Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0C02618g1.82ON1988196288650.0
KLTH0F02376g1.82ON1976113327820.0
Kwal_33.133921.82ON1968116827300.0
KLLA0C02321g1.82ON1842116022120.0
Ecym_10861.82ON2091103721690.0
TDEL0C061901.82ON1879112320840.0
Smik_14.661.82ON1952117520160.0
CAGL0J08206g1.82ON1898113820010.0
KAFR0D039501.82ON1957114019960.0
Suva_14.711.82ON1948111319920.0
ZYRO0F16676g1.82ON1994110919580.0
YNL271C (BNI1)1.82ON195361718560.0
NCAS0A005901.82ON194664718540.0
TPHA0B044901.82ON1940115618460.0
AFR669W1.82ON191875418430.0
Skud_14.691.82ON194662618400.0
KNAG0F004701.82ON202864317870.0
TBLA0A054401.82ON217064517510.0
NDAI0F042201.82ON202262517220.0
Kpol_2000.661.82ON193068316860.0
NCAS0G001205.717ON13144667622e-81
CAGL0H06765g5.717ON12944657487e-80
SAKL0E15224g5.717ON13354577444e-79
Ecym_5679na 1ON13063727301e-77
Kpol_416.105.717ON14914737152e-75
TDEL0F055605.717ON12924697086e-75
KLLA0F10912g5.717ON12834817024e-74
AFR301C5.717ON16553787048e-74
NDAI0F001605.717ON13494507008e-74
AGL364Cna 1ON12604046971e-73
Ecym_40045.717ON14544707002e-73
Kwal_55.196205.717ON13894776874e-72
ZYRO0B16654g5.717ON14243736841e-71
Smik_9.95.717ON13744846794e-71
Skud_9.85.717ON13744836713e-70
YIL159W (BNR1)5.717ON13754836696e-70
KNAG0L022505.717ON13674736633e-69
KLTH0E00704g5.717ON13893976562e-68
TPHA0E001205.717ON16424596394e-66
KAFR0D021205.717ON13244006321e-65
TBLA0E018105.717ON14514606332e-65
Suva_9.265.717ON13753786251e-64
CAGL0F04301g3.321ON148399792.6
ZYRO0G17996g7.488ON145554765.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0C02618g
         (1988 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] ...  3419   0.0  
KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] ...  1076   0.0  
Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] ...  1056   0.0  
KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] ...   856   0.0  
Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON...   840   0.0  
TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_...   807   0.0  
Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {...   781   0.0  
CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} simi...   775   0.0  
KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1....   773   0.0  
Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847...   771   0.0  
ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} som...   758   0.0  
YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}...   719   0.0  
NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {...   718   0.0  
TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_...   715   0.0  
AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic...   714   0.0  
Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {...   713   0.0  
KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON}     692   0.0  
TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa]...   679   0.0  
NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON}           667   0.0  
Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 193...   654   0.0  
NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717      298   2e-81
CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] ...   292   7e-80
SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa...   291   4e-79
Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} simila...   285   1e-77
Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] ...   280   2e-75
TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa]...   277   6e-75
KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} som...   275   4e-74
AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON} ...   275   8e-74
NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717     274   8e-74
AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON} Sy...   273   1e-73
Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to ...   274   2e-73
Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W...   269   4e-72
ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa...   268   1e-71
Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   266   4e-71
Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   263   3e-70
YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,...   262   6e-70
KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] ...   259   3e-69
KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some si...   257   2e-68
TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717 ...   250   4e-66
KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5....   248   1e-65
TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {...   248   2e-65
Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (R...   245   1e-64
CAGL0F04301g Chr6 (426122..430573) [4452 bp, 1483 aa] {ON} simil...    35   2.6  
ZYRO0G17996g Chr7 (1477518..1481885) [4368 bp, 1455 aa] {ON} wea...    34   5.4  

>SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1988

 Score = 3419 bits (8865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1724/1962 (87%), Positives = 1724/1962 (87%)

Query: 27   LFSNLKKLTGSGNNANTSNKIEPSDISSPKIVSTPAVPEFSGKPLSKQTTLNTQNLSSYV 86
            LFSNLKKLTGSGNNANTSNKIEPSDISSPKIVSTPAVPEFSGKPLSKQTTLNTQNLSSYV
Sbjct: 27   LFSNLKKLTGSGNNANTSNKIEPSDISSPKIVSTPAVPEFSGKPLSKQTTLNTQNLSSYV 86

Query: 87   DMNTPHHNRSPSGMSGSPTKYSYSRRSSQWSNGNNIGNGGRLSRQQTNQSLSSASIFSQG 146
            DMNTPHHNRSPSGMSGSPTKYSYSRRSSQWSNGNNIGNGGRLSRQQTNQSLSSASIFSQG
Sbjct: 87   DMNTPHHNRSPSGMSGSPTKYSYSRRSSQWSNGNNIGNGGRLSRQQTNQSLSSASIFSQG 146

