  I + HIRF  ALK QG   ++L F +     G+
Sbjct: 457 AASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRMALKAQGRDTNELTFVSPAGVAGS 516

Query: 458 YYAAXXXXXXXXXXXXTAFAP---KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-PLFKK 513
           Y+               A  P   K +   FF +Y+S  +  A + G +I+ R   LF  
Sbjct: 517 YWGLFMIVLMFIAQFYVALFPPGGKPDAEVFFQSYLSFPIVVATYFGHKIYKRNWKLFIP 576

Query: 514 TEDIDLDTDRREIDNDVWEED 534
            ED+D+DT RRE D ++ +++
Sbjct: 577 LEDMDIDTGRRETDMELLKQE 597

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  272 bits (695), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 169/526 (32%), Positives = 258/526 (49%), Gaps = 29/526 (5%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           GS   + +KRALK RH+ MIA+G +IGTGLF+     L+  GP+  +I +   GT     
Sbjct: 71  GSFDPSNMKRALKSRHLIMIAIGSSIGTGLFVGSGKALATGGPLALIIGWTLAGTQMIGT 130

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
              LGE+   +PV  +F  ++ RFL P++      +Y + W     LE+      ++FWT
Sbjct: 131 IHGLGELTVRLPVVGAFADYSTRFLDPSVSFVISSIYVMQWFFVLPLEIIASCITMRFWT 190

Query: 155 DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
            +V    W+ + + ++VS NL  V+ +GE EF  + +KV+ I GFII   +++ G G T 
Sbjct: 191 QSVDPIIWVALFYTMIVSINLLGVRGFGEAEFIFSSVKVITICGFIILCIVLILGGGPTH 250

Query: 215 P-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
             VG RYW +PGP   G          F G  + +++A+++  G+E+  + +GE  +P K
Sbjct: 251 QYVGSRYWHDPGPLANG----------FKGVAAVMVTASYSLGGSEMTCLASGE-TDP-K 298

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
            +P AI ++                      +  L    S   +SPFV+A+     KV+P
Sbjct: 299 ELPHAIKQIFWRILFFFLVSLTLVGFLVPYTNENLLGGSS-AENSPFVLALYLHHVKVVP 357

Query: 334 HIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGF 393
           HI N VIL +I+S GNS ++ SSR L SM   GL P    +  + G P   +L  S+ G 
Sbjct: 358 HIVNGVILVSILSVGNSCIFASSRTLCSMAHQGLIPHIFGYVDRGGRPLVGILANSIFGL 417

Query: 394 LAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFM 453
           LA+L      S VF WL+ I  +A    W+ I+V+H+RF  A+K Q  S D+L F +   
Sbjct: 418 LAFLVKFSSISNVFSWLMAIAGLATCVVWLSINVSHVRFRLAMKAQNKSLDELQFVSSVG 477

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP-------KFNVSDFFTAYVSVILFFAVWIGFQIWF 506
            WG+ YA              A  P       K     FF  Y+  ++  A++   + +F
Sbjct: 478 VWGSVYAGVLNFLTLVAQFYIALWPVEGWKDSKSRAEAFFKNYLCALILIAMFAAHKCYF 537

Query: 507 RGPL-----FKKTEDIDLDTDRREIDNDVWEE---DEPKNLWEKFW 544
           R         KK  ++DLDT R  ID ++ +E   +  K L  K W
Sbjct: 538 RITTGKWWGIKKLSEVDLDTGRVNIDIEIIKEEVAERKKFLRNKAW 583

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  272 bits (695), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 162/526 (30%), Positives = 264/526 (50%), Gaps = 26/526 (4%)

Query: 22  FSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGAL 81
           F R  D       GS   + +KR LKPRH+ MIA+GG+IGTGLF+     ++  GP+G +
Sbjct: 59  FQRCVDSFKPPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVV 118

Query: 82  IAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFAL 141
           + +   G+        LGE+    PV  +F  +  RFL P++      +Y L W     L
Sbjct: 119 LGWTIAGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPL 178

Query: 142 ELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFII 201
           E+      +Q+W  ++    W+ I + V+V  NL   + +GE EF  + +K + + GFII
Sbjct: 179 EIIAAAMTVQYWNSSIDPVIWVAIFYAVIVCINLFGARGFGEAEFAFSTVKAITVCGFII 238

Query: 202 YAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTEL 260
            + +++CG G     +G +YW +PG    G          F G ++ L+ A+++  G E+
Sbjct: 239 LSIVLICGGGPDHEFIGAKYWHDPGCLANG----------FPGVLAVLVVASYSLGGIEM 288

Query: 261 VGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPF 320
             + +GE  +P K +P AI +V                      +  L    S + +SPF
Sbjct: 289 TCLASGE-TDP-KGLPGAIKQVFWRILFFFLASLTLVGFLVPYTNQNLLGGSS-VDNSPF 345

Query: 321 VIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGI 380
           VIA++    KVLP I NAVIL +++S GNS ++ SSR L SM   GL P +  +  ++G 
Sbjct: 346 VIAMKLHHIKVLPTIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGR 405

Query: 381 PYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQG 440
           P   ++  SL G LA+L  S   + VF+WL+ I  +A    W+ I+++HIRF  A+K QG
Sbjct: 406 PLVGIMANSLFGLLAFLVKSGSMADVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQG 465

Query: 441 ISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-------KFNVSDFFTAYVSVI 493
            S D+L F +    WG+ Y+A             +  P       K     FF  Y+  +
Sbjct: 466 KSLDELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWSSGKERAKLFFQNYLCAL 525

Query: 494 LFFAVWIGFQIWFRGPL-----FKKTEDIDLDTDRREIDNDVWEED 534
           +   +++  +I+++         K  +DIDL+TDR++ID ++ +++
Sbjct: 526 IMLFIFVVHKIYYKCQTGKWWGVKSLKDIDLETDRKDIDIEIIKQE 571

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  273 bits (698), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 164/510 (32%), Positives = 268/510 (52%), Gaps = 19/510 (3%)

Query: 37  VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQ 96
           +K+ ++KR +  RH+  +A+G  +GTGL +  ++ L++AGP G LI Y  +GT  Y V Q
Sbjct: 112 IKKEELKRDINQRHMVFMAIGSGVGTGLLVGNASTLNSAGPAGLLIGYALMGTCVYCVIQ 171

Query: 97  SLGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTD 155
           + GE+  T+  +   F  +    ++P+   + G++Y L W     LEL      I++WT 
Sbjct: 172 AAGELGVTYANLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLELVTASLTIKYWTT 231

Query: 156 AVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTG 214
            V    +++I +++++  N    K Y E +F+  C+K+  I GF I   ++ CG AG  G
Sbjct: 232 KVDPDVFVVIFYLLILLINFFGSKGYAEADFFFNCMKLAMISGFFILGIVVACGGAGHDG 291

Query: 215 PVGFRYWRNPGPW-GPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
            +G +YW NPG + G   I        F G  S  +++AF + G+E V ++A E ANPRK
Sbjct: 292 YLGGKYWHNPGAFRGEKAID------HFKGVSSVFVTSAFAFGGSEFVALSASEQANPRK 345

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
           ++P A   +                     + P+L+       +SP+V+AI   G KV+P
Sbjct: 346 SIPSAAKLILYRIIWVYLTSITILGFLVPWDSPQLQPSSDGKKTSPYVVAIAMHGVKVVP 405

Query: 334 HIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGF 393
           H+ NAVIL  ++S  NS  + SSR+L S+   G APK+  +  + G P  A+L ++L G 
Sbjct: 406 HLINAVILMAVLSVSNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLISALFGV 465

Query: 394 LAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFM 453
           + +  +S   + VF WLL I+ ++  F +  I V+HIR   A+K QG S  +L F+++  
Sbjct: 466 ICFCATSKKETDVFSWLLAISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGELGFRSQVG 525

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIW---F 506
            +G++YA              A AP    K +   FF  Y++  +    + G+ IW   F
Sbjct: 526 TYGSFYACLLLVLSLMAEFWVALAPIGEGKLDAESFFENYLAAPIGIVFYFGYMIWKKDF 585

Query: 507 RGPLFKKTEDIDLDTDRREIDND-VWEEDE 535
           R  +F +++DIDLD  R+  D D + +EDE
Sbjct: 586 R--IFIRSKDIDLDFKRQVFDEDLIKQEDE 613

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  271 bits (694), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 170/534 (31%), Positives = 273/534 (51%), Gaps = 16/534 (2%)

Query: 26  KDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYM 85
           +D   L    S K   +K+ +KPRH+ MI+L   IGTG+ +     L N GP   LI Y 
Sbjct: 71  EDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYA 130

Query: 86  FIGTLAYMVSQSLGEMAT-FIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELS 144
            + T+ Y V QS  E+A  +  ++  F  +    +  A   +  ++Y L W     LEL 
Sbjct: 131 IVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELV 190

Query: 145 VVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAF 204
                I++W D++   A+++I +VVL+  N      Y E EF+    KVL ++GF I   
Sbjct: 191 TASMTIKYWNDSINPDAFVVIFYVVLIVINFIGAAGYAEAEFFFNTCKVLMLIGFFILGI 250

Query: 205 IMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGI 263
           I+ CG AG  G +G  YW +PG +     +  +N  RF G V+ L++AAF Y G E   +
Sbjct: 251 IVNCGGAGNDGYLGSVYWHDPGAFRG---NNGIN--RFKGLVAVLVNAAFAYGGAEFSVL 305

Query: 264 TAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVI 322
           TA E  NP+K++  A  K+                     N P+L  S  +   +SPFVI
Sbjct: 306 TAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVI 365

Query: 323 AIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPY 382
           AI + G KV+PHI NAVIL +++S  NS +Y SSR+L S+   G APK   +  + G P 
Sbjct: 366 AIASHGVKVVPHIINAVILLSVLSVANSALYSSSRILLSLSEQGFAPKLFNYVDRRGRPV 425

Query: 383 AAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGIS 442
             +L + + G L ++ +S     VF WLL I+ ++  F W  IS++H+RF +++  QG S
Sbjct: 426 RCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRS 485

Query: 443 RDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAV 498
            D+L +++    WGAYYA              A +P    K + ++FF  Y+++ +   +
Sbjct: 486 LDELGYQSWTGVWGAYYAMIMILLILIGQFWVAISPVGSNKLDANNFFENYLAMPILIGL 545

Query: 499 WIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWEE---DEPKNLWEKFWSAVA 548
           ++G+++W+R   +     ++DL + R+  D ++ +    +E + L    W+  A
Sbjct: 546 YLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRA 599

>Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)
          Length = 558

 Score =  270 bits (690), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 165/503 (32%), Positives = 249/503 (49%), Gaps = 21/503 (4%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
            T VKRALK RHIS++ALGG IG G  +     L+  GP+  L+ +  IG +A+ V +S+
Sbjct: 46  NTGVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGVIAFAVMESI 105

Query: 99  GEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVP 158
           GE+ T  P    F    +RF   AL A  GY Y + +    A E + +  ++QFW   VP
Sbjct: 106 GEIITLYPSGGGFTTLARRFHGDALSAVCGYAYVVVFFAVLANEYNTLSSILQFWGPQVP 165

Query: 159 LTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPV-G 217
           L  +I+I W       L  V  +GE E+W++  K++ +V + I++ I + G  K  P  G
Sbjct: 166 LYGYILIFWFAFEIFQLIGVSLFGETEYWLSWFKIVGLVAYYIFSIIYISGGIKDRPAFG 225

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           F YW +PG    G          F G     +  +  Y GTE V + A E+ NP K VP 
Sbjct: 226 FHYWNSPGSLSHG----------FKGIAVVFVFCSTFYSGTECVALAATESKNPGKAVPL 275

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           A+ +                      +DP L S  + +  SP  IAI  +G     H+ N
Sbjct: 276 AVRQTLWRVLIVYIGIAVFYGATVPFDDPNL-SATTKVLKSPISIAISRAGWAGGAHLVN 334

Query: 338 AVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYL 397
           A IL T ISA N  +YI SR L ++   GLAPK L WT + G+P  A+   + +G ++ +
Sbjct: 335 AFILVTCISAINGSLYIGSRTLTNLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLM 394

Query: 398 ESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
             S GAS  + +++N++ V  F  W +IS  H+R  +A   QG S ++LP+KA   PW  
Sbjct: 395 NVSVGASDAYSYIVNLSGVGVFIVWGVISYTHLRVRKAWVTQGRSLEELPYKALLYPWTP 454

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAY----VSVILFFAVWIGFQIWFRGPLFKK 513
            ++             T+F P F+  +F  AY    V+++L+ A+ +     FR      
Sbjct: 455 IFSLIANVFLALIQGWTSFVP-FDAGNFVDAYILLPVAIVLYVAICVFKNHHFR---IVD 510

Query: 514 TEDIDLDTDRR-EIDNDVWEEDE 535
            + +DLD  RR +ID D  +++ 
Sbjct: 511 LKSVDLDEGRRKDIDADFSDQES 533

>ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {ON}
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046C BAP3 Amino acid permease involved in the uptake
           of cysteine leucine isoleucine and valine
          Length = 620

 Score =  271 bits (694), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 164/514 (31%), Positives = 265/514 (51%), Gaps = 17/514 (3%)

Query: 37  VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQ 96
           V    +K+ALK RH++M++LG  IGTGL I+    LSNAGP   LI Y  +    Y + Q
Sbjct: 94  VSNAGLKQALKTRHVAMMSLGTGIGTGLLIANGKGLSNAGPAPLLIGYGLVSVNTYFMVQ 153

Query: 97  SLGEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTD 155
           + GE+A   P +  SF  +T + +S   G A  +++F+ W   F +EL  +   ++FWT 
Sbjct: 154 AAGELAVAFPTIPGSFNAYTSQLVSRPFGFATTWLFFVQWLTMFPMELIAMTFAVRFWTT 213

Query: 156 AVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTG 214
            V    +++I +V L   +   V+ YGE EF++   KVL ++GF+I+A  +  G AG +G
Sbjct: 214 RVDADVFVLIFFVFLFIVHFIGVEAYGETEFFLNLFKVLMVIGFVIFAICVAAGGAGDSG 273

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274
            +G +YW +PG +          EGRF G    L+SA F+Y GTEL  ++  E  NPRKT
Sbjct: 274 YIGAKYWHDPGAF-----VSHTAEGRFKGVCYVLVSAYFSYGGTELFVLSVNEQENPRKT 328

Query: 275 VPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK----SEDSYISSSPFVIAIENSGTK 330
           +P A                         N P+L     +++   S SP+V+A      +
Sbjct: 329 IPTATKTTIYRIIFIYLLTMVLVGFTVPNNHPRLMGSPYAKEGVQSVSPYVLAASYHHVR 388

Query: 331 VLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSL 390
           VLPH  NAV++  ++S  NS +Y + R++ S+   G  PKY  +  + G P  A++   +
Sbjct: 389 VLPHFINAVVMLALVSMSNSAMYAAPRLICSLAQQGYCPKYFDYIDRRGRPTRALVLCFI 448

Query: 391 VGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKA 450
           +G +A+  SS     +F WL  I  ++  F W  I ++H+RF  A+K QG   ++L +K+
Sbjct: 449 IGVIAFASSSEKRETIFSWLSAIAGLSELFTWSSIMLSHVRFRAAIKVQGKDINELGYKS 508