Query: 147  SMTNLTKFMGADGKVKLDRPSNPQEIEDLFAELMHKRNFFQSLPAAGQKELMNYDLDKKW 206
            SMTNLTKFMGADGKVKLDRPSNPQEIEDLFAELMHKRNFFQSLPAAGQKELMNYDLDKKW
Sbjct: 147  SMTNLTKFMGADGKVKLDRPSNPQEIEDLFAELMHKRNFFQSLPAAGQKELMNYDLDKKW 206

Query: 207  LLVKQDLQSELKKLANKKNTHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKGH 266
            LLVKQDLQSELKKLANKKNTHV                                  SKGH
Sbjct: 207  LLVKQDLQSELKKLANKKNTHVAPAGAAGLAATISAATQGTSGAGGVGGVDGTQAGSKGH 266

Query: 267  NSTSSPILGGGGFYESGNQNSSTATLSQDPLHLSPDYYVRKIISDKISTKQLKDLWVSLR 326
            NSTSSPILGGGGFYESGNQNSSTATLSQDPLHLSPDYYVRKIISDKISTKQLKDLWVSLR
Sbjct: 267  NSTSSPILGGGGFYESGNQNSSTATLSQDPLHLSPDYYVRKIISDKISTKQLKDLWVSLR 326

Query: 327  TEQLDWVVGFLDAQGQVAIANVLLRFFHKESPDALLNDEALDKEFAFFKCLKTLLNLKEG 386
            TEQLDWVVGFLDAQGQVAIANVLLRFFHKESPDALLNDEALDKEFAFFKCLKTLLNLKEG
Sbjct: 327  TEQLDWVVGFLDAQGQVAIANVLLRFFHKESPDALLNDEALDKEFAFFKCLKTLLNLKEG 386

Query: 387  ANEAVRTKLVVSAITDGLLSLRISTRRIASEMLVFITQWDIPYGLNQVIGELDQESHVSS 446
            ANEAVRTKLVVSAITDGLLSLRISTRRIASEMLVFITQWDIPYGLNQVIGELDQESHVSS
Sbjct: 387  ANEAVRTKLVVSAITDGLLSLRISTRRIASEMLVFITQWDIPYGLNQVIGELDQESHVSS 446

Query: 447  NVHLQARLLSANKRDSLLAQDHELDLTRDHASKKFEQWLFVVEYTLDGRGKMGSLVGASE 506
            NVHLQARLLSANKRDSLLAQDHELDLTRDHASKKFEQWLFVVEYTLDGRGKMGSLVGASE
Sbjct: 447  NVHLQARLLSANKRDSLLAQDHELDLTRDHASKKFEQWLFVVEYTLDGRGKMGSLVGASE 506

Query: 507  DFKSAGGENAILEYGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLELLNYD 566
            DFKSAGGENAILEYGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLELLNYD
Sbjct: 507  DFKSAGGENAILEYGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLELLNYD 566

Query: 567  KIDEQLRIFEDRTADDYNTIMASKSINHNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQ 626
            KIDEQLRIFEDRTADDYNTIMASKSINHNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQ
Sbjct: 567  KIDEQLRIFEDRTADDYNTIMASKSINHNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQ 626

Query: 627  HLFIASSKVQDEGDDPTEASKQLKLIDSLVSNVTMSSIDTESSFNGAIQRLYDSMQTDEV 686
            HLFIASSKVQDEGDDPTEASKQLKLIDSLVSNVTMSSIDTESSFNGAIQRLYDSMQTDEV
Sbjct: 627  HLFIASSKVQDEGDDPTEASKQLKLIDSLVSNVTMSSIDTESSFNGAIQRLYDSMQTDEV 686

Query: 687  ARRAIMEARELTRKFEEVKAERDYLGEKLSKAEGGLVGQLQNELSQRDRILEKNQRVTEQ 746
            ARRAIMEARELTRKFEEVKAERDYLGEKLSKAEGGLVGQLQNELSQRDRILEKNQRVTEQ
Sbjct: 687  ARRAIMEARELTRKFEEVKAERDYLGEKLSKAEGGLVGQLQNELSQRDRILEKNQRVTEQ 746

Query: 747  LQADXXXXXXXXXXXXXXXXXXXXXXXTILNSRPQGSSAVQEEEAGTASSSAPGVLHADR 806
            LQAD                       TILNSRPQGSSAVQEEEAGTASSSAPGVLHADR
Sbjct: 747  LQADLEELKKKHLLEKHEHEVELRKLLTILNSRPQGSSAVQEEEAGTASSSAPGVLHADR 806

Query: 807  KLAIQKALQDRLQQTKKDLTKESKRLGTTLGTTLEPNRRLKLLRSRMEDIENEARELEMT 866
            KLAIQKALQDRLQQTKKDLTKESKRLGTTLGTTLEPNRRLKLLRSRMEDIENEARELEMT
Sbjct: 807  KLAIQKALQDRLQQTKKDLTKESKRLGTTLGTTLEPNRRLKLLRSRMEDIENEARELEMT 866

Query: 867  NFADIQRQTVEEQTXXXXXXXXXXXXXDRAPKAKKQVKEDQVRKLRELRQRLASVQKESN 926
            NFADIQRQTVEEQT             DRAPKAKKQVKEDQVRKLRELRQRLASVQKESN
Sbjct: 867  NFADIQRQTVEEQTVVPALPPPAVPVLDRAPKAKKQVKEDQVRKLRELRQRLASVQKESN 926

Query: 927  DVSKFNVEERINELFNDKKLSALDRLKELETKYKGFGIDFQADPELSAMLSDAPPENHHA 986
            DVSKFNVEERINELFNDKKLSALDRLKELETKYKGFGIDFQADPELSAMLSDAPPENHHA
Sbjct: 927  DVSKFNVEERINELFNDKKLSALDRLKELETKYKGFGIDFQADPELSAMLSDAPPENHHA 986

Query: 987  KDGQAHPSLDPKHLSRKIEEMSKIVDELTAFKKEIENGPPXXXXXXXDEELEQDDRASIH 1046
            KDGQAHPSLDPKHLSRKIEEMSKIVDELTAFKKEIENGPP       DEELEQDDRASIH
Sbjct: 987  KDGQAHPSLDPKHLSRKIEEMSKIVDELTAFKKEIENGPPSSSSSSSDEELEQDDRASIH 1046

Query: 1047 SGNASTGSFLETLSQKYGTGQNAGPTASSRAMVGRESNYPGRGYHRRSFMERVKKSDAAP 1106
            SGNASTGSFLETLSQKYGTGQNAGPTASSRAMVGRESNYPGRGYHRRSFMERVKKSDAAP
Sbjct: 1047 SGNASTGSFLETLSQKYGTGQNAGPTASSRAMVGRESNYPGRGYHRRSFMERVKKSDAAP 1106

Query: 1107 FLSELTQKVAPKTPIDGAYEIEVGARSEEEHIGIGIPSKRNGTVVEGMKDADNSGVSNAE 1166
            FLSELTQKVAPKTPIDGAYEIEVGARSEEEHIGIGIPSKRNGTVVEGMKDADNSGVSNAE
Sbjct: 1107 FLSELTQKVAPKTPIDGAYEIEVGARSEEEHIGIGIPSKRNGTVVEGMKDADNSGVSNAE 1166

Query: 1167 VAPGESFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPSMLKKDXXXXXXXXXXXXXXXX 1226
            VAPGESF                             MPSMLKKD                
Sbjct: 1167 VAPGESFAASAAAPASAAAPATAAAPATAAAPAAPPMPSMLKKDPSAEPSATGATAAPPP 1226

Query: 1227 XXXXXLDLFAKNGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1286
                 LDLFAKNGL                                              
Sbjct: 1227 PPPPPLDLFAKNGLAAVSPTSAPPPPPPPPPAFLSKGPPANGTTPLAPPPPPPPPPPLGG 1286

Query: 1287 XKAMYRAATXXXXXXXXXXXFERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLY 1346
             KAMYRAAT           FERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLY
Sbjct: 1287 PKAMYRAATPSPLLPQSPSLFERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLY 1346

Query: 1347 ERGVLAQLEKAFAAREIKLLANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHK 1406
            ERGVLAQLEKAFAAREIKLLANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHK
Sbjct: 1347 ERGVLAQLEKAFAAREIKLLANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHK 1406

Query: 1407 ILRCDKDFLGSASVIDFLLKPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGEL 1466
            ILRCDKDFLGSASVIDFLLKPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGEL
Sbjct: 1407 ILRCDKDFLGSASVIDFLLKPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGEL 1466

Query: 1467 QRADQLYLEMMVNLQGYWASRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRS 1526
            QRADQLYLEMMVNLQGYWASRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRS
Sbjct: 1467 QRADQLYLEMMVNLQGYWASRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRS 1526

Query: 1527 VFEVILAVGNYMNDSSKQAHGFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSF 1586
            VFEVILAVGNYMNDSSKQAHGFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSF
Sbjct: 1527 VFEVILAVGNYMNDSSKQAHGFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSF 1586

Query: 1587 LQELEPVLDVVKISVEQLAADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPV 1646
            LQELEPVLDVVKISVEQLAADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPV
Sbjct: 1587 LQELEPVLDVVKISVEQLAADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPV 1646

Query: 1647 LPEARKRSDLLSDEVKLTLMEFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHN 1706
            LPEARKRSDLLSDEVKLTLMEFDGLMQMFGED                 IQEYKKAQAHN
Sbjct: 1647 LPEARKRSDLLSDEVKLTLMEFDGLMQMFGEDASDKFAKNSFFKKFADFIQEYKKAQAHN 1706