Query: 451 KFMPWGAYYAAXXXXXXXXXXXXTAF-AP----KFNVSDFFTAYVSVILFFAVWIGFQIW 505
               WG+ Y               A  AP    K + SDFF +Y+++ ++   ++GF +W
Sbjct: 509 NTGVWGSAYGVFFSLLVFAAQFWVALSAPNSGGKCSASDFFQSYLALPIWLTFYVGFMLW 568

Query: 506 FRGPLFK-KTEDIDLDTDRREIDNDVWEEDEPKN 538
            R   F      +DLD+ RR  D ++  +++ ++
Sbjct: 569 TRDFTFLIPLNKVDLDSYRRYYDPELLRQEDEEH 602

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  270 bits (690), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 171/513 (33%), Positives = 263/513 (51%), Gaps = 26/513 (5%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           GS     +KR LK RH+ MIA+GG+IGTGLF+     L+  GP+  +I +   G+     
Sbjct: 63  GSYHSDNLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVGT 122

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
              LGE+    PV  +F  ++ R L P++      +Y   W     +EL      +QFWT
Sbjct: 123 IHGLGEITMRFPVVGAFANYSTRLLDPSISFMVSSIYICQWYFVLPIELIASAMTVQFWT 182

Query: 155 DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214
             V    W+ I +V++VS NL  VK +GE EF  + +KV+ I+GFII + I++CG G   
Sbjct: 183 TKVDPVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFIILSIILICGGGPDH 242

Query: 215 P-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
             +G  YW +PG    G          F G  S  ++A+++  G+E+V + + E  +P K
Sbjct: 243 RFIGTEYWHHPGALANG----------FKGVASVFVTASYSLGGSEMVCLCSAE-TDP-K 290

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
            +P AI +V                      +  L    S +++SPFVIAI+ SG +VLP
Sbjct: 291 ELPHAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLLGGSS-VNNSPFVIAIKLSGIRVLP 349

Query: 334 HIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGF 393
            I NAVIL +I+S GNS ++ SSR L SM   GL P+   +  ++G P   ++  SL G 
Sbjct: 350 SIINAVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIVNSLFGL 409

Query: 394 LAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFM 453
           LA+L  S    VVFDWL+ I  +A    W+ I+++HIRF  A+K Q  S D+L FK+   
Sbjct: 410 LAFLVKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSLDELEFKSSVG 469

Query: 454 PWGAYYAAXXXXXXXXXXXXTAFAP-------KFNVSDFFTAYVSVILFFAVWIGFQIWF 506
            +G+ Y+A             +  P       +     FF  Y+  ++   V++  +I+F
Sbjct: 470 VYGSIYSATVNILILIAQFYISLWPVGGWTSSQQRTESFFKNYLCALVLVFVFVTHKIYF 529

Query: 507 RGPL-----FKKTEDIDLDTDRREIDNDVWEED 534
           +        FK   +IDL+TDR+ ID ++ +++
Sbjct: 530 KCSTGKWFDFKPLAEIDLETDRKNIDIEIVKQE 562

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  270 bits (690), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 177/538 (32%), Positives = 275/538 (51%), Gaps = 29/538 (5%)

Query: 30  SLESLGSVK-ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIG 88
           SL  + ++K  T+V R LK RH+  IALGG IGTGLFI   T LS+ GP   LI+Y  + 
Sbjct: 51  SLSDIDTIKPSTEVSRGLKSRHVQFIALGGAIGTGLFIGSGTALSSCGPAPLLISYSVMS 110

Query: 89  TLAYMVSQSLGEMATFIPVT--SSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVV 146
              + +   + EM   IP++  SS       +L+       G+  F + S+    E++  
Sbjct: 111 FFVWAIMNQMTEMVVLIPLSGESSMASLAGTYLNRPSSFMCGWNCFYAMSMVVPTEITAC 170

Query: 147 GQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIM 206
             +I++WTDA     ++ I  ++    +L PVK +GE EF ++ IK+L I+G I+   ++
Sbjct: 171 ALLIEYWTDA-NAAIFVTIFMILATLLSLLPVKIFGESEFCVSIIKILTILGLILVGVVI 229

Query: 207 VCGAG--KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVGI 263
             G G  +   +GF YW  PG +   ++    + G FL    ++I + F +    E+   
Sbjct: 230 FFGGGPAQHKVLGFHYWNTPGAFNSYLVKG--STGAFLAVWKAIIKSGFAFVMIPEITSS 287

Query: 264 TAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLK----SEDSYISSSP 319
            + EAA PRK +PRA  +                      ++  L     S  +  ++SP
Sbjct: 288 CSAEAAFPRKNMPRACQRFVYRLAVFYVLGCLVIGVIVGYDNKTLNEAISSGKANAAASP 347

Query: 320 FVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSG 379
           FVI I+ +G ++LPHI NA IL++  S   S++Y +SRVL+S+ L G APK+ +   K G
Sbjct: 348 FVIGIQEAGIRILPHIINACILTSAYSCSTSELYGASRVLHSLALRGDAPKFFSKVNKYG 407

Query: 380 IPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQ 439
           +PY +V  TSL G LAYL  S  + VVF+WL NI  ++GF  W+ +S+ ++RF +   + 
Sbjct: 408 VPYYSVAATSLFGVLAYLNCSKSSLVVFNWLSNIATISGFVNWVFVSITYLRFRKITDYL 467

Query: 440 GISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAF-APKFNVSDFFTAYVSVILFFAV 498
            I+ D +P++ +     AY +A              F A  +NVSDFFT YV++     +
Sbjct: 468 KIN-DRVPYRRRGQRALAYASAIFFALLAITNGFYVFIAGNWNVSDFFTCYVTIGFVGVL 526

Query: 499 WIGFQIWFRGPLFKKTEDIDLDTDRRE----IDNDVWEEDE-----PKNLWEKFWSAV 547
           +IG  I+++   F+     D+D   RE    ID    EE E     PKN  E+ W  V
Sbjct: 527 FIGSSIYYKEWTFR-----DMDVVGREIMPKIDQADQEEKEEYLPPPKNWVERVWRIV 579

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  267 bits (683), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 168/511 (32%), Positives = 258/511 (50%), Gaps = 17/511 (3%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
            T++K+ LK RHI M+ L G  GTGLF+S    L   GPVG LIAY+ +G +      ++
Sbjct: 43  RTKLKQGLKARHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGMLIAYVLVGIVVGCNQIAI 102

Query: 99  GEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVP 158
            E+A+F+P T + +  +++F+  A+G   G++   ++S     ELS    V+ +WTD  P
Sbjct: 103 AEVASFMPATGATIRHSEQFIDEAVGFTFGWIS--TYSSLMPGELSATAVVMTYWTDLSP 160

Query: 159 LTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGF 218
              +I I  V+ +  N+  ++FYGE+E++   +K+  I   II   ++  G  K   +GF
Sbjct: 161 -AIFITIFGVLFILTNIYTIRFYGEIEYFFGWLKLALIAILIITGLVIDLGGTKQERLGF 219

Query: 219 RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRA 278
            YWRNPGP+   ++  D   G+F+G+ ++L S  ++Y G + + I AGE  N R  +   
Sbjct: 220 HYWRNPGPFAEYLVGGDT--GKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFHG 277

Query: 279 INKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNA 338
              V                     ND  + +      SSPFVIA+E +G KVLPHI NA
Sbjct: 278 AKNVFVRIILLYLITVFVLTLIVPYNDKLIATGSGNARSSPFVIAMERAGIKVLPHIVNA 337

Query: 339 VILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLE 398
           +IL++  SAGN  +   SR L+ +     APK    T+K GIP+  VL  S    LAY+ 
Sbjct: 338 LILTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPWVGVLFISSFLPLAYMS 397

Query: 399 SSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAY 458
            S  ++ VF W   + +      W+LIS  HI   +AL+ QG SR DLP+     P+ A+
Sbjct: 398 CSESSATVFSWFQELVSSNTLLRWILISANHIHMDRALRAQGYSRKDLPYSTTIAPYAAW 457

Query: 459 YAAXXXXXXXXXXXXTAFAP-KFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDI 517
           ++               F    F++  FF+ Y  + L  A+   F  W    LFKKT  +
Sbjct: 458 FSGIMSFIFLLTGGFYNFIHGNFDIESFFSRYFIIPLAIAL---FTFW---KLFKKTRYL 511

Query: 518 D-LDTDRREIDNDVWEEDE--PKN--LWEKF 543
              + D + I  D+ E  E  P+   LW++ 
Sbjct: 512 RPHEVDLQSIFEDIRENPEYIPETTPLWKRL 542

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  268 bits (686), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 158/511 (30%), Positives = 265/511 (51%), Gaps = 18/511 (3%)

Query: 36  SVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVS 95
           S   T++K+ +K RH+ +++LG  IGTGL ++ ++ L   GP G LI Y F+  ++Y++ 
Sbjct: 65  SAHSTKLKQNMKTRHVVLMSLGTGIGTGLLVANASSLHFGGPGGLLIGYFFVSIISYIMM 124

Query: 96  QSLGEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
           Q+ GEMA   P +  +F  ++  F+S   G A  +++ + W+    LEL     V+++WT
Sbjct: 125 QAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCIQWTTILPLELITSSIVVKYWT 184

Query: 155 DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGA-GKT 213
             +    +++I ++ ++  +    + YGE EF     KVL + GFII   ++ CGA G  
Sbjct: 185 TKINADIFVLIFYLFILCIHFCGARGYGETEFIFNSCKVLMVAGFIIVGILINCGAVGDD 244

Query: 214 GPVGFRYWRNPGPW--GPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271
           G +G +YW  PG +  G GI        RF G    L++A F+Y G EL  ++  E  NP
Sbjct: 245 GYIGGKYWHEPGAFAAGSGI-------DRFKGIAYVLVTAYFSYGGMELYALSVNELPNP 297

Query: 272 RKTVPRAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTK 330
           RK +P A  K V                     ++  L S  S +  SP+V+A+   G K
Sbjct: 298 RKAIPSACAKGVYRILIIYMLTMVIIGFLVPHDSNKLLGSGSSGVHPSPYVLALSLHGIK 357

Query: 331 VLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSL 390
           ++PHI NAVIL ++IS GNS +Y   R+L S+   G APK L +  + G P  A++  S+
Sbjct: 358 IVPHIINAVILISVISVGNSAMYSGPRLLCSLAQQGYAPKILDYVDRQGRPLMALIICSV 417

Query: 391 VGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKA 450
            G +A++ +S     +F WL  I+ ++  F W  I ++H RF +A+K QG S + L +++
Sbjct: 418 FGLIAFVAASKYEEDIFGWLAAISGLSELFTWTAICLSHFRFRRAMKLQGRSLETLGYRS 477

Query: 451 KFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILFFAVWIGFQIW 505
               WG+ YA              A  P     KF+V   F + +++ L+ ++ +G+ I 
Sbjct: 478 TTGEWGSLYAVVFNVFVLIAQLWVAMIPMDNGGKFSVKSLFKSCLALPLWLSMAVGYMIV 537

Query: 506 FRG-PLFKKTEDIDLDTDRREIDNDVWEEDE 535
            +   +      I +D+ RR  D +V ++++
Sbjct: 538 TKNWTILNPLSSISVDSHRRSYDVEVMKQED 568

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  270 bits (689), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 155/508 (30%), Positives = 260/508 (51%), Gaps = 14/508 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
           +  ++++++PRH+ M++LG  IGTGL +   + LS AGP   +I Y  +G+  Y + Q+ 
Sbjct: 116 DAHLQKSIRPRHVLMMSLGTGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQAC 175

Query: 99  GEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           GEMA  +  +  +F  +    +   +     ++Y L W     LEL      I +WT  V
Sbjct: 176 GEMAVCYSGLPGNFNAYPSFLVDEGMAFGVAWVYCLQWLCVMPLELVTASMTIDYWTTKV 235

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIM-VCGAGKTGPV 216
               +++I +V++   N    K Y E EF+    KVL + GF I A ++   GAG  G +
Sbjct: 236 NSDVFVVIFFVLITLINTFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYI 295

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           G +YW NPG +       D +  RF   +S+  +AAF +  +E + I A E +NPR+ +P
Sbjct: 296 GAKYWHNPGAF-----RGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIP 350

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL--KSEDSYISSSPFVIAIENSGTKVLPH 334
            A   +                     +  +L      +   +SP+VIA+ + G +V+PH
Sbjct: 351 SAAKTMIYRILFIFLTSITLVGFLVPYDSTELLGSGGSASSQASPYVIAVASHGVRVVPH 410

Query: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394
             NAVIL +++S  NS  Y S R+LYS+   G APK+  +  + G P  A+L T++ G +
Sbjct: 411 FINAVILLSVLSVANSAYYSSCRILYSLAQQGYAPKWFEYIDREGRPARAMLVTTIFGVI 470

Query: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454
           A+   S     VF WLL+I  ++  F W  I ++HIRF +A+K QG S D++ FK++   
Sbjct: 471 AFCSCSDKEEDVFAWLLSIAGLSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQVGV 530

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-P 509
           WG+ YAA             + AP      +  +FF  Y+++ +   ++ G++I+ +   
Sbjct: 531 WGSGYAAIMMILALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIYKKDWK 590

Query: 510 LFKKTEDIDLDTDRREIDNDVWEEDEPK 537
           LF + +DIDL + R   D ++  ++E +
Sbjct: 591 LFIRAKDIDLISHRTIFDGELVRQEEEE 618

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  267 bits (683), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 164/475 (34%), Positives = 243/475 (51%), Gaps = 11/475 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
           +T +K  LK RH+ MIA+GG IGTGL +   T L   GP   LI +   GT+ Y +  +L
Sbjct: 83  QTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMAL 142

Query: 99  GEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW-TDAV 157
           GE+A   P++  F  +  RF+  + G AN + Y L W +   LE+      + FW TD  
Sbjct: 143 GELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPK 202

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
               ++ + WVV+V  N+  VK YGE EF  + IKV+ +VGFII   I+ CG G  G   
Sbjct: 203 YRDGFVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYI 262

Query: 218 F-RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
             +YW +PG +     + D    +F G  S  +++AF++ G+ELVG+ A E+  PRK+VP
Sbjct: 263 GGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTSAFSFAGSELVGLAASESVEPRKSVP 317

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPHI 335
           +A  +V                     ND  L    S   ++SPFVIAI+  G K LP +
Sbjct: 318 KAAKQVFWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAASPFVIAIKTHGIKGLPSV 377

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            N VIL  ++S GNS +Y  SR + ++      P+   +  + G P   +  TS  G +A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIGVTSAFGLIA 437

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++ +S     VF+WLL ++ ++  F W  I + HIRF +AL  QG   D+L FK+    W
Sbjct: 438 FVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVW 497

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP---KFNVSDFFTAYVSVILFFAVWIGFQIWFR 507
           G+Y+               A  P     +   FF AY+S  L  A++IG +I+ R
Sbjct: 498 GSYWGLFMVVIMFIAQFYVALFPVGGSPSAEGFFEAYLSFPLVMAMYIGHKIYKR 552

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  270 bits (691), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 166/513 (32%), Positives = 260/513 (50%), Gaps = 17/513 (3%)