Query: 1707 IKMXXXXXXXXXXKKMVEEQHKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKL 1766
            IKM          KKMVEEQHKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKL
Sbjct: 1707 IKMEEEERAYERRKKMVEEQHKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKL 1766

Query: 1767 KNAGPGKSDPSSXXXXXXXXXXXXDGKRSSANILDNFEVDEAAPVNQSLVYSPETTLKAA 1826
            KNAGPGKSDPSS            DGKRSSANILDNFEVDEAAPVNQSLVYSPETTLKAA
Sbjct: 1767 KNAGPGKSDPSSARKRALARKKLLDGKRSSANILDNFEVDEAAPVNQSLVYSPETTLKAA 1826

Query: 1827 NAAHAESPTPKASRQGSVAGSGATATPLLESPSKQASAGPEDVADRARNLLKELRGPESE 1886
            NAAHAESPTPKASRQGSVAGSGATATPLLESPSKQASAGPEDVADRARNLLKELRGPESE
Sbjct: 1827 NAAHAESPTPKASRQGSVAGSGATATPLLESPSKQASAGPEDVADRARNLLKELRGPESE 1886

Query: 1887 KRKPLLEDHREKMRARRRRVNEGASSENKLVFVGGASEAPTDSHKGLPNDTTADIPATPV 1946
            KRKPLLEDHREKMRARRRRVNEGASSENKLVFVGGASEAPTDSHKGLPNDTTADIPATPV
Sbjct: 1887 KRKPLLEDHREKMRARRRRVNEGASSENKLVFVGGASEAPTDSHKGLPNDTTADIPATPV 1946

Query: 1947 SADDEPGSGRAGDHDQALNAQEKXXXXXXXXXXXXXXEFVDA 1988
            SADDEPGSGRAGDHDQALNAQEK              EFVDA
Sbjct: 1947 SADDEPGSGRAGDHDQALNAQEKGGSARDSDGDSDGSEFVDA 1988

>KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1976

 Score = 1076 bits (2782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 596/1133 (52%), Positives = 775/1133 (68%), Gaps = 55/1133 (4%)

Query: 30   NLKKLT-GSGNNANTSN--KIEPSDISSPKIVSTPAVPEFSGKPLSKQTTLNTQNLSSYV 86
            NLK+LT GSGN++ + N  K++ SDISSPK ++ P   EFS KPLSKQ+TLN  +LS+Y 
Sbjct: 30   NLKRLTTGSGNSSVSHNTQKLDISDISSPKKINLPDTGEFSHKPLSKQSTLNMASLSAYT 89

Query: 87   DMNTPHHNRSPSGMS-GSPTKYSYSRRSSQWSNGNNIGNGGRLSRQQTNQSLSSASIFSQ 145
            D     HNRS S  S GSPTKYSYSRR+SQWSN N+  +G +LSRQQTNQS+SSASIFSQ
Sbjct: 90   DA-VGAHNRSASNASVGSPTKYSYSRRASQWSNNNSAVSGSKLSRQQTNQSMSSASIFSQ 148

Query: 146  GSMTNLTKFMGADGKVKLDRPSNPQEIEDLFAELMHKRNFFQSLPAAGQKELMNYDLDKK 205
            GS +NL+KF+G DG V+L+RP +P+EIE+LF E+++KRN +QSLPA+ Q+EL NYDL+KK
Sbjct: 149  GSFSNLSKFVGPDGAVRLERPRDPKEIEELFEEVLYKRNVYQSLPASAQRELNNYDLEKK 208

Query: 206  WLLVKQDLQSELKKLANKKNTHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKG 265
            WL+V+QDLQSE+KK  N KN                                     S+ 
Sbjct: 209  WLMVRQDLQSEVKKFMNSKNASKSSTVVGGSSSAVPDSPSASNFTSSTSPNGSFTGLSRP 268

Query: 266  HNSTSSPILGGGGFYESGNQNSSTATLSQDPLHLSPDYYVRKIISDKISTKQLKDLWVSL 325
              STSS +     FY S    SST TLSQDP HLSPDYYVRKII + IS K+L DLWVSL
Sbjct: 269  KISTSS-VNTSEQFYSSNLGTSSTTTLSQDPSHLSPDYYVRKIICNDISAKRLNDLWVSL 327

Query: 326  RTEQLDWVVGFLDAQGQVAIANVLLRFFHKESPDALLNDEALDKEFAFFKCLKTLLNLKE 385
            RTEQLDWV GFL+AQGQVAIANV+L+  ++ESPD LL DE LDKEFA+FKCLKT LNL+E
Sbjct: 328  RTEQLDWVQGFLEAQGQVAIANVILKTCYRESPDNLLGDEVLDKEFAYFKCLKTSLNLRE 387