Query: 35  GSVKE---TQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLA 91
           G  KE    ++++ +KPRH+ M++LG  IGTGL +  + PL+ AGP   +I Y  +GT  
Sbjct: 149 GQKKEDSNAELRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLVIGYGIMGTCI 208

Query: 92  YMVSQSLGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVI 150
           Y + Q+ GEMA  +  +T SF  F    + P    A  ++Y + W     LEL      I
Sbjct: 209 YCIIQACGEMAVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTASMTI 268

Query: 151 QFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGA 210
           Q+WT  V    +++I +V+++  N    K Y E EF     KVL I GF I A  +  GA
Sbjct: 269 QYWTTKVDPDVFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFFILAICIDTGA 328

Query: 211 -GKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAA 269
            G  G +G +YW +PG +            RF G + + ++AAF +  TE + +TA E +
Sbjct: 329 AGTDGYIGAKYWNDPGAF-----RGQTKIERFKGVMDTFVTAAFAFGATEFIALTAAEQS 383

Query: 270 NPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVIAIENSG 328
           NPRK +P A  K+                     + D  L S  S   +SP+V+AI   G
Sbjct: 384 NPRKAIPSAAKKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGGSATKASPYVLAISLHG 443

Query: 329 TKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTT 388
            +V  H  NAVIL ++IS GNS  Y SSR+L S+   G APK   +  + G P  A+  +
Sbjct: 444 VRVAQHFVNAVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIAMCCS 503

Query: 389 SLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPF 448
           +++  +A+  +S   + VF WL+ I  ++  F W  I ++H+RF +A+K QG S  ++ +
Sbjct: 504 AVIAVIAFCATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLGEMGY 563

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF----NVSDFFTAYVSVILFFAVWIGFQI 504
            ++    G+ YAA             A  P      + + FF+ Y+++ +    + G++I
Sbjct: 564 LSQTGILGSLYAAIMMILALIAQFWVALVPMGTHTPDANSFFSNYLAMPILIVFYFGYKI 623

Query: 505 WFRG-PLFKKTEDIDLDTDRREIDNDVW-EEDE 535
           W R   LF + +DIDL + R   D ++  +EDE
Sbjct: 624 WKRDWRLFIRAKDIDLISHRTIYDEELLRQEDE 656

>ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON}
           similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 564

 Score =  267 bits (683), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 164/494 (33%), Positives = 245/494 (49%), Gaps = 17/494 (3%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
           +T VKRALK RHIS++ALGG IG G  +     L+  GP+  L+ +  IG +A+ + +S+
Sbjct: 48  KTGVKRALKDRHISLLALGGIIGPGCLVGAGNALAKGGPLALLLGFSIIGIIAFTIMESI 107

Query: 99  GEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVP 158
           GEM T  P    F    +RF S +L A  GY Y + +    A E + +  + QFW   VP
Sbjct: 108 GEMITLYPSGGGFTTLARRFHSDSLSAVCGYAYIVVFFAVMANEYNTLSSIFQFWGPQVP 167

Query: 159 LTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPV-G 217
           L  +I+I W    +  +A V  +GE+E+W++  K+L +V F I++ I + G  K  P  G
Sbjct: 168 LYGYILIFWAAFQAFQMAGVGAFGEIEYWLSWFKILGLVAFYIFSTIYISGGIKDRPAFG 227

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           F YW NPG    G          F G     +  +  Y GTE V  +A E+ NP + +P 
Sbjct: 228 FHYWNNPGALSHG----------FKGIAEVFVFCSTFYSGTESVAYSASESKNPNRAIPL 277

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           AI +                      ND  L +    +  SP  IAI  +G +   H+ N
Sbjct: 278 AIRQTFWRILVVYIGIGFFYGVTVPYNDHNLNAGTKAL-KSPISIAITRAGWEGGTHLVN 336

Query: 338 AVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYL 397
           A IL T ISA N  ++I SR + ++   GLAPK+L WT + G+P  A+   + +G ++ +
Sbjct: 337 AFILVTCISAINGSLFIGSRTITNLAHEGLAPKFLAWTDRRGVPIPAITLFNALGLVSLM 396

Query: 398 ESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
             S GAS  + +++N++ V  F  W  I + H+RF +A   QG +  +LP+KA F P+  
Sbjct: 397 NVSVGASTAYSYIVNLSGVGVFIVWGTIGLTHLRFRKAWIKQGRTVKELPYKALFYPYTQ 456

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTE-- 515
                           T+F P F   DF  AYV +     ++IG  +  +   FK  +  
Sbjct: 457 IIGIAANIFLALIQGWTSFVP-FKAGDFVDAYVLLPAAAVLYIGISL-LKTHSFKTVDLL 514

Query: 516 DIDLDTDRREIDND 529
            IDLD  RR +D D
Sbjct: 515 TIDLDEGRR-VDLD 527

>TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.368
           YOL020W
          Length = 590

 Score =  267 bits (683), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 179/526 (34%), Positives = 265/526 (50%), Gaps = 26/526 (4%)

Query: 22  FSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGAL 81
           F R  D     + GS   + +KR+LK RH+ MIA+GG+IGTGLFI     L+N GP+  +
Sbjct: 56  FQRVIDSFKPPANGSFHTSNLKRSLKSRHLIMIAIGGSIGTGLFIGSGQALANGGPLALV 115

Query: 82  IAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFAL 141
           + +   G+        LGE+    PV  +F  +  RFL P+L      +Y L W     L
Sbjct: 116 LGWSIAGSQIVGTIHGLGEITVRFPVVGAFANYQTRFLDPSLSFVISTIYVLQWFFVLPL 175

Query: 142 ELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFII 201
           E+      +Q+W D +    ++ I +  +VS NL  V+ +GE EF  + IKV+ + GFII
Sbjct: 176 EILSSAITVQYWNDTIDPVVFVAIFYCAIVSINLFGVRGFGEAEFVFSTIKVITVTGFII 235

Query: 202 YAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTEL 260
              I++CG G T   +G +YW +PG    G          F G++S LI+A+++  GTE+
Sbjct: 236 LCIILICGGGPTHEFIGAKYWHDPGCLANG----------FRGFLSVLITASYSLGGTEM 285

Query: 261 VGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPF 320
             + +GE  +P K +P AI +V                      +  L    S + +SPF
Sbjct: 286 TCLASGE-TDP-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSS-VDNSPF 342

Query: 321 VIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGI 380
           VIAI+    KVLP I NAVIL +I+S GNS ++ SSR L SM   GL P +  +  ++G 
Sbjct: 343 VIAIKLHNIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGR 402

Query: 381 PYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQG 440
           P   ++  SL G LA+L  S   S VFDWL+ I  +A    W+ I++ HIRF  A+K Q 
Sbjct: 403 PLTGIVINSLFGLLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINICHIRFRLAMKAQN 462

Query: 441 ISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-------KFNVSDFFTAYVSVI 493
            + D+L F +    WG+ Y+A             +  P       K     FF  Y+  I
Sbjct: 463 KTIDELEFVSAVGVWGSVYSAIINSLILIVQFYVSLWPIGGWTDSKDRAGKFFQNYLCAI 522

Query: 494 LFFAVWIGFQIWFRGPLFK-----KTEDIDLDTDRREIDNDVWEED 534
           +    +I  +++FR    K       +DIDLDT R+ ID D+ +E+
Sbjct: 523 VSLIFFICHKLYFRYKTKKWWEIIPLKDIDLDTGRKNIDIDIVKEE 568

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  267 bits (682), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 156/509 (30%), Positives = 260/509 (51%), Gaps = 14/509 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
              +K+++K RH+ M++LG  IGTGL ++ +  L  AGP   +I Y+ +  + Y + Q+ 
Sbjct: 83  NNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFITYFMVQAA 142

Query: 99  GEMAT-FIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           GEM   +  +  +F  +   F+S + G A  +++ + W     LEL      I++W D++
Sbjct: 143 GEMGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWNDSI 202

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPV 216
               +I+I +V L+  +   VK YGE EF     K+L + GFII + ++ CG AG  G +
Sbjct: 203 NADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYI 262

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           G +YWR+PG +  G      N  RF G    L++A F++ G EL  ++  E +N RK+ P
Sbjct: 263 GGKYWRDPGSFADG-----SNATRFKGICFILVTAYFSFGGIELFVLSINEQSNARKSTP 317

Query: 277 RAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHI 335
            A  + V                     ND  + S  +   +SP+V+A      +V+PHI
Sbjct: 318 LAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHASPYVLAASIHKVRVIPHI 377

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            NAVIL ++IS  NS +Y + R++ S+   G AP++L +  + G P  A+   +LVG + 
Sbjct: 378 INAVILISVISVANSALYAAPRLMCSLAQQGYAPRFLNYIDREGRPLRALAVCALVGVVG 437

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++  S      F WL  I  ++  F W  I ++HIRF +A+K QG S  +L +KA    W
Sbjct: 438 FVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLGELGYKANTGIW 497

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-P 509
           G+YY               A +P     K +V  FF  Y++  L+  +++G+ ++ +   
Sbjct: 498 GSYYGVFFNILVFMAQFWVALSPIGNGGKCDVQAFFEGYLAAPLWIFMYLGYMLYNKDFT 557

Query: 510 LFKKTEDIDLDTDRREIDNDVWEEDEPKN 538
           L    + IDLD  RR  D ++  +++ +N
Sbjct: 558 LLNPLDKIDLDFHRRVYDPEIMRQEDEEN 586

>TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  265 bits (678), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 172/541 (31%), Positives = 270/541 (49%), Gaps = 34/541 (6%)

Query: 32  ESLGSVKETQVK------RALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYM 85
           E  GS+ E +VK      R LK RHI +IALG  IGTGLFI     LS  GP   LI+Y+
Sbjct: 35  EEQGSISELEVKPQNEMVRGLKSRHIQLIALGDAIGTGLFIGSGGALSTCGPAPILISYI 94

Query: 86  FIGTLAYMVSQSLGEMATFIPV--TSSFMVFTQRFLSPALGAANGYMYFLSWSITFALEL 143
            +    + +   L EM   IP+   +S     + ++   L    G+  F + ++    E+
Sbjct: 95  VMSFFVWTIVNQLTEMVALIPLPGEASMYSLARMYVGRPLAFMCGWNLFYAMAMIAPSEI 154

Query: 144 SVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYA 203
           +    +IQ+WTDA     +I I  V  V+  + PV+ +GE EF ++ IK+L IVG II  
Sbjct: 155 TACAMLIQYWTDANS-AIFISIFIVFSVAITMLPVRVFGESEFCVSSIKLLTIVGLIIVG 213

Query: 204 FIMVCGAGKTGP--VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGT-EL 260
            ++  G G +    +GF YW+ PG +   ++    + G+FL   +++I + F++    E 
Sbjct: 214 IVIFFGGGPSQDHILGFHYWKKPGAFKEHLVPG--STGKFLAVWTAIIKSGFSFVLVPET 271

Query: 261 VGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL----KSEDSYIS 316
           V   + E+A+PR+ +PRA  +                      +D  L     S  S  +
Sbjct: 272 VASCSAESASPRRNMPRACQRFVYRLALFYVAGVLVVTVVVGSDDANLLNAIHSGASNAA 331

Query: 317 SSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTT 376
           +SP+VI I+ +G KVLPHI NA IL++  S G +++Y  SR+L+SM + G AP+      
Sbjct: 332 ASPYVIGIKEAGIKVLPHIINACILTSAYSCGTAELYGCSRILHSMAMKGDAPQIFAKVN 391

Query: 377 KSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQAL 436
           + G+PY +     L   LAYL  S  +S+VF+WL NI  ++GF +W+ +SV + RF   +
Sbjct: 392 RFGVPYYSTAVACLFTLLAYLNCSKSSSLVFNWLSNIATISGFISWVFVSVTYTRFRTVI 451

Query: 437 KHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-KFNVSDFFTAYVSVILF 495
               ++ D +PF+ +F    AY                 F    +N SDFF +YV++   
Sbjct: 452 DKLDLN-DRIPFRRRFQKGFAYACIAFFVLLSLTNGYAVFIKGNWNTSDFFASYVTIGFV 510

Query: 496 FAVWIGFQIWFRGPLFKKTEDIDLDTDRREI--DNDVWEEDE-------PKNLWEKFWSA 546
             ++IG  I+++   F+   +I      REI    D+ +EDE       PKN  EK W  
Sbjct: 511 AVLFIGSTIYYKELRFRDVSEIG-----REIIPKIDIADEDERNDVPVVPKNWGEKIWYT 565

Query: 547 V 547
           +
Sbjct: 566 I 566

>YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}
           AGP3Low-affinity amino acid permease, may act to supply
           the cell with amino acids as nitrogen source in
           nitrogen-poor conditions; transcription is induced under
           conditions of sulfur limitation; plays a role in
           regulating Ty1 transposition
          Length = 558

 Score =  265 bits (677), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 161/501 (32%), Positives = 252/501 (50%), Gaps = 17/501 (3%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
           +T VKRALK RHIS++ALGG IG G  +     L+  GP+  L+ +  IG +A+ V +S+
Sbjct: 46  QTGVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGIIAFSVMESI 105

Query: 99  GEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVP 158
           GEM T  P    F    +RF S AL A  GY Y + +    A E + +  ++QFW   VP
Sbjct: 106 GEMITLYPSGGGFTTLARRFHSDALPAVCGYAYVVVFFAVLANEYNTLSSILQFWGPQVP 165

Query: 159 LTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPV-G 217
           L  +I+I W       L  V  +GE E+W+A +K++ +V + I++ + + G  +  P  G
Sbjct: 166 LYGYILIFWFAFEIFQLVGVGLFGETEYWLAWLKIVGLVAYYIFSIVYISGDIRNRPAFG 225

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           F YW +PG    G          F G     +  +  Y GTE V + A E+ NP K VP 
Sbjct: 226 FHYWNSPGALSHG----------FKGIAIVFVFCSTFYSGTESVALAATESKNPGKAVPL 275

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           A+ +                      +DP L S  + +  SP  IAI  +G     H+ N
Sbjct: 276 AVRQTLWRILVVYIGIAVFYGATVPFDDPNL-SASTKVLKSPIAIAISRAGWAGGAHLVN 334

Query: 338 AVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYL 397
           A IL T ISA N  +YI SR L  +   GLAPK L WT + G+P  A+   + +G ++ +
Sbjct: 335 AFILITCISAINGSLYIGSRTLTHLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLM 394

Query: 398 ESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
             S GA+  + +++N++ V  F  W +IS  H+R  +A   QG S ++LP++A F PW  
Sbjct: 395 NVSVGAANAYSYIVNLSGVGVFIVWGVISYTHLRIRKAWVAQGRSIEELPYEALFYPWTP 454

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTE-- 515
             +             + F P F+  +F  AY+ + +   ++IG  + F+   F+  +  
Sbjct: 455 VLSLAANIFLALIQGWSYFVP-FDAGNFVDAYILLPVGILLYIGICV-FKSNHFRTVDLR 512

Query: 516 DIDLDTDRR-EIDNDVWEEDE 535
            I+LD  RR +++ D+ +++ 
Sbjct: 513 SINLDEGRRKDMEADLSDQES 533

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  265 bits (676), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 160/523 (30%), Positives = 266/523 (50%), Gaps = 16/523 (3%)