Query: 386  GANEAVRT---KLVVSAITDGLLSLRISTRRIASEMLVFITQWDIPYGLNQVIGELDQES 442
            GA+EAV +   +++VSAI +GLLSLR++TRR+ASE+L+ ++QW +P+G N V+  LDQES
Sbjct: 388  GADEAVMSNSARIIVSAIVEGLLSLRVATRRVASELLISLSQWSLPHGFNHVMDALDQES 447

Query: 443  HVSSNVHLQARLLSAN-----KRDSLLAQDHELDLTRDHASKKFEQWLFVVEYTLDGRGK 497
                NVHLQARL++ +     K+ S +A   + D   D   +KFEQW+ VVEYTLDGRGK
Sbjct: 448  RFCDNVHLQARLITQSASKDPKKGSSIAPTPDGD--GDRVMRKFEQWMLVVEYTLDGRGK 505

Query: 498  MGSLVGASEDFKSAGGENAILEYGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIM 557
            MGSLVGASEDF+++GGENAI+EY YLTLLL+N LC TP DV QRT+LR+R K+ GL RI+
Sbjct: 506  MGSLVGASEDFRTSGGENAIMEYAYLTLLLINHLCQTPVDVKQRTVLRARLKNAGLPRIL 565

Query: 558  QKLELLNYDKIDEQLRIFEDRTADDYNTIMASKSINHNVDMENPLSLLQNLWESYKGTGA 617
             K++LLNY+K+DEQL  F+D T DD++ + + +S    VDM++P+S+ QNLW   KGT A
Sbjct: 566  NKMKLLNYEKVDEQLARFDDSTTDDFDALYSQESTGEGVDMKDPVSMTQNLWNLCKGTDA 625

Query: 618  EKYLVSLVQHLFIASSKVQDEG-DDPTEASKQLKLIDSLVSNVTMSSIDTESSFNGAIQR 676
            E++L SL+Q+L I++ ++  +  DDPT+ +KQLKLID+LVSNV+M+S+D +SSFN AIQR
Sbjct: 626  EQHLTSLLQNLLISTGELGSKNKDDPTQRTKQLKLIDALVSNVSMASVDMQSSFNSAIQR 685

Query: 677  LYDSMQTDEVARRAIMEARELTRKFEEVKAERDYLGEKLSKAEGGLVGQLQNELSQRDRI 736
            LYD+MQTDE+ARRAI+E R+  +++EE+KA+RD L EKLS AEGGLVGQLQ+E+ QRD I
Sbjct: 686  LYDAMQTDEIARRAILENRDWVKRYEEIKADRDNLKEKLSNAEGGLVGQLQDEVRQRDHI 745

Query: 737  LEKNQRVTEQLQADXXXXXXXXXXXXXXXXXXXXXXXTILNSRPQGSSAVQEEEAGTASS 796
            LEK+QRV  QLQ +                       T +NS  +GS  +++E+     S
Sbjct: 746  LEKSQRVNAQLQHELDESKKKLILAKHEHEVELRKTLTAMNSNFEGSHNMRDEKG----S 801

Query: 797  SAPGVLHADRKLAIQKALQDRLQQTKKDLTKESKRLGTTLGTTLEPNRRLKLLRSRMEDI 856
              P  L  +RKLAIQKALQ +L++T K++  ESKR    LG +LEPN+RLKLLRSRMEDI
Sbjct: 802  ENPRPLRPERKLAIQKALQAKLEKTSKEINVESKR----LGLSLEPNKRLKLLRSRMEDI 857

Query: 857  ENEARELEMTNFADIQRQTVEEQTXXXXXXXXXXXXXDRAPKAKKQVKEDQVR--KLREL 914
            EN+ARELEMTNF+D Q+  ++E               D    ++ + K  Q+   KL EL
Sbjct: 858  ENQARELEMTNFSDYQKDDIKE--------PEVSNEDDHKAVSESEEKAQQISALKLEEL 909

Query: 915  RQRLASVQKESNDVSKFNVEERINELFNDKKLSALDRLKELETKYKGFGIDFQADPELSA 974
            R++LAS+Q+ESND+SKFNVE R +E+F+ +K  ALDRLK+LET YKGFGI+F  D  L  
Sbjct: 910  RKKLASLQQESNDISKFNVEGRFHEMFSGQKSLALDRLKKLETDYKGFGINFDPDSPLGQ 969

Query: 975  MLSDAPPENHHAKDGQAHPSLDPKHLSRKIEEMSKIVDELTAFK-KEIENGPPXXXXXXX 1033
             L+        + D +A  +LDPK     +EE+S I+  L + K  E  N  P       
Sbjct: 970  ALAG----KSVSSDDKAR-TLDPKEALNIVEEVSNILSGLDSSKAAEKSNETPLRTATSS 1024

Query: 1034 D-EELEQDDRASIHSGNAS---TGSFLETLSQKYGTGQNAGPTASSRAMVGRESNYPGRG 1089
            D  E E DD+        S   T SFLE+LSQKYG  QN+   ++  +  G E NYPG G
Sbjct: 1025 DSSEDEMDDKNGDKIAADSTLPTSSFLESLSQKYGGAQNS--LSNRHSFAGGEINYPGSG 1082