Query: 27  DVVSLESLGSVKETQ--VKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAY 84
           D+   ++   + +TQ  +K  +K RH++MI+LG  IGTGL ++    L   GP G +I Y
Sbjct: 51  DLEGKDADNGLNKTQQTLKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPAGLVIGY 110

Query: 85  MFIGTLAYMVSQSLGEMAT-FIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALEL 143
           +   T+ Y V Q+  E+   +  +  ++  +    +    G A   +Y L W+    LEL
Sbjct: 111 VTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLEL 170

Query: 144 SVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYA 203
                 +++WT +V    ++ I +V L+  +    + Y E EF    +KVL + GFII A
Sbjct: 171 VTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMA 230

Query: 204 FIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGI 263
             +  GA + G +G +YW +PG +G      D    RF G  S  + AAF Y G+E + +
Sbjct: 231 ISLTAGASEQGYIGGQYWHDPGAFG-----GDRAIDRFKGICSVWVQAAFAYGGSEFIAL 285

Query: 264 TAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSED--SYISSSPFV 321
           TA E ANPR++VP+A  +                      N  +L S +  S   +SPFV
Sbjct: 286 TAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSRASPFV 345

Query: 322 IAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIP 381
           IA    G +V+PHI N +IL+++IS GNS +Y + R+L S+  +G+ PK  T+  + G P
Sbjct: 346 IAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRP 405

Query: 382 YAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGI 441
              ++  SL G +A++ +S+    VF WL  I  ++  F W  I+V+H+RF +A++ QG 
Sbjct: 406 LVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGR 465

Query: 442 SRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILFF 496
           S  +L ++A     G+YYA              A AP     + +V  FF  Y++  +  
Sbjct: 466 SLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLV 525

Query: 497 AVWIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWEEDEPKN 538
             ++G+++W R   L   + ++DL + R+  D +V  ++E + 
Sbjct: 526 VFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAER 568

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  264 bits (675), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 170/535 (31%), Positives = 276/535 (51%), Gaps = 22/535 (4%)

Query: 27  DVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMF 86
            V+ +ES    ++  + R LK RH+ +IALG  IGTGLFI     LS  GP   LIAY  
Sbjct: 40  SVLDIES----QKPGIVRGLKSRHVQLIALGSAIGTGLFIGSGGALSICGPAPLLIAYAV 95

Query: 87  IGTLAYMVSQSLGEMATFIPV--TSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELS 144
           +    + V   + EM T IP+   S+     + +++  L    G+  F + ++    E++
Sbjct: 96  MSLFVWSVMNQMTEMVTLIPLPGESTLYSLLKLYVNKPLSFMCGWNLFYAQAMIAPAEVT 155

Query: 145 VVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAF 204
               ++Q+WTDA P   +I I  V+ V+  + PVK +GE EFW++ IK+L IVG II   
Sbjct: 156 ACALLVQYWTDANP-AIFISIFLVLSVAITMLPVKVFGESEFWVSSIKILTIVGLIIVGV 214

Query: 205 IMVCGAG--KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGT-ELV 261
           ++  G G  +   +GF YW+ PG + P ++  +   G+FL + +++I + F++    E+V
Sbjct: 215 VIFFGGGPAQEHVLGFHYWKKPGAFKPYLV--EGGTGKFLAFWTAIIKSGFSFVLVPEIV 272

Query: 262 GITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSS--- 318
              A EA  PR+ +PRA  +                      ++ +L +  +   SS   
Sbjct: 273 SSCAAEAVAPRRNMPRACKRFIYRLALFYVFGILVVGVIVGYDNDRLLNAIASGQSSAAA 332

Query: 319 -PFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTK 377
            PFVI I+ +G +VLPHI NA IL++  S G   +Y +SR L+SM   G AP+ LT   K
Sbjct: 333 SPFVIGIKEAGIRVLPHIINAAILTSAYSCGTGLLYGASRTLHSMACKGDAPRILTTVNK 392

Query: 378 SGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALK 437
            G+PY     TSL   LAYL  S+ +SVVF+WL NI  ++GF +W+L+S+A+IRF   + 
Sbjct: 393 YGVPYYCTGITSLFCLLAYLNCSNSSSVVFNWLSNIATISGFVSWVLVSIAYIRFRNVID 452

Query: 438 HQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-KFNVSDFFTAYVSVILFF 496
              ++ D +PF+  +    AY A               F    ++ S+FF AY+++    
Sbjct: 453 VLKLN-DRIPFRVPYQKPLAYLAMGFFSILTLTNGFAVFIKGNWDTSNFFAAYITLGFVL 511

Query: 497 AVWIGFQIWFRGPLFKKTEDIDLDTDRR----EIDNDVWEEDEPKNLWEKFWSAV 547
            +++G  I+++    +   +I+ D   +    E +   ++   P+N  EK W  +
Sbjct: 512 VLFVGSTIYYKEWRCRDIAEIEQDILPKITLAEAEEYEYDIPVPRNWLEKIWMVI 566

>ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {ON}
           conserved hypothetical protein
          Length = 567

 Score =  263 bits (672), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 168/499 (33%), Positives = 274/499 (54%), Gaps = 22/499 (4%)

Query: 32  ESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLA 91
           ES  +V   ++ R+L PRH++MIA+ G IGTGLF+S +  L+  GP   LI Y+ +G + 
Sbjct: 52  ESQDAVIRERLNRSLSPRHVNMIAIAGVIGTGLFLSTAKSLNAGGPGSLLINYVIMGGVI 111

Query: 92  YMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQ 151
           Y+   SLGEM+TF+P++ S+  ++++F+S +   A     + S +++ A +L+ +  V+ 
Sbjct: 112 YLTMLSLGEMSTFMPISGSYCAYSRKFVSESYCFALMCNMWYSDAVSVASDLTALQLVLD 171

Query: 152 FW---TDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVC 208
           +W   T   P  A  ++ W +++  N+  VK YGE E+W+A +KV+A++ F I A I  C
Sbjct: 172 YWKTNTHHFPYWAASLLFWFLILGLNVVHVKLYGEAEYWLAMLKVVAVIIFFIMAIIANC 231

Query: 209 GAGKTGP-VGFRYWRN-PGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAG 266
           G  +    +GF+ W +   P+  G          F G+V+  ++++F+Y GTE V +T G
Sbjct: 232 GHNQQHEYIGFKNWSHGDAPFVQG----------FKGFVTIFVTSSFSYGGTETVTLTGG 281

Query: 267 EAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIEN 326
           EA NP +  P+ I  V                     + P LK++   + +SPF I  + 
Sbjct: 282 EAKNPVRNTPKVIKTVFWRILVFYVFTMFFVGMDIPYDYPNLKTKS--VLTSPFTIVFQM 339

Query: 327 SGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAP--KYLTWTTKSGIPYAA 384
           +GTK      NAVI+++ ISA N  ++  SR+LY+MGL G  P  ++ T T ++  PY A
Sbjct: 340 AGTKAAGSFMNAVIMTSAISACNHALFGGSRILYNMGLEGFLPYSRFFTKTNRNKAPYVA 399

Query: 385 VLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRD 444
           V+TT  VG L +  S  GA  +F WL NI  V+   +W+ I+V  IRF + L+ QG    
Sbjct: 400 VITTWAVGGLCFGASFIGAGELFSWLQNIVGVSNQISWLSIAVISIRFRKGLEAQG-KVH 458

Query: 445 DLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQI 504
           +L F+    P+G ++              +AF P ++ S FF+ Y+ +I+F A WI + +
Sbjct: 459 ELKFRNWTYPYGPWFCIIFISLIILVQGWSAFDP-WSTSSFFSFYLELIVFPACWIFWWV 517

Query: 505 WFRGPLFKKTEDIDLDTDR 523
             +   FKK +D+D  TD+
Sbjct: 518 -IKRDRFKKAKDMDFITDK 535

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  263 bits (673), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 159/507 (31%), Positives = 256/507 (50%), Gaps = 15/507 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
           +  +K+A+K RH+ M++LG  IGTGL ++ +  L  AGP   +I Y  +  + Y V Q+ 
Sbjct: 74  DDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAA 133

Query: 99  GEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           GEMA   P +   F  +   F+S   G A  +++ + W     LEL      I++W D +
Sbjct: 134 GEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKI 193

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPV 216
               +++IL+V L+  +   V+ YGE EF     K+L I GF+I + ++ CG AG  G +
Sbjct: 194 NADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYI 253

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           G +YWR+PG +     + D    RF G    L++A F+Y G EL  ++  E  NPR++ P
Sbjct: 254 GGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTP 308

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVIAIENSGTKVLPHI 335
            A  +                      N D  + +  S   +SP+V+A+   G KV+PHI
Sbjct: 309 AAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHI 368

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            NAVIL ++ S  NS +Y S R+L S+   G APKY  +  + G P  A++  S+ G +A
Sbjct: 369 INAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIA 428

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           +   S    V+F WL  I  ++  F W  I ++H+RF  A+K QG S ++L + +    W
Sbjct: 429 FCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIW 488

Query: 456 GAYYAAXXXXXXXXXXXXTAFAPK-----FNVSDFFTAYVSVILFFAVWIGFQIWFRGPL 510
           G+ Y               A +P      ++   FF +Y++  ++   ++G+ ++ R   
Sbjct: 489 GSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFT 548

Query: 511 F-KKTEDIDLDTDRREIDNDVW-EEDE 535
           F    + IDLD  RR  D ++  +EDE
Sbjct: 549 FLTDLKKIDLDNHRRLYDPELLRQEDE 575

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  263 bits (672), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 159/498 (31%), Positives = 252/498 (50%), Gaps = 14/498 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
           + ++K  +K RH++MI+LG  IGTGL ++    L   GP G LI Y+   T+ Y V Q+ 
Sbjct: 68  QQKLKHNIKTRHLTMISLGTGIGTGLLVASGKALHYGGPGGLLIGYLTTSTMLYCVVQAC 127

Query: 99  GEMAT-FIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
            E+   +  +  ++  +    +    G A   +Y L W+I   LEL      I++WT++V
Sbjct: 128 CELGVAYATLPGNYNAYPTFLVDRGFGFAVALVYGLQWAIVLPLELVTASMTIKYWTESV 187

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVG 217
               ++ I ++ +V  +    + Y E EF    +KVL + GFII    + CGA K G +G
Sbjct: 188 NPDVFVAIFYLFIVFIHFFGSRGYAESEFIFNTLKVLLMAGFIIMGISLNCGASKLGYIG 247

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
            +YW NPG +      + +N  +  G  S  + +AF Y G+E + +TA E ANPR++VP 
Sbjct: 248 AKYWSNPGTFAG---ERSINHLK--GICSVWVQSAFAYGGSEFIALTAAEQANPRESVPS 302

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKL--KSEDSYISSSPFVIAIENSGTKVLPHI 335
           A  +                         +L   S  S   +SPFVIA    G K++PHI
Sbjct: 303 ATKRWLYRVVVVFLIPIALICFLVPYTSDQLLSSSGASASHASPFVIAAAYHGVKIVPHI 362

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            NA+IL+++IS GNS +Y + R+L S+  NGL PK  T+  ++G P A +L   + G L+
Sbjct: 363 INAIILTSVISVGNSGMYSAPRILLSLAENGLCPKIFTYVDRAGRPLATLLFVCVFGLLS 422

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++ +S     VF WL  I  ++  F W  I+++HIRF  A+K QG S  +L + +     
Sbjct: 423 FVAASKNQESVFTWLTAIAGLSQLFTWTSIALSHIRFRAAMKVQGRSLGELGYTSTTGAI 482

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-P 509
           G+YYA              A AP     + +   FF  Y++  +    ++G++IW+R   
Sbjct: 483 GSYYAVFFNIVVLVAQFWIAIAPIDKHGELDAESFFKNYLAFAVLVLFYVGYKIWYREVQ 542

Query: 510 LFKKTEDIDLDTDRREID 527
           L    + IDL+T R+  D
Sbjct: 543 LLIPVDKIDLETHRQIFD 560

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  264 bits (675), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 168/526 (31%), Positives = 276/526 (52%), Gaps = 22/526 (4%)

Query: 31  LES-LGSV--KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFI 87
           LES LG V  + + +K+ +K RH+ +I+LG  IGTGL +  +  L +AGP G +I Y  +
Sbjct: 103 LESGLGEVPGENSDLKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSIM 162

Query: 88  GTLAYMVSQSLGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVV 146
           G+  Y + Q+ GE+A  +  + S+F ++    +  A G A  ++Y L W     LEL   
Sbjct: 163 GSCLYCIIQACGELAVCYSSLPSNFNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVTA 222

Query: 147 GQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIM 206
              I++WT +V    ++ I +V+++  N    + Y E EF+    KVL + GF I   I+
Sbjct: 223 SMTIKYWTTSVNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFFILGIII 282

Query: 207 VCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITA 265
            CG AG +G +G +YW +PG +     ++ ++   F G +++  +AAF +  +E + +TA
Sbjct: 283 TCGGAGTSGYIGAKYWHSPGAFNG---NRPIDH--FKGVMATFTTAAFAFGASEFISLTA 337

Query: 266 GEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL-KSEDSYISSSPFVIAI 324
            E +NPRK +P+A   +                     N P L  S      +SP+V+A+
Sbjct: 338 AEQSNPRKAIPKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLGSGSDATKASPYVVAV 397

Query: 325 ENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAA 384
            + G +V+PH  NAVIL +++S GNS  Y SSR+L S+   G APK  T+  K G P  A
Sbjct: 398 ASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRGRPLVA 457

Query: 385 VLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRD 444
           ++ ++L   +A+  +S     VF WLL I+ ++  F W+ I ++H+RF +ALK QG S  
Sbjct: 458 MVCSTLFMTIAFCAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALKVQGHSLG 517

Query: 445 DLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWI 500
           ++ FK++   +G+ YAA             A AP      +  +FF  Y+++ +   ++ 
Sbjct: 518 EIGFKSQVGIYGSLYAATMLILALIAQFWVALAPIGGNGLDARNFFQNYLAMPILLVLYF 577

Query: 501 GFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWE------EDEPKNL 539
           G++I  R    +     IDL + R+  D D+ +      E E KNL
Sbjct: 578 GYKIRKRDWKFWIPAHRIDLVSHRKVFDEDILKQEVAEIEQEKKNL 623

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  263 bits (671), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 163/527 (30%), Positives = 270/527 (51%), Gaps = 18/527 (3%)

Query: 23  SRSKDVVSLESLGSVK-ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGAL 81
           +RS+DV   + + S++ +TQ K++L  RH+ M++LG  IGTGL ++ +  L   GP   +
Sbjct: 59  ARSEDVE--DGIASIRSDTQFKKSLSSRHVIMMSLGTGIGTGLLVANAKGLYYGGPGSLI 116

Query: 82  IAYMFIGTLAYMVSQSLGEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFA 140
           I Y+ +  + Y + Q+ GEMA   P +  +F  +   F+S + G A  +++ + W     
Sbjct: 117 IGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNAYQSIFISKSWGFATVWLFCIQWLTVLP 176

Query: 141 LELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANL-APVKFYGEVEFWIACIKVLAIVGF 199
           LEL      I++W D +    +++I +V LV+ +L   ++ YGE EF     K+L ++GF
Sbjct: 177 LELITSSLTIKYWNDKINADIFVMIFYVFLVAIHLVGGIRAYGETEFLFNSCKILMVIGF 236

Query: 200 IIYAFIM-VCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGT 258
           II + ++   GAG  G +G +YW  PG +  G  +      RF G    L+S  F+Y GT
Sbjct: 237 IILSIVINAGGAGNDGYIGGKYWHEPGSFAEGDATS-----RFKGICLVLVSGYFSYGGT 291

Query: 259 ELVGITAGEAANPRKTVPRAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISS 317
           EL  ++  E A PRK  P A  K +                     ND  + +  S   +
Sbjct: 292 ELYVLSVNEQAEPRKATPAAAKKSIYRILIIYLLTMILIGFNVPHNNDQLMGAGGSATHA 351

Query: 318 SPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTK 377
           SP+V+A    G K++PH  NAVIL ++IS  NS ++   R+L S+   G APK L++  +
Sbjct: 352 SPYVLAATIHGVKIVPHFINAVILISVISVANSSLFAGPRLLSSLATQGYAPKILSYVDR 411

Query: 378 SGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALK 437
            G P  A+  + L+G +A++  +     VF WL  I  ++  F W  I  +H+RF  A+K
Sbjct: 412 EGRPLVALGISFLIGLIAFVSCTSHEEEVFTWLAAIAGLSEIFTWSGIMFSHVRFRAAMK 471

Query: 438 HQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSV 492
            QG   ++L +KA    WG+ Y A             A AP     K +   FF +Y++ 
Sbjct: 472 VQGKDINELGYKANTGVWGSAYGAFFGVLVLIAQFWVALAPIGNGGKCDAEAFFESYLAF 531

Query: 493 ILFFAVWIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDVWEEDEPKN 538
            ++ A + G+ I+ +   L    + IDLD+ RR  D ++ ++++ +N
Sbjct: 532 PIWVACYFGYMIYNKDFTLLSPLDKIDLDSYRRIYDPELIKQEDEEN 578

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  261 bits (668), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 170/535 (31%), Positives = 265/535 (49%), Gaps = 27/535 (5%)

Query: 23  SRSKDVVSLESLGSVKE-------TQVKRALKPRHISMIALGGTIGTGLFISISTPLSNA 75
               D+VS+E   +VK        T++K+ LK RHI M+ L G  GTGLF+S    L   
Sbjct: 25  DEEHDIVSVEE--TVKRGVLHNDRTKLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKT 82

Query: 76  GPVGALIAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSW 135
           GPVG LIAY+F+G +      ++ E+A+F+P T + +   ++F+  ++G   G++   ++
Sbjct: 83  GPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDESVGFTFGWIS--TY 140

Query: 136 SITFALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLA 195
           S     ELS    ++++WTD  P   +I +  ++ V  N+  ++FYGE+E+    +K++ 
Sbjct: 141 SSLMPGELSATAVIMRYWTDVSP-AVFITVFGILFVVTNIYTIRFYGELEYIFGWLKLVL 199

Query: 196 IVGFIIYAFIMVCGAGK-TGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFT 254
           I   II   ++  G  K    +GF YWR PGP+   ++   +  G+F+G+ +++ S  ++
Sbjct: 200 IFILIISGLVIDLGGTKGQERLGFHYWREPGPFANYLVGGHI--GKFVGFWAAISSVVYS 257

Query: 255 YQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY 314
           Y G + + I AGE  N R  +      V                     ND  + +    
Sbjct: 258 YSGIQNIAILAGETKNSRHAIFHGAKNVFLRIIVLYLVTVFILTLIVPYNDKLIATGTGT 317

Query: 315 ISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTW 374
             SSPFVIA+  +G KVLPHI NA+IL++  SAGN  +   SR L+ +     APK    
Sbjct: 318 ARSSPFVIAMNRAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLR 377

Query: 375 TTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQ 434
           T+K GIPY  V+  S    LAY+  S  ++ VF W   + +      W+LIS  HI   +
Sbjct: 378 TSKRGIPYVGVIFISSFLPLAYMSCSKSSATVFGWFQELVSSNTLLRWILISANHIHMDR 437

Query: 435 ALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-KFNVSDFFTAYVSVI 493
           ALK QG SR DLP+     P+ A+++               F    F++  FFT Y  + 
Sbjct: 438 ALKAQGYSRSDLPYSTPMGPFAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIP 497

Query: 494 LFFAVWIGFQIWFRGPLFKKTEDID-LDTDRREIDNDVWEEDE----PKNLWEKF 543
           L   +   F  W    LFKKT+ +   + D   I +D+ E  E     KN W +F
Sbjct: 498 LAIGL---FTFW---KLFKKTKYLRPHEVDLESIFDDIKENPEHIVKTKNAWARF 546

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  262 bits (669), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 174/500 (34%), Positives = 262/500 (52%), Gaps = 17/500 (3%)

Query: 42  VKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEM 101
           +KR LK RH+ MI +GG IGTGLF+     L+ AGP G LI +   GT+ Y +  ++GE+
Sbjct: 76  LKRTLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAMGEL 135

Query: 102 ATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW-TDAVPLT 160
           A   PV   +  +  RF+  + G A   +Y + W IT  LE+      + +W T A    
Sbjct: 136 AVTFPVAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRD 195

Query: 161 AWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGF-R 219
           A++ + +VV+V  NL  VK YGE EF  + IKV+A++GFII   I+VCG G  G     R
Sbjct: 196 AFVALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYIGGR 255

Query: 220 YWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAI 279
            W NPG +  G          F G  S  ++AAF++ G+ELVG+ A E ANPRK++P A 
Sbjct: 256 LWHNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSIPSAA 305

Query: 280 NKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSY-ISSSPFVIAIENSGTKVLPHIFNA 338
            +V                        +L  + S   ++SPFVI+I+N+G K LP + N 
Sbjct: 306 KQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINV 365

Query: 339 VILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLE 398
           VIL  ++S GN  V+  SR + ++   G  PK   +  ++G P   ++ T + G L+++ 
Sbjct: 366 VILIAVLSVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLSFIA 425

Query: 399 SSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAY 458
           +S     VFDWLL ++ ++  F W  I + HIR  +AL  Q  +  +L F A    WG+ 
Sbjct: 426 ASPKEGEVFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAPTDVWGSV 485

Query: 459 YAAXXXXXXXXXXXXTAFAP---KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-PLFKKT 514
           Y+              A  P   K + + FF AY+S  ++   +IG +IW +   LF K 
Sbjct: 486 YSLILIILILIAQFWIALFPIGGKPSAAAFFEAYLSFPIYIVFYIGHKIWKKNWKLFIKA 545

Query: 515 EDIDLDTDRREIDNDVWEED 534
            DID+D+ RRE D +  +++
Sbjct: 546 SDIDIDSGRRETDIEALKQE 565

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  260 bits (665), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 158/441 (35%), Positives = 228/441 (51%), Gaps = 14/441 (3%)

Query: 22  FSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGAL 81
           F R  D       GS     +KR+LK RH+ MIA+GG+IGTGLF+     L+  GP+  +
Sbjct: 57  FHRCIDSFKPPENGSFDPDSLKRSLKSRHLIMIAIGGSIGTGLFVGSGKALAIGGPLAVI 116

Query: 82  IAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFAL 141
           I ++  GT        LGE+    PV  +F  +  RFL P+L      +Y L W     L
Sbjct: 117 IGWLIAGTQMVGTIHGLGEITVRFPVVGAFADYGTRFLDPSLSFVVSSIYVLQWFFVLPL 176

Query: 142 ELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFII 201
           E+      IQFW  ++    W+ I +V +V+ NL  V+ +GE EF  + IKV+ I GFII
Sbjct: 177 EIIASAMTIQFWNTSIDPVVWVAIFYVTIVAINLFGVRGFGEAEFLFSSIKVITISGFII 236

Query: 202 YAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTEL 260
              +++ G G T   VG RYW +PG    G          F G  S  ++A+++  G+E+
Sbjct: 237 LCIVLIVGGGPTHEYVGARYWHDPGALAHG----------FKGVASVFVTASYSLGGSEM 286

Query: 261 VGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPF 320
             + +GE  +P K +P AI +V                      +  L    S +++SPF
Sbjct: 287 ACLASGE-TDP-KELPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSS-VNNSPF 343

Query: 321 VIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGI 380
           VIA      KVLP I NAVIL +I+S GNS ++ SSR L SM   GL P+   +  ++G 
Sbjct: 344 VIACNLYHIKVLPSIINAVILVSIMSVGNSCIFASSRTLCSMAHQGLIPQIFGYVDRAGR 403

Query: 381 PYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQG 440
           P   ++T SL G LA+L  S   S VF+WL+ I  +A    W+ I+V+HIRF  A+K Q 
Sbjct: 404 PLVGIITNSLFGLLAFLVKSSSMSEVFNWLMAIAGLATCVVWLSINVSHIRFRMAMKAQD 463

Query: 441 ISRDDLPFKAKFMPWGAYYAA 461
            + D+L F +    WG+ Y+A
Sbjct: 464 KTLDELEFVSAVGIWGSVYSA 484

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  261 bits (668), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 157/509 (30%), Positives = 254/509 (49%), Gaps = 14/509 (2%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
           +  +K+A+K RH+ M+ LG  IGTGL ++    L+ AGP   ++ Y  +  + Y + Q+ 
Sbjct: 75  DDHMKKAMKSRHVIMMTLGTGIGTGLLVANGKGLALAGPAPLVLGYGLVSFVTYFMIQAA 134

Query: 99  GEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           GEMA   P + +SF  +   F+S   G A  +++ + W     LEL      I++W D +
Sbjct: 135 GEMAVTYPTMPASFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDTI 194

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPV 216
               +I+I +V L+  +   VK YGE EF     K+L I GFII + ++ CG AG+ G +
Sbjct: 195 NPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSIVINCGGAGRDGYI 254

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           G +YW NPG +     + +    RF G    L++  F+Y GTEL  ++  E  NPRK+ P
Sbjct: 255 GNKYWINPGAF-----ASESPAARFKGVAYILVTGYFSYGGTELFSLSVNEQKNPRKSTP 309

Query: 277 RAINK-VXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHI 335
            A  + +                     +D  + +  S   +SP+V+A    G KV+PH 
Sbjct: 310 AAAKQSIYRILIIYLLTMILIGFNVPHDSDQLMGAGGSATHASPYVLAASLHGVKVVPHF 369

Query: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395
            NAVIL +++S  NS +Y S R++ S+   G APK+  +  + G P  A+    L G + 
Sbjct: 370 INAVILISVVSVANSALYASPRLMRSLAEQGYAPKWFNYVDREGRPLRALCICGLFGVIG 429

Query: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455
           ++  S      F WL  I  ++  F W  I ++HIRF  A+K QG S ++L ++A    W
Sbjct: 430 FVACSPQEEQAFTWLAAIAGLSELFTWSSIFISHIRFRMAMKVQGKSLEELGYRATTGIW 489

Query: 456 GAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILFFAVWIGFQIWFRGPL 510
           G+ Y+              A +P     K++   FF +Y++  L+   + G+ I+ R   
Sbjct: 490 GSVYSVFFNMLVFIAQFWVALSPPKSNGKYDAEGFFESYLAAPLWLVFYFGYMIYSRDFT 549

Query: 511 FKKTED-IDLDTDRREIDNDVWEEDEPKN 538
           F    D IDLD  RR  D ++  +++ + 
Sbjct: 550 FLTPLDKIDLDFHRRIYDPELLRQEDAET 578

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  260 bits (665), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 160/490 (32%), Positives = 242/490 (49%), Gaps = 20/490 (4%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
           ++ VKR LK RHIS++ALGG IG G  I     L+  GP+  L+ +  IG LA+++ +S+
Sbjct: 53  DSGVKRQLKDRHISLLALGGIIGPGCLIGAGNALAIGGPLALLLGFGIIGILAFIMMESI 112

Query: 99  GEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVP 158
           GEM T  P    F   T+RF S AL A  GY Y + +    A E + +  ++QFW   VP
Sbjct: 113 GEMITLYPSGGGFTTLTRRFHSDALSAVCGYAYAVVFFAVLANEYNTLSSIMQFWGPQVP 172

Query: 159 LTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPV-G 217
           L  +I+I W       L  V  +GE E+W+A  K+L ++ + I++ + + G  K  P  G
Sbjct: 173 LYGYILIFWAAFQVFQLLGVGAFGETEYWLAWFKILGLLTYYIFSIVYISGGVKNRPAFG 232

Query: 218 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPR 277
           F+YW +PG    G          F G  +  +  +  Y GTE V + A E+ NPR+ VP 
Sbjct: 233 FQYWNDPGALSNG----------FKGIANVFVFCSTFYSGTESVALAATESKNPRRAVPI 282

Query: 278 AINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFN 337
           AI +                      ND  L    + +  SP  IAI  +G     H+ N
Sbjct: 283 AIRQTFWRILIVYLGISIFYGVTVPYNDENLNFA-TKVLKSPIAIAISRAGWPAGVHLVN 341

Query: 338 AVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYL 397
           A IL T ISA N  +YI SR L  +   GLAPK L WT + G+P  A+   + +G ++ +
Sbjct: 342 AFILITCISAINGSLYIGSRTLTHLANEGLAPKLLAWTDRRGVPIPAITVFNALGLISLM 401

Query: 398 ESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
             S  A   +++++N++ V  F  W +IS+ H+RF +A K QG +RD+LP+KAK  P   
Sbjct: 402 NVSVTAVDAYNYIVNLSGVGVFIVWGIISLTHLRFRKAWKLQGHTRDELPYKAKLFPVFP 461

Query: 458 YYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDI 517
             +             + F P F+  +F  AY+ +     +++G   W       KT+  
Sbjct: 462 IVSIIANIFLGLVQGWSYFKP-FDAKNFVDAYILIPAGIILYLGVSYW-------KTKGF 513

Query: 518 DLDTDRREID 527
               D  E++
Sbjct: 514 LTAVDLSEVN 523

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  263 bits (671), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 164/500 (32%), Positives = 263/500 (52%), Gaps = 16/500 (3%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           K  ++K+ +KPRH+ MI+LG  IGTGL + + + L  AGP G L+ +  +GT  Y + Q+
Sbjct: 145 KSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCIIQA 204

Query: 98  LGEMAT-FIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
           +GEMA  +  +   F  +    + PA G +  ++Y L W     LEL      I++WT  
Sbjct: 205 VGEMAVAYSDLVGGFNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWTTK 264

Query: 157 VPLTAWIIILWVVLVSANL-APVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KTG 214
           V    ++II +V++++ N+      Y E EF     K+L ++GF I   I++CG     G
Sbjct: 265 VDPDVFVIIFYVLILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGNDG 324

Query: 215 PVGFRYWRNPGPW-GPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
            +G +YW  PG + G   I       RF G +++L++AAF +  +E +G+TA E +NPRK
Sbjct: 325 YIGGKYWHEPGAFRGEHAID------RFKGVMATLVNAAFAFGMSEFIGVTASEQSNPRK 378