Query: 1090 YHRRSFMERVKKSDAAPFLSELTQKVAPKTPIDGAYEIEVGARSEEEHIGIGI 1142
            YHR+SFM RVK++ A P+L EL+ K+   + I  +          EE++GIGI
Sbjct: 1083 YHRKSFMNRVKRTGAVPYLGELSGKIGSSSYIKPS--------EAEENVGIGI 1127

 Score =  746 bits (1927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/627 (61%), Positives = 465/627 (74%), Gaps = 21/627 (3%)

Query: 1307 FERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEKAFAAREIKLL 1366
            F+RYPRP KKLKQLHWEKI+D  +SIW+DAKAEK+ADDLYE+GVL++LEKAFAAREIK L
Sbjct: 1332 FDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVLSRLEKAFAAREIKSL 1391

Query: 1367 ANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLK 1426
            A+R+K+D +K++FLSRDVSQQFGINLHMY++LSV+EVV KILRCD+DFL + SVIDFL K
Sbjct: 1392 ASRKKKDSDKLSFLSRDVSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSK 1451

Query: 1427 PEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWAS 1486
             EIVEVSNNLARNFAPY+ +WEGVSSV+ AK PEKDP ELQRAD+LYLE+ VNLQ YW+S
Sbjct: 1452 QEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWSS 1511

Query: 1487 RMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAH 1546
            RMRALKVITTYEK+YSDL+ KL  IDKA  SIQ S+NLR+V +VILAVGN+MNDSSKQA 
Sbjct: 1512 RMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQ 1571

Query: 1547 GFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAA 1606
            GF+LATLQRLTFIKD+KNSMTFLNYVEKIIRE Y EFN FL+ELEPV+  VKIS+EQ+A 
Sbjct: 1572 GFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVAQ 1631

Query: 1607 DCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLM 1666
            DCREFSQ+++NVERS+++GNLSD +KFHP DRVL+KVLP LPEARK+ DLL DE+KLTL+
Sbjct: 1632 DCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLL 1691

Query: 1667 EFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKKMVEEQ 1726
            EFD LM++FGED                 + EYKKAQ +N+K+          KK+VE+Q
Sbjct: 1692 EFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNLKLEEEERAYERRKKLVEDQ 1751

Query: 1727 HKRARLEAE---KGGVDDGSEAEGVTAVSRGERDVMDKLLEKLKNAGPGKSDPSSXXXXX 1783
             KR R E+E   KG  D G ++  V      +RDVMD+LLEKLKNAGP KSDPSS     
Sbjct: 1752 LKRTR-ESESKNKGTTDAGGDS--VRNEVNEDRDVMDRLLEKLKNAGPAKSDPSSARKRA 1808

Query: 1784 XXXXXXXDGKRSSANILDNFEVDEAAPVNQSLVYSPETTLKAANAAHAE-SPTPKASRQG 1842
                    G  S++ ILDNF+++++    +SLVYSP+          A+ SPTP+   + 
Sbjct: 1809 VARKRLLQGSSSNSTILDNFDIEDSD--GKSLVYSPDNNSSEVQLNEADTSPTPERRVRD 1866

Query: 1843 SVAGSGATATPLLESPSKQASAGPEDVADRARNLLKELRGPESEKRKPLLEDHR-EKMRA 1901
            S A S A+              G  D+ DRARNLL ELRGPES   K   +  R  K+RA
Sbjct: 1867 SNATSPAS-----------HDTGSSDLTDRARNLLIELRGPESPGVKMSAQHQRLSKLRA 1915

Query: 1902 RRRRVNEGASSENKLVFVGGASEAPTD 1928
            RR+  +  + SEN+L FVG      +D
Sbjct: 1916 RRKNDSSSSGSENRLNFVGAGQAENSD 1942

>Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] {ON}
            YNL271C (BNI1) - contains formin homology domains;
            homologous to BNR1 (BNI1 related protein) [contig 118]
            FULL
          Length = 1968

 Score = 1056 bits (2730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/1168 (50%), Positives = 765/1168 (65%), Gaps = 104/1168 (8%)

Query: 27   LFSNLKKLTGSGNNAN--TSNKIEPSDISSPKIVSTPAVPEFSGKPLSKQTTLNTQNLSS 84
            +FSNLK+LTG+ NN++  T  K++ SDISSPK ++ P   EFS KPLSKQ+TLN  NLS+
Sbjct: 27   IFSNLKRLTGNANNSSSQTLQKVDISDISSPKKINLPDTGEFSHKPLSKQSTLNIANLSA 86

Query: 85   YVDMNTPHHNRSPSGMSGSPTKYSYSRRSSQWSNGNNIGNGGRLSRQQTNQSLSSASIFS 144
            Y D+ + H+  S +  + SPTKYSYSRR+SQWS+        +LSRQQTNQS+SSASIFS
Sbjct: 87   YTDVASTHNRSSSAASNSSPTKYSYSRRASQWSSNGGTAPSTKLSRQQTNQSISSASIFS 146

Query: 145  QGSMTNLTKFMGADGKVKLDRPSNPQEIEDLFAELMHKRNFFQSLPAAGQKELMNYDLDK 204
            QGS +NL+KF+G DG ++L++P +P+EIE+LF E+++KRN +QSLP + QKEL NYDL+K
Sbjct: 147  QGSFSNLSKFVGPDGSIRLEKPRDPREIEELFEEVLYKRNVYQSLPPSAQKELNNYDLEK 206

Query: 205  KWLLVKQDLQSELKKLANKKNTHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSK 264
            KWL+V+QDLQSE+KK  N K+                                     S 
Sbjct: 207  KWLMVRQDLQSEVKKFMNNKSV-----------------SKSPAAASTGISLIAPESPST 249

Query: 265  GHNSTSSPI---LGGGG------------FYESGNQNSSTATLSQDPLHLSPDYYVRKII 309
            GH +++S I   L G              FY S N  SST TLSQDP HLSPDYYVRKII
Sbjct: 250  GHFASNSSINESLAGSSRSRAQNPGTSDQFYGSNNGTSSTTTLSQDPSHLSPDYYVRKII 309

Query: 310  SDKISTKQLKDLWVSLRTEQLDWVVGFLDAQGQVAIANVLLRFFHKESPDALLNDEALDK 369
             + IS K+L DLWVSLRTEQLDWVVGFL+AQGQVAIANV+L+  ++ESPD LL DE LDK
Sbjct: 310  CNNISAKRLNDLWVSLRTEQLDWVVGFLEAQGQVAIANVILKTCYRESPDNLLGDEVLDK 369

Query: 370  EFAFFKCLKTLLNLKEGANEAVRTKLVVSAIT---DGLLSLRISTRRIASEMLVFITQWD 426
            EFA+FKCLKT LNLKEGA+EAV +      I+   +GLLSLR++TRRIASE+LV ++QW 
Sbjct: 370  EFAYFKCLKTSLNLKEGADEAVLSNSAKIIISAIIEGLLSLRVATRRIASELLVSLSQWA 429

Query: 427  IPYGLNQVIGELDQESHVSSNVHLQARLLS--ANK------RDSLLAQDHELDLTRDHAS 478
            +P+G   V+  LDQES    NVHLQARLLS  +NK      R SLLA     D   D   
Sbjct: 430  LPHGFTHVMNALDQESRFCDNVHLQARLLSQTSNKEIKNSLRSSLLA-----DNNGDRIM 484

Query: 479  KKFEQWLFVVEYTLDGRGKMGSLVGASEDFKSAGGENAILEYGYLTLLLVNQLCNTPADV 538
            +KFEQW+ VVEYTLDGRGKMGSLVGASEDF+++GGENAI+EY YLTLLLVN LC TP DV
Sbjct: 485  RKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLVNHLCQTPVDV 544

Query: 539  NQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTADDYNTIMASKSINHNVDM 598
             QRT+LR+R K+ GL RI+ K++ LNY+K+DEQL IFED T DD++T+ +       ++M
Sbjct: 545  KQRTILRARLKNAGLPRILNKMKRLNYEKVDEQLAIFEDSTTDDFDTLYSQGPNGELINM 604

Query: 599  ENPLSLLQNLWESYKGTGAEKYLVSLVQHLFIASSKVQDEG-DDPTEASKQLKLIDSLVS 657
            ++P+S+ QNLW+  KGT AE++L+SL+Q+L I++ ++     +DP + +KQLKLID+LVS
Sbjct: 605  QDPVSMTQNLWDLCKGTEAEEHLMSLLQNLLISTGELGGTSKEDPAQRTKQLKLIDALVS 664

Query: 658  NVTMSSIDTESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEVKAERDYLGEKLSK 717
            NV+M+S+D +SSFN AIQRLYD+MQTDE+ARRAI+E R+  +++EE+KAER+ L EKLS 
Sbjct: 665  NVSMASVDLQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKAERNNLKEKLSN 724

Query: 718  AEGGLVGQLQNELSQRDRILEKNQRVTEQLQADXXXXXXXXXXXXXXXXXXXXXXXTILN 777
            AEGGLVGQLQ EL QRD ILEK+QRVT QLQ +                       T LN
Sbjct: 725  AEGGLVGQLQEELKQRDHILEKSQRVTAQLQHELDESKKKLILAKHQHEVELRKTLTALN 784

Query: 778  SRPQGSSAVQEEEAGTASSSAPGVLHADRKLAIQKALQDRLQQTKKDLTKESKRLGTTLG 837
            S+  G      E+ G      P  L  +R LAIQ+ALQ +L++T K++T ES R    LG
Sbjct: 785  SK--GGDIQLTEDGG-----QPKPLKPERMLAIQRALQIKLEKTSKEITVESSR----LG 833