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVIAIENSGTKVL 332
            +P A  K+                     + D  L S    + +SP+V+A+   G KV+
Sbjct: 379 AIPSAAKKMLYRIVCMFLASITIVGFLVPYDSDQLLGSSGGGVKASPYVLAVSTHGVKVV 438

Query: 333 PHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVG 392
           PH  NAVIL +++S  NS  Y SSR+L S+   G APK   +  + G P   +   SL G
Sbjct: 439 PHFINAVILISVLSVANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASLFG 498

Query: 393 FLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKF 452
            +A+  +S     VF WLL I+ ++  F W+ I V+H+RF +A+  QG S  +L F+++ 
Sbjct: 499 VIAFCATSPKEDEVFVWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRSQV 558

Query: 453 MPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG 508
             WG+ YAA             A AP    K +  +FF  Y+++ +  A++ G++I+ + 
Sbjct: 559 GAWGSSYAAIMMVCILIAQFWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIYTKN 618

Query: 509 -PLFKKTEDIDLDTDRREID 527
             +F + +DIDL + R   D
Sbjct: 619 WTIFIRAKDIDLVSHRNIFD 638

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  261 bits (667), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 162/528 (30%), Positives = 265/528 (50%), Gaps = 32/528 (6%)

Query: 33  SLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAY 92
            L S ++  + +++K RH+ MI+LG  IGTGL +     L  AGP G ++ Y     + Y
Sbjct: 81  ELESQEKNNLTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGVASIMLY 140

Query: 93  MVSQSLGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQ 151
            + Q+ GE+   +  +T ++  +    + P+LG A   +Y + W     L+L      ++
Sbjct: 141 CIIQAAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVK 200

Query: 152 FWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-A 210
           +WT +V    ++ ++++ ++  NL   + Y E EF     K+L ++GF+I A I+ CG A
Sbjct: 201 YWT-SVNSDIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVIGFVILAIIINCGGA 259

Query: 211 GKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAAN 270
           G    +G  YW NPGP+  G          F G  +    AAF+Y G E++ ++A E  N
Sbjct: 260 GDRKYIGTEYWHNPGPFAHG----------FKGVCTVFCYAAFSYGGIEVLLLSAAEQEN 309

Query: 271 PRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYIS-SSPFVIAIENSG 328
           P K++P A  KV                     N D  L S+DS  S +SPFVIA+ + G
Sbjct: 310 PTKSIPNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSDDSSGSHASPFVIAVASHG 369

Query: 329 TKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTT 388
            KV+PH  NAVIL ++IS  NS +Y   R+L S+   G+ PK L +  + G P    L +
Sbjct: 370 VKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRRGRPLLCFLVS 429

Query: 389 SLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPF 448
              G + ++ +S     VF WLL I++++  F WM +S++HIRF  A+  QG S +++ +
Sbjct: 430 LAFGCIGFVATSDAEEEVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGY 489

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILFFAVWIGFQ 503
           KA+   WG++ A              A AP     K NV  FF  Y+++ +    + G +
Sbjct: 490 KAQTGYWGSWLAVLIAVFFLVCQFWVAIAPVNDHGKLNVKVFFQNYLAMPIVLVAYFGHK 549

Query: 504 IWFRG-PLFKKTEDIDLDTDRR-----------EIDNDVWEEDEPKNL 539
           I+F+    +   + IDL++ R            + D+DV E +  ++L
Sbjct: 550 IYFKSWSFWIPADKIDLNSHRNIFVHSTLTEFDKADDDVKEYENQESL 597

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  262 bits (670), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 158/519 (30%), Positives = 264/519 (50%), Gaps = 14/519 (2%)

Query: 33  SLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAY 92
           S+ + ++   K  +K RH+ M+ L   IGTGL ++ +  L  +GP G ++ Y  +  + Y
Sbjct: 145 SIAASEDMPKKGGMKARHVIMMTLATGIGTGLLVANAKSLHFSGPAGLVVGYFMVSFVTY 204

Query: 93  MVSQSLGEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQ 151
            V Q+ GEMA   P +   F  +   F+S   G A  +++ L+W     LEL      ++
Sbjct: 205 FVVQAAGEMAIAYPTLPGGFNTYQSLFISKPFGFATVWIFALNWLTILPLELITSSITVK 264

Query: 152 FWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-A 210
           +WT ++    +++I ++ L+  +   ++ Y E EF+    K+L I GFII++ ++ CG A
Sbjct: 265 YWTTSINPDIFVLIFYLFLLFVHFIGLRLYAEAEFFFNSCKILMITGFIIFSIVVNCGGA 324

Query: 211 GKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAAN 270
           G  G +G +YW +PGP+     + D    RF      LI+A F+Y GTEL  ++  E  N
Sbjct: 325 GHDGYIGGKYWHDPGPF-----ASDNGAARFKEVCYVLINAYFSYGGTELYVLSVNEQEN 379

Query: 271 PRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTK 330
           PRK VP A                         N P L    +   +SP+V+A +  G K
Sbjct: 380 PRKAVPVAAKTSVYRVAIIYLLTMILIGFNVPYNSPDLMGNANSKDASPYVLAAQIHGVK 439

Query: 331 VLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSL 390
           ++PH  NAVIL ++IS  NS ++   R+L ++   G APK+LT+  ++G P  A+   SL
Sbjct: 440 IVPHFINAVILLSVISVANSALFAGPRLLATLAEQGFAPKFLTYVDRAGRPLLALCVCSL 499

Query: 391 VGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKA 450
            G +A+  +S     VF WL  I  ++  FAW  I ++HIRF  A+K+ G S D++ +KA
Sbjct: 500 FGVIAFAATSKKEDEVFTWLAAIAGLSELFAWSGILLSHIRFRWAMKYHGKSMDEVGYKA 559

Query: 451 KFMPWGAYYAAXXXXXXXXXXXXTAF-AP----KFNVSDFFTAYVSVILFFAVWIGFQIW 505
               WG+YY               A  AP    +     FF +Y++ +++   ++ + I+
Sbjct: 560 ITGIWGSYYGLFFNLLVLIAQFWVALSAPGSGGQVTAISFFESYLAFVIWVFFYLCYMIY 619

Query: 506 FRG-PLFKKTEDIDLDTDRREIDNDVWEEDEPKNLWEKF 543
            +   +    +DID+D  RR  D D   +++ ++ +EK+
Sbjct: 620 NKDWTILIPLKDIDVDYQRRIYDADFLRQEKEES-YEKY 657

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  261 bits (666), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 158/495 (31%), Positives = 248/495 (50%), Gaps = 24/495 (4%)

Query: 39  ETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSL 98
           ETQ+ + +KPRHI MI+LG  IGTGL +     LS +GP G +I Y     + Y V Q+ 
Sbjct: 103 ETQLNKTMKPRHIVMISLGTGIGTGLLVGNGQVLSKSGPAGLVIGYGVASIMIYCVVQAA 162

Query: 99  GEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157
           GE+   +  +T ++  +    + PA+G A   +Y L W     L+L      I++WT  V
Sbjct: 163 GELGLVYSRLTGNYTTYPTYLIDPAVGFAVSMLYTLQWLTVLPLQLVTAAMTIRYWTTNV 222

Query: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPV 216
               ++  + V++++ N+   K Y E EF+  C K+L + GF+I   ++ CG AG    +
Sbjct: 223 NPDIFVAAILVLVIAINMFGAKGYAEAEFFCNCCKLLMMAGFVILGIVINCGGAGDKEYI 282

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276
           G +YW+ PG +  G          F G  +    AAF+Y G E++ +TA E ANPRK +P
Sbjct: 283 GVKYWQTPGAFANG----------FKGVAAVFCYAAFSYGGIEVLVLTANEQANPRKAIP 332

Query: 277 RAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL---KSEDSYISSSPFVIAIENSGTKVLP 333
            A  KV                     N P L    ++ S   +SPFVIA+ + G +V+P
Sbjct: 333 DACRKVVYRVLFLYMLTTIIVCFLVPYNSPALLGSNNDGSGSDASPFVIAVASHGVQVVP 392

Query: 334 HIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGF 393
           HI NA IL ++IS  NS +Y   R+L S+   G APK   +  + G P   VL +  +G 
Sbjct: 393 HIINAAILISVISVANSSLYSGPRLLLSLSQQGYAPKCFNYIDRRGRPIICVLVSVAMGL 452

Query: 394 LAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQ--GI-SRDDLPFKA 450
           +A+L +      VF WLL ++ ++  F WM I+++H+RF  A++ Q  G+ +RD + + A
Sbjct: 453 IAFLAAIPAREEVFTWLLAVSGLSQIFIWMSITISHLRFRDAIRSQLGGLRARDVVEYTA 512

Query: 451 KFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILFFAVWIGFQIW 505
           +    G+  A              A AP     + +V  FF  Y++  +    ++ ++IW
Sbjct: 513 QTGYVGSLVALAISIFILVCQFWVAIAPLGHNGQLDVQIFFENYLAAPVLLGGYLAYKIW 572

Query: 506 FRG-PLFKKTEDIDL 519
            R   L     +IDL
Sbjct: 573 HRDWRLCIPANEIDL 587

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  260 bits (665), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 168/514 (32%), Positives = 279/514 (54%), Gaps = 13/514 (2%)

Query: 32  ESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLA 91
             + + +   +++ +KPRH+ MI+LG  IGTGL +  S+ LS AGP   +I Y  +G+  
Sbjct: 112 RKVNNTESDDLQKTIKPRHVIMISLGTGIGTGLLVGNSSVLSAAGPAPLVIGYSIMGSCL 171

Query: 92  YMVSQSLGEMAT-FIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVI 150
           Y + Q+ GEMA  +  +   F  +    L PALG +  ++Y L W     LEL      I
Sbjct: 172 YCIIQAAGEMAVVYSDLNGGFNNYPSFLLDPALGFSVAWVYCLQWLCVCPLELVTASLTI 231

Query: 151 QFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG- 209
           ++WT  V    ++II +V+++S N+   + Y E EF+    KVL ++GF I   I+  G 
Sbjct: 232 KYWTTKVDPDVFVIIFYVLIISINVFGARGYAEAEFFFNVCKVLMMIGFFILGIIITAGG 291

Query: 210 AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAA 269
           AG  G +G +YW  PG +  G  + D    RF G + + ++AAF +  TE + +TA E +
Sbjct: 292 AGNDGYLGAKYWHEPGAF-RGEHAVD----RFKGVMDTFVAAAFAFGATEFIALTAAEQS 346

Query: 270 NPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVIAIENSG 328
           NPRK +P A  KV                     + D  L S  S + +SP+V+A+   G
Sbjct: 347 NPRKAIPSAAKKVLYRIVLIFLVSIIMLGFLVPYDSDQLLGSSGSGVKASPYVLAVSLHG 406

Query: 329 TKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTT 388
            +V+PH  NAVIL +++S GNS  Y SSR+L S+   G APK+  +  + G P  A+L +
Sbjct: 407 VRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSQQGYAPKWFDYVDRQGRPARAMLMS 466

Query: 389 SLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPF 448
           +L G +A+  +S   + VF+WLL I+ ++  F W  I ++H+RF  A+K QG S  ++ F
Sbjct: 467 ALFGVIAFCATSPKETDVFNWLLAISGLSQLFTWFAICMSHVRFRYAMKVQGRSIGEVGF 526

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQI 504
            ++   +G+ YAA             A AP    K +  +FF +Y+++ +  A++ G+++
Sbjct: 527 HSQTGVYGSLYAATMMILALMAQFWVAIAPLNEGKLDAQNFFQSYLAMPILIALYFGYKL 586

Query: 505 WFRG-PLFKKTEDIDLDTDRREIDNDVWEEDEPK 537
           ++R   L+ K + IDL + R+  D ++ ++++ +
Sbjct: 587 YYRDWKLYIKADKIDLISHRQIFDENILKQEDEE 620

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  259 bits (661), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 154/504 (30%), Positives = 255/504 (50%), Gaps = 16/504 (3%)

Query: 42  VKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEM 101
           +KR++KPRH++M+++   IGTGL ++    L   GP G +I Y  +  +AY++ Q+ GEM
Sbjct: 83  LKRSIKPRHVAMMSICTGIGTGLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQAAGEM 142

Query: 102 ATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLT 160
           A   P +  +F  ++ + +S   G A  ++Y + W     LEL      I++W D++   
Sbjct: 143 AVAYPSLPGNFNAYSSQLISRPFGFATVWLYCIQWLTVLPLELITASLTIKYWNDSINAD 202

Query: 161 AWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPVGFR 219
            +I I +V ++  +    + YGE EF     KVL I+GF+I + ++ CG AG    +G +
Sbjct: 203 VFIAIFYVFILFIHFFGSRGYGESEFIFGICKVLMIIGFVILSIVINCGGAGDRKYIGAK 262

Query: 220 YWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAI 279
           YW +PG +  G         +F G    L++  F+Y GTEL  +T  E +NPR+ +    
Sbjct: 263 YWYDPGAFAVG-----SGATKFKGVAYVLVTGYFSYGGTELYAMTVNEQSNPRRAIQSIT 317

Query: 280 NKVXXXXXXXXXXXXXXXXXXXXXNDPKL--KSEDSYISSSPFVIAIENSGTKVLPHIFN 337
            +                         +L   S  S   +SP+V+A+   G K++PHI N
Sbjct: 318 KQCIYRILLIYMLTMILIGFLVPHTSSELMGSSGKSATHASPYVLAVSLHGVKIVPHIIN 377

Query: 338 AVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYL 397
           AVIL  +IS GNS +Y   R+L ++   G AP++L +  ++G P  A++  S+ G LA++
Sbjct: 378 AVILIAVISVGNSAMYSGPRILNTLAEQGYAPRFLAYVDRAGRPLVALIACSVFGLLAFV 437

Query: 398 ESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGA 457
            +S     VF WL  I  ++  F W  I ++H+RF QA+++      +L +KA     G+
Sbjct: 438 AASDCEEDVFTWLAAIAGLSELFTWSAIMLSHVRFRQAMRYNNRPLSELGYKANTGVLGS 497

Query: 458 YYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-PLF 511
                            + AP     K +V  FF +Y++  L+  ++ G+ I FR   + 
Sbjct: 498 VLGLSFNILVFIAQFWVSIAPFGKDGKLDVLSFFQSYLAFPLWVVLFFGYMIVFRNWEII 557

Query: 512 KKTEDIDLDTDRREIDND-VWEED 534
           K  +DIDLD  R   D D +++ED
Sbjct: 558 KPLKDIDLDHYRSIYDQDRLYQED 581

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  257 bits (657), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 171/527 (32%), Positives = 262/527 (49%), Gaps = 18/527 (3%)

Query: 24  RSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIA 83
           RS D    + +     T++K+ LK RHI M+ L G  GTGLF+S    L   GPVG LIA
Sbjct: 26  RSTDETLKQGVLHNDRTKLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIA 85

Query: 84  YMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALEL 143
           Y+F+G +      ++ E+A+F+P T + +   ++F+  ++G   G++   ++S     EL
Sbjct: 86  YLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDESVGFTFGWIS--TYSSLMPGEL 143

Query: 144 SVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYA 203
           S    ++++WTD  P   +I I  V+ V  N+  ++FYGEVE+    +K++ I   II  
Sbjct: 144 SATAVIMRYWTDISP-AVFITIFGVLFVVTNIYTIRFYGEVEYVFGWLKLILIFILIISG 202