Query: 838  TTLEPNRRLKLLRSRMEDIENEARELEMTNFADIQRQTVEEQTXXXXXXXXXXXXXDRAP 897
             +LEPN+RL+LLRSRME+IEN+ARELEMTNF++ +    +E               D   
Sbjct: 834  VSLEPNKRLRLLRSRMEEIENQARELEMTNFSEYREDADKEIEMAHEGTHMYPSDVDVG- 892

Query: 898  KAKKQVKEDQVRKLRELRQRLASVQKESNDVSKFNVEERINELFNDKKLSALDRLKELET 957
                   +D   KL +LR++LAS+Q ESND+SKFNVE R +E+F+D+K+ ALDRLK+LE 
Sbjct: 893  -----TTQDSNLKLEQLRRKLASLQNESNDISKFNVEGRFHEMFSDQKIQALDRLKKLEN 947

Query: 958  KYKGFGIDFQADPELSAMLSDAPPENHHAKDGQAHPSLDPKHLSRKIEEMSKIVDELTAF 1017
             Y GFGI++  DP  S  L     +    +D     +LDPK  +  ++E     D   A 
Sbjct: 948  DYSGFGINY--DPAESPSL-----KQEQGQDVNKSRTLDPKGPNNSVDESQLETDRANA- 999

Query: 1018 KKEIENGPPXXXXXXXDEELEQDDRASIHSGNAST----GSFLETLSQKYGTGQNAGPTA 1073
               I++ P         E LE++D   +H   ++T    GSFLE LSQKYG GQ     +
Sbjct: 1000 --SIDSSP-------ASESLEEED---VHLTKSTTEEIGGSFLERLSQKYGKGQ--ANLS 1045

Query: 1074 SSRAMVGRESNYPGRGYHRRSFMERVKKSDAAPFLSELTQKVAPKTPIDGAYEIEVGARS 1133
            +  ++VGRE++YPG GYHR+SFM RVKKSD  P+L EL+ K    T     +E E     
Sbjct: 1046 NRNSVVGRENSYPGSGYHRKSFMNRVKKSDNVPYLEELSGKFGTAT-----HENE----- 1095

Query: 1134 EEEHIGIGIPSKRNGTVVEGMKDADNSG 1161
             EE+ GIGI            KD +N G
Sbjct: 1096 SEENFGIGIRVNNEQLTSLPSKDKENHG 1123

 Score =  769 bits (1986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/626 (62%), Positives = 477/626 (76%), Gaps = 21/626 (3%)

Query: 1307 FERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEKAFAAREIKLL 1366
            FERYPRP KKLKQLHWEKI+D  +SIWK+AKAE++ADDLYE+G+L++LEKAFAAREIK L
Sbjct: 1315 FERYPRPTKKLKQLHWEKIDDAEDSIWKNAKAEQFADDLYEKGILSRLEKAFAAREIKSL 1374

Query: 1367 ANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLK 1426
             +R+K+D +K+TFLSRDVSQQFGINLHMY++LSV+EVV KIL+CDKDFL + SVI+FL K
Sbjct: 1375 TSRKKKDSDKLTFLSRDVSQQFGINLHMYSSLSVEEVVTKILKCDKDFLTTPSVIEFLSK 1434

Query: 1427 PEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWAS 1486
             EIVEVSNNLARNFAPY+T+WEG+++V +AK PEKDP ELQRAD+LYLE+ VNLQGYW+S
Sbjct: 1435 QEIVEVSNNLARNFAPYTTDWEGITNVKDAKPPEKDPSELQRADRLYLELFVNLQGYWSS 1494

Query: 1487 RMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAH 1546
            RMRALKVIT+YEKEYSDL+ KLR IDKA  +IQ S+NLR+V +VILAVGN+MNDSSKQA 
Sbjct: 1495 RMRALKVITSYEKEYSDLIHKLRMIDKATCAIQQSENLRNVLDVILAVGNFMNDSSKQAQ 1554

Query: 1547 GFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAA 1606
            GF+LATLQRLTFIKD+KNSMTFLNYVEKI+RE Y EFN FL+ELEPV+  VKIS+EQ++ 
Sbjct: 1555 GFRLATLQRLTFIKDDKNSMTFLNYVEKIVRETYPEFNVFLKELEPVVAAVKISIEQVSQ 1614

Query: 1607 DCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLM 1666
            DC+EFSQ+++NVERS+++GNLSDSSKFHP DR L+KVLPVLPEARK+ DLL DE+KLTL+
Sbjct: 1615 DCKEFSQSVINVERSVDIGNLSDSSKFHPLDRTLLKVLPVLPEARKKGDLLMDEMKLTLL 1674

Query: 1667 EFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKKMVEEQ 1726
            EFD