Query: 204 FIMVCGAGK-TGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVG 262
            ++  G  K    +GF YWR+PGP+   I+   +  G+F+G+ S+L S  ++Y G + + 
Sbjct: 203 LVIDLGGVKGQERLGFHYWRDPGPFAEYIVGGSI--GKFVGFWSALSSVVYSYSGIQNIA 260

Query: 263 ITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVI 322
           I AGE  N R  +      V                     ND  + S      SSPFVI
Sbjct: 261 ILAGETKNSRHAIYHGAKNVFLRIIVLYLVTVFVLTLIVPYNDALIASGTGTAKSSPFVI 320

Query: 323 AIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPY 382
           A+  +G KVLPHI NA++L++  SAGN  +   SR L+ +     APK    T+K GIPY
Sbjct: 321 AMNRAGIKVLPHIVNALVLTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPY 380

Query: 383 AAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGIS 442
             V+  S    LAY+  S  +S VF W   + +      W+LIS  HI   +ALK QG S
Sbjct: 381 VGVIFISCFLPLAYMSCSESSSTVFGWFQELVSSNTLLRWILISANHIYMDRALKAQGYS 440

Query: 443 RDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-KFNVSDFFTAYVSVILFFAVWIG 501
           R DLP+     P+ A+++               F    F++  FFT Y  + L   +   
Sbjct: 441 RSDLPYSTPIAPYAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGL--- 497

Query: 502 FQIWFRGPLFKKT-----EDIDLDTDRREIDNDVWEEDEPKNLWEKF 543
           F  W    LFKKT     E++DL +   +I  +    ++ K +W + 
Sbjct: 498 FTFW---KLFKKTRYLRPEEVDLASIFDDIRENPEHIEKSKPIWARL 541

>Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON}
           YBR069C (REAL)
          Length = 618

 Score =  259 bits (661), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 162/535 (30%), Positives = 262/535 (48%), Gaps = 32/535 (5%)

Query: 22  FSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGAL 81
           F R         L S +   + R++K RH+ MI+LG  IGTGL +     L  AGP G +
Sbjct: 70  FKRQLPADQNSELESQERNNLTRSIKSRHLIMISLGTGIGTGLLVGNGQVLGTAGPAGLV 129

Query: 82  IAYMFIGTLAYMVSQSLGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFA 140
           + Y     + Y + Q+ GE+   +  +T ++  ++   + P+LG A   +Y + W     
Sbjct: 130 LGYGIASIMLYCIIQAAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLP 189

Query: 141 LELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFI 200
           L+L      I++WT+ V    ++  +++ ++  NL   K Y E EF     K+L ++GF+
Sbjct: 190 LQLVTAAMTIKYWTN-VNADIFVAAVFIFVIIINLFGSKGYAEAEFMFNICKILMVIGFV 248

Query: 201 IYAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTE 259
           I A ++ CG AG    +G +YW NPGP+  G          F G  +    AAF+Y G E
Sbjct: 249 ILAIVINCGGAGDRKFIGTKYWHNPGPFAHG----------FKGVCTVFCYAAFSYGGIE 298

Query: 260 LVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL--KSEDSYISS 317
           ++ ++A E  NP K++P A  KV                     N  +L      S   +
Sbjct: 299 VLLLSAAEQENPTKSIPNACKKVVYRILFIYMLTTILICFLVPYNSDELLGSGSSSGSHA 358

Query: 318 SPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTK 377
           SPFVIA+ + G KV+PH  NAVIL ++IS  NS +Y + R+L S+   G  PK L +  +
Sbjct: 359 SPFVIAVASHGVKVVPHFINAVILISVISVANSSLYSAPRLLLSLAEQGFLPKCLAYVDR 418

Query: 378 SGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALK 437
           +G P    L + + G + ++ +S     VF WLL I++++  F WM +S++HIRF  A+ 
Sbjct: 419 NGRPLLCFLVSIIFGCIGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMA 478

Query: 438 HQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSV 492
            QG S D++ +KA+   WG++ A              A AP     K + + FF  Y+++
Sbjct: 479 KQGRSMDEVGYKAQTGYWGSWLAVLIALFFLVCQFWVAIAPVSKHGKLDANVFFQNYLAM 538

Query: 493 ILFFAVWIGFQIWFRG-PLFKKTEDIDLDTDR-----------REIDNDVWEEDE 535
            +    + G +I+ +    +   E IDLD+ R            +ID+D  +E E
Sbjct: 539 PIVLFAYFGHKIYTKSWKFWIPAEKIDLDSHRTIYVPPILMGTNKIDDDDLKEYE 593

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  259 bits (662), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 158/510 (30%), Positives = 260/510 (50%), Gaps = 16/510 (3%)

Query: 37  VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQ 96
           +  T +K+A+K RH+ M++LG  IGTGL ++ +  L   GP   +I Y+ +  + Y + Q
Sbjct: 110 ITNTHLKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGPAALVIGYVLVSFVTYFMIQ 169

Query: 97  SLGEMATFIP-VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTD 155
           + GEMA   P +  +F  ++  F+S A G A  +++ + W     LEL      I++W D
Sbjct: 170 AAGEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWLTVLPLELITASLTIKYWND 229

Query: 156 AVPLTAWIIILWVVLVSANL-APVKFYGEVEFWIACIKVLAIVGFIIYAFIM-VCGAGKT 213
            +    +I+I +V L+  +L   V  YGE EF     K+L ++GFII + ++   GAG  
Sbjct: 230 KINADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKILMVIGFIIMSIVINAGGAGNR 289

Query: 214 GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
             +G ++W +PG +     +      RF G    L+S  F+Y GTEL  ++  E +NPR+
Sbjct: 290 EYIGGKFWHDPGAF-----AGKTAGSRFKGICYVLVSGYFSYGGTELFALSVNEQSNPRR 344

Query: 274 TVPRA-INKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVL 332
           + P+A  + +                     +D  + S  S   +SP+V+A   +G K+ 
Sbjct: 345 STPQASKSSLYRILIIYLLTMILIGFNVPYDSDELMGSGGSATHASPYVLAASLNGVKIA 404

Query: 333 PHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVG 392
           PH  NAVIL ++IS  NS +Y + R++ S+   G APK+L +  + G P  A++   LVG
Sbjct: 405 PHFINAVILISVISVANSSLYAAPRLMCSLAQQGYAPKFLDYVDRQGRPLLALIACLLVG 464

Query: 393 FLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKF 452
            + ++ +S     VF WL  I  ++  F W  I ++H+RF  A+K Q  S ++L +KA  
Sbjct: 465 VIGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVRFRMAMKLQNRSLEELGYKATT 524

Query: 453 MPWGAYYAAXXXXXXXXXXXXTAFAP-----KFNVSDFFTAYVSVILFFAVWIGFQIWFR 507
             +G+ Y              TA  P     K N + FF  Y+++ ++   + G+ +W R
Sbjct: 525 GIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKANANSFFANYLAMPIWLVFYFGYMLWTR 584

Query: 508 G-PLFKKTEDIDLDTDRREIDNDVW-EEDE 535
              L K  + IDLD  RR  D ++  +EDE
Sbjct: 585 DFQLLKPLDKIDLDFHRRIYDPELMRQEDE 614

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score =  257 bits (656), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 172/523 (32%), Positives = 271/523 (51%), Gaps = 26/523 (4%)

Query: 23  SRSKDVVSLES----LGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPV 78
           S S D+  L S      +++E  + RAL PRHI+MI++ G IGTGL++S +  L N GP 
Sbjct: 24  SSSLDIDELRSDFDPEQNIRE-DLTRALSPRHINMISIAGIIGTGLYLSTAKSLHNGGPA 82

Query: 79  GALIAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSIT 138
              + Y  IG + Y+    LGEM+TF+P++ SF  + ++F S +   A  + Y+ + +++
Sbjct: 83  SLFMNYTIIGGVVYLTMLCLGEMSTFMPISGSFCSYARKFGSESFACALMWNYWFNDAVS 142

Query: 139 FALELSVVGQVIQFWTDA---VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLA 195
            A +L+ +  V+ +W  A    P     +I W  ++  N+  V+ YGE E+W+A +KV+A
Sbjct: 143 VASDLTALQLVLDYWHTADHHFPYWGASLIFWFFVLFLNVIHVRIYGEAEYWLAMLKVIA 202

Query: 196 IVGFIIYAFIMVCGAGKTGP-VGFRYWRN-PGPWGPGIISKDVNEGRFLGWVSSLISAAF 253
           IV F I + I+  G       +GF+ W +   P+  G          F G+ S  +SA F
Sbjct: 203 IVIFFIMSIIVNVGKNPQHEYIGFKNWTHGEAPFVNG----------FKGFASLFVSACF 252

Query: 254 TYQGTELVGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDS 313
            Y GTE + +T GEA+NP +  P+ +  V                     + P L ++  
Sbjct: 253 AYGGTESITLTGGEASNPVRNTPKIVKTVFWRILIFYVLSTFFIGMNIPYDYPGLSTKS- 311

Query: 314 YISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLT 373
            + +SPF +  + +GT+      NAVIL+++ISA N  ++  SR++Y+M L+G  PK + 
Sbjct: 312 -VMTSPFTLVFQMAGTRGAGSFMNAVILTSVISACNHALFAGSRIMYNMALDGYLPKKIV 370

Query: 374 -WTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRF 432
             T +   PY AVL T  VG L    S  GA  ++ WL NI  V+   AW+ I +  IRF
Sbjct: 371 GRTNRYKAPYVAVLITWAVGGLCLGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRF 430

Query: 433 MQALKHQGISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSV 492
            + L+ QG   D L FK    P+G Y+               AF P ++V+DFF+ Y+ +
Sbjct: 431 RKGLEVQG-KTDLLQFKNWTYPFGPYFLVIFTVFIILIQGWQAFDP-WSVTDFFSVYLEL 488

Query: 493 ILFFAVWIGFQIWFRGPLFKKTEDIDLDTDRREIDNDVWEEDE 535
            +F  V+I + +W R   F K ED+D  TDR     ++ E +E
Sbjct: 489 FVFPFVYIIWWLWKR-DWFVKYEDMDFVTDRYIPTKEIVELNE 530

>KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  257 bits (656), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 170/516 (32%), Positives = 278/516 (53%), Gaps = 22/516 (4%)

Query: 26  KDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYM 85
            +V +++   +++E  + RALKPRHI+MI++ G IGTGL++S ST L   GP    I Y 
Sbjct: 35  NEVYTIDPEANIRE-DLTRALKPRHINMISIAGIIGTGLYLSTSTSLHKGGPASLFINYS 93

Query: 86  FIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSV 145
            IG + Y+    L EM+T++P++ SF  + ++F S +   A  + Y+ + +++ A +L+ 
Sbjct: 94  LIGGIVYLTLLCLAEMSTYMPISGSFCTYAKKFGSDSFAMALMWNYWFNDAVSVASDLTA 153

Query: 146 VGQVIQFW-TDAVPLTAWI--IILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIY 202
           +  V+ +W TD+     W   +I W  ++S N+  V+FYGE E+W+A +KV+AI+ F I 
Sbjct: 154 LQLVMDYWNTDSNHFPYWAASLIFWFFVLSLNVIHVRFYGEAEYWLAMLKVIAIIIFFIM 213

Query: 203 AFIMVCGAGKTGP-VGFRYWR-NPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTEL 260
           + I+  G       +GF+ W     P+  G          F G+ S  +SA+F Y GTE 
Sbjct: 214 SIIVNVGHNPQHEYIGFKNWTVGEAPFVDG----------FKGFASLFVSASFAYGGTES 263

Query: 261 VGITAGEAANPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPF 320
           + +T+GE+ NP +  P+ +  V                     N P L S    + +SPF
Sbjct: 264 ITLTSGESDNPLRNTPKIVKTVFWRILFFYIGTTFFIAMNVPYNYPGLSSGS--VVTSPF 321

Query: 321 VIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYL-TWTTKSG 379
            I  + +GT       NAVI++++ISA N  ++  SR++Y+MGL G  PK + + T +  
Sbjct: 322 TIVFKMAGTAGAGSFMNAVIMTSVISACNHALFAGSRIMYNMGLEGYLPKSIVSRTNRYK 381

Query: 380 IPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQ 439
           +PY AVL T  VG L +  S  GA  ++ WL NI  V+   AW+ I++  IRF Q L+ Q
Sbjct: 382 VPYVAVLITWAVGGLCFGASFIGAGTLWTWLQNIVGVSNQLAWLCIAITSIRFRQGLEAQ 441

Query: 440 GISRDDLPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVW 499
             +  +L FK    P+G Y+              ++FAP +NVS+FF+ Y+ + +F   +
Sbjct: 442 NKTH-ELKFKNWTYPFGPYFLVVAVTFIILVQGWSSFAP-WNVSNFFSVYIELFVFPFCF 499

Query: 500 IGFQIWFRGPLFKKTEDIDLDTDRREIDNDVWEEDE 535
           I + ++ R P F K +D+D  TD+     ++ E +E
Sbjct: 500 IIWWLYKRDP-FVKCKDMDFVTDKYVPSQEIIELNE 534

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score =  258 bits (659), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 167/506 (33%), Positives = 261/506 (51%), Gaps = 13/506 (2%)

Query: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97
           K   +K+ ++PRH+ MI+L   IGTG+ +     L N GP   +I Y  + ++ Y V QS
Sbjct: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136

Query: 98  LGEMAT-FIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156
             E+A  +  +   F  +    +  A G +  ++Y L W     LEL      I++W   
Sbjct: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196

Query: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGP 215
           +   A++ I +VVLV+ N      Y E EF+  C KVL I+GF I   I+ CG AG  G 
Sbjct: 197 INPDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKVLMIIGFFILGIIINCGGAGNDGY 256

Query: 216 VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTV 275
           +G RYW +PG +     S  +N  RF G V+ L++AAF Y G E   +TA E  NP+K++
Sbjct: 257 LGARYWHDPGAFRG---SDSIN--RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 311

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXN-DPKLKSEDSYISSSPFVIAIENSGTKVLPH 334
             A  K+                     N D  L S  S   +SPFVIA+ + G +V+PH
Sbjct: 312 RSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPH 371

Query: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394
             NAVIL +++S  NS +Y SSR+L S+   G AP++L +  + G P   +L + + G L
Sbjct: 372 FINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431

Query: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454
           +++ +S     VF WLL I+ ++  F W  IS++H+R  +A+  QG S D+L + A    
Sbjct: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491

Query: 455 WGAYYAAXXXXXXXXXXXXTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG-P 509
           WGAYYA              A +P    K + ++FF  Y+++ +   +++G++IW R   
Sbjct: 492 WGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR 551

Query: 510 LFKKTEDIDLDTDRREIDNDVWEEDE 535
           L   + ++DL   R+  D +V   ++
Sbjct: 552 LLIPSSEVDLVAHRKIFDAEVLRHEQ 577

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  257 bits (656), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 160/511 (31%), Positives = 264/511 (51%), Gaps = 21/511 (4%)

Query: 41  QVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGE 100
           Q++R LK RH+ +IALG  IGTGLFI     LS  GP   LI+Y+ +    + +   L E
Sbjct: 58  QMQRGLKSRHMQLIALGCAIGTGLFIGTGGALSTCGPAPLLISYIIMSFFVWTIMHQLTE 117

Query: 101 MATFIPV--TSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVP 158
           M    P+   +S     + +L+  L    G+  F + ++    E++    +IQ+WTDA  
Sbjct: 118 MVVLTPIPGEASMYALARAYLNRPLSFMCGWNLFYAQAMIAPSEITASTLLIQYWTDANS 177

Query: 159 LTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG--KTGPV 216
              ++ I  V+ ++    PVK +GE EFW++ IK++ I G II   ++  G G  +   +
Sbjct: 178 -AIFVSIFIVITIAVTALPVKVFGESEFWVSMIKLITITGLIILGVVIFFGGGPNQHHVL 236

Query: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTY-QGTELVGITAGEAANPRKTV 275
           GF YW++PG + P I +   N G+FL   +++I + F +    E +   + EA  PR+ +
Sbjct: 237 GFHYWKHPGAFKPHISTG--NTGKFLAVWTAIIKSGFAFILSPETLTSCSAEADRPRRNM 294

Query: 276 PRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKL----KSEDSYISSSPFVIAIENSGTKV 331
           PRA N+                      ++  L     S  S  ++SPFVI I+  G KV
Sbjct: 295 PRAANRFVWRLMLFYIGGALVVGVTVGYDNQNLLSAIASGQSNAAASPFVIGIKEVGIKV 354

Query: 332 LPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLV 391
           LPHI NA IL+   SAG +++Y +SR+L+SM L G APK      + G+PY +++  S  
Sbjct: 355 LPHIINAAILTGAYSAGTAEMYGASRMLHSMALKGNAPKIFARVNRYGVPYYSIIVPSCF 414

Query: 392 GFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAK 451
            FLAYL  S+ AS VF WL NI+ ++GF +W+ +S+ ++RF + + +  ++ D + F+  
Sbjct: 415 CFLAYLNCSNSASQVFTWLTNISTISGFISWVFVSITYVRFRRVIDYLDLN-DRIKFRKP 473

Query: 452 FMPWGAYYAAXXXXXXXXXXXXTAFAP-KFNVSDFFTAYVSVILFFAVWIGFQIWFRGPL 510
           F    AY++               F    ++VSDFF  Y+++     ++I    +++   
Sbjct: 474 FQRIFAYFSGCFFVILSLTNGYAVFTKGNWSVSDFFANYITIGFVVVLFIMGTAYYKEWR 533

Query: 511 FKKTEDIDLDTDRREI--DNDVWEEDEPKNL 539
           F+  E+I     R E+    D+ +E+E   +
Sbjct: 534 FRDMEEI-----RSELIPKIDMADEEESNEI 559

>Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL020W
           (TAT2) - Tryptophan permease, high affinity [contig 265]
           PARTIAL
          Length = 481

 Score =  254 bits (648), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 150/428 (35%), Positives = 222/428 (51%), Gaps = 14/428 (3%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           GS     +K++LK RH+ MIA+GG+IGTGLFI     L+  GP+  +I +   GT     
Sbjct: 66  GSFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVGT 125

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
              LGE+    PV  +F  +  RFL P++      +Y L W     LE+      +++W 
Sbjct: 126 IHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWD 185

Query: 155 DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KT 213
            +V    W+ I + ++   NL  V+ +GE EF  + IKV+ IVGFII   +++CG G K 
Sbjct: 186 TSVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGPKK 245

Query: 214 GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
             VG +YW +PGP   G          F G    L+ A+++  GTE+  + +GE  +P K
Sbjct: 246 EFVGAKYWHDPGPLANG----------FKGVAGVLVIASYSLGGTEMACLASGE-TDP-K 293

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
            +P AI +V                      +  L    S + +SPFVIAI   G   LP
Sbjct: 294 ELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMGGSS-VDNSPFVIAIRLHGINALP 352

Query: 334 HIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGF 393
            I NAVIL +++S GNS ++ SSR L SM   GL P+   +  ++G P   +LT  L G 
Sbjct: 353 SIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGL 412

Query: 394 LAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFM 453
           LA+L  S  A  VF WL+ I  +A    W+ I+++HIRF  A+K QG+  ++L F +   
Sbjct: 413 LAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEFVSGVG 472

Query: 454 PWGAYYAA 461
            +G+ Y+A
Sbjct: 473 IYGSVYSA 480

>TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {ON}
           Anc_3.397 YBR132C
          Length = 575

 Score =  256 bits (654), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 169/521 (32%), Positives = 260/521 (49%), Gaps = 28/521 (5%)

Query: 40  TQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLG 99
           TQ  R LK RH+ +IA+ G IGT LF++I   L   GP   LIA+         ++ S  
Sbjct: 60  TQTFRRLKNRHVQLIAISGVIGTALFVAIGKALYKGGPAFLLIAFALWCVPILCITVSTA 119

Query: 100 EMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTD---- 155
           EM  F+PV+S F+    R    +L     + ++    +    E+  V  +I +W D    
Sbjct: 120 EMVCFLPVSSPFLRLAARCADDSLAVMASWNFWFLQCVQIPFEIVSVNTIIHYWRDDYSA 179

Query: 156 AVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFI-MVCGAGKTG 214
           A+PL   I++ +++ + A    VK+YGE EFW+A  K++  +G  ++ FI M+ G  K  
Sbjct: 180 AIPLVVQIVLYFLISICA----VKYYGETEFWLASFKIILALGLFLFTFITMLGGNPKHD 235

Query: 215 PVGFRYWRNPGPWGPGIISKDVNEGR----FLGWVSSLISAAFTYQGTELVGITAGEAAN 270
             GFRY+    P+     + D + G     F G+++ LI A+FT  G E + + AGE   
Sbjct: 236 RYGFRYY-GETPFKKYYPNGDKDAGASVGYFQGFLACLIQASFTIAGGEYISMLAGEVKL 294

Query: 271 PRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKS--EDSY--ISSSPFVIAIEN 326
           PRK +PRA  +V                     NDP L +  ++S     SSP+VIA+ N
Sbjct: 295 PRKVLPRAFKQVFYRLTFLFLGSCLCVGIICSANDPALTAAIDESRPGAGSSPYVIAMNN 354

Query: 327 SGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVL 386
            G KVLP I NA +++   SAGN+  Y SSR LY M L+G AP+  T   K G+P  +VL
Sbjct: 355 LGIKVLPDIVNAALITAAFSAGNAYTYCSSRTLYGMALDGYAPRIFTRCNKHGVPIYSVL 414

Query: 387 TTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQA-LKHQGISRDD 445
            + L G ++ L+ +  ++VV +WL+N+   +    + ++ + ++ F +A L H+ I    
Sbjct: 415 ISLLWGLISLLQLNDNSAVVLNWLINLITASQLINFTVLCIIYLFFRRAYLLHKDI-LPK 473

Query: 446 LPFKAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKF-NVSDFFTAYVSVILFFAVWIGFQ- 503
           LPFK+   P+ A                T F P    V DF   Y+ V +   ++IG++ 
Sbjct: 474 LPFKSWGQPYTAIVGLVSATAMILIQGYTVFFPSLWTVRDFLFCYLMVFIDIGIYIGYKF 533

Query: 504 IWFRG-PLFKKTEDIDLDTDRREIDNDVWEEDEPKNLWEKF 543
           IW RG   FK  + +D   D +EI     E  E  + +EKF
Sbjct: 534 IWRRGRDKFKDPKTVDFSKDLKEI-----ESHEVDHSFEKF 569

>NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  256 bits (653), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 170/520 (32%), Positives = 282/520 (54%), Gaps = 29/520 (5%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
            +++E  + RALKPR ++MI++ G IGTGL++S S  L   GP    + Y  +G + Y+ 
Sbjct: 44  ANIRE-DLTRALKPRVVNMISIAGIIGTGLYLSTSKSLHTGGPASLFMNYTIMGGVVYLT 102

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
             +LGEM+T++P++ SF V+ ++F S +   A  + Y+ + +++ A +L+ +  V+ +W 
Sbjct: 103 LLALGEMSTYMPISGSFCVYARKFGSESFACALMWNYWFNDAVSVASDLTALQLVMDYWK 162

Query: 155 DA---VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG 211
            +    P  A  +I W V+V  N+  V+FYGE E+W+A +K++AI+ F I + ++  G  
Sbjct: 163 TSEHGFPYWAASLIFWFVVVCLNVIHVRFYGEAEYWLAMLKIIAIIIFFILSIVVNVGKN 222

Query: 212 KTGP-VGFRYW-RNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAA 269
                +GF+ W R   P+  GI           G+ S  +SA+F Y GTE + +T GEA 
Sbjct: 223 PQHEYIGFKNWTRGEAPFVDGI----------KGFASLFVSASFAYGGTESITLTNGEAE 272

Query: 270 NPRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGT 329
           NP +  P+ +  V                     + P L S+   I +SPF +  + +GT
Sbjct: 273 NPIRNTPKIVKTVFWRILIFYVGSTFFIAMNIPYDYPGLDSKS--IVTSPFTLVFQMAGT 330

Query: 330 KVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAP-KYLTWTTKSGIPYAAVLTT 388
           K      NAVI++++ISA N  ++  SR++Y+MGL G  P + ++ T ++ +PY +VL T
Sbjct: 331 KGAGSFMNAVIMTSVISACNHALFAGSRIMYNMGLEGFLPARIVSRTNRNKVPYVSVLIT 390

Query: 389 SLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPF 448
           + VG L +  S  GA  ++ WL NI  V+   AW+ I +  IRF + L+ QG +  +L +
Sbjct: 391 AAVGALCFGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQGKTH-ELIY 449

Query: 449 KAKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWF-- 506
           K    P+G Y+              +AFAP +NVS+FF+ Y+ + +F    + F IW+  
Sbjct: 450 KNWTYPYGPYFVIIFVSFIILIQGWSAFAP-WNVSNFFSYYLELFVFP---VCFIIWWLV 505

Query: 507 RGPLFKKTEDIDLDTDRREIDNDVWEEDEP-KNL--WEKF 543
           +   F K ED+D  TDR     ++ E +E   NL  W+K+
Sbjct: 506 KRDRFVKYEDMDFTTDRYIPTKEIIELNETLDNLKGWKKY 545

>Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON}
           ANNOTATED BY YGOB - YOL020W (TAT2) - Tryptophan
           permease, high affinity [contig 265] PARTIAL
          Length = 491

 Score =  254 bits (648), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 150/428 (35%), Positives = 222/428 (51%), Gaps = 14/428 (3%)

Query: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94
           GS     +K++LK RH+ MIA+GG+IGTGLFI     L+  GP+  +I +   GT     
Sbjct: 66  GSFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVGT 125

Query: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154
              LGE+    PV  +F  +  RFL P++      +Y L W     LE+      +++W 
Sbjct: 126 IHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWD 185

Query: 155 DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KT 213
            +V    W+ I + ++   NL  V+ +GE EF  + IKV+ IVGFII   +++CG G K 
Sbjct: 186 TSVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGPKK 245

Query: 214 GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRK 273
             VG +YW +PGP   G          F G    L+ A+++  GTE+  + +GE  +P K
Sbjct: 246 EFVGAKYWHDPGPLANG----------FKGVAGVLVIASYSLGGTEMACLASGE-TDP-K 293

Query: 274 TVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTKVLP 333
            +P AI +V                      +  L    S + +SPFVIAI   G   LP
Sbjct: 294 ELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMGGSS-VDNSPFVIAIRLHGINALP 352

Query: 334 HIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGF 393
            I NAVIL +++S GNS ++ SSR L SM   GL P+   +  ++G P   +LT  L G 
Sbjct: 353 SIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGL 412

Query: 394 LAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFM 453
           LA+L  S  A  VF WL+ I  +A    W+ I+++HIRF  A+K QG+  ++L F +   
Sbjct: 413 LAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEFVSGVG 472

Query: 454 PWGAYYAA 461
            +G+ Y+A
Sbjct: 473 IYGSVYSA 480

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  255 bits (652), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 163/508 (32%), Positives = 276/508 (54%), Gaps = 26/508 (5%)

Query: 36  SVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVS 95
           +++E  ++RALKPRHI+MI++ G IGTGL++S +  L   GP    + Y  +G + Y+  
Sbjct: 49  NIRE-DLQRALKPRHINMISIAGVIGTGLYLSTAKSLYQGGPASLFMNYTIMGGVVYLTL 107

Query: 96  QSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW-T 154
             LGEM+T++P++ SF  + ++F S +   A  + Y+ + +++ A +++ +  V+ +W T
Sbjct: 108 LCLGEMSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDMTALQLVMDYWDT 167

Query: 155 DAVPLTAWI--IILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGK 212
           +A     W   ++ W ++V  N+  V+FYGE E+W+A +KV+AI+ F I + ++  G   
Sbjct: 168 EASGFPYWAASLLFWFLVVLLNVIHVRFYGEAEYWLAMLKVIAIIIFFILSIVVNVGHNP 227

Query: 213 TGP-VGFRYWRN-PGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAAN 270
               +GF+ W +   P+  G          F G+ S  +SA+F Y GTE + +T GEAAN
Sbjct: 228 QHEYIGFKNWNHGEAPFVDG----------FKGFASLFVSASFAYGGTESITLTNGEAAN 277

Query: 271 PRKTVPRAINKVXXXXXXXXXXXXXXXXXXXXXNDPKLKSEDSYISSSPFVIAIENSGTK 330
           P +  P+ +  V                     + P L ++   + +SPF +  + +GTK
Sbjct: 278 PLRNTPKIVKTVFWRILVFYVGSTFFIAMNIPYDYPGLDTKS--VVTSPFTLVFQMAGTK 335

Query: 331 VLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYL-TWTTKSGIPYAAVLTTS 389
                 NAVI++++ISA N  ++  SRV+Y+MGL G  PK + + T +  +PY +VL TS
Sbjct: 336 AAGSFMNAVIMTSVISACNHALFAGSRVMYNMGLEGFLPKKIVSRTNRYKVPYVSVLITS 395

Query: 390 LVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFK 449
            +G L +  S  GA  V+ WL NI  V+   AW+ I +  IRF + L+ QG +  +L +K
Sbjct: 396 SIGLLCFGASFIGAGTVWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQGKTH-ELRYK 454

Query: 450 AKFMPWGAYYAAXXXXXXXXXXXXTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIW--FR 507
               P+G Y+              +AF P ++V++FF+ Y+ + +F   +I   IW  ++
Sbjct: 455 NWTYPYGPYFLVIFVTFIILVQGWSAFDP-WDVTNFFSYYLDLFVFPFCFI---IWWLYK 510

Query: 508 GPLFKKTEDIDLDTDRREIDNDVWEEDE 535
              F K ED+D  TDR     ++ E +E
Sbjct: 511 RDRFVKLEDMDFVTDRYIPTKEIIELNE 538

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.137    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,998,110
Number of extensions: 1899464
Number of successful extensions: 8131
Number of sequences better than 10.0: 407
Number of HSP's gapped: 6715
Number of HSP's successfully gapped: 430
Length of query: 548
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 433
Effective length of database: 40,294,809
Effective search space: 17447652297
Effective search space used: 17447652297
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 68 (30.8 bits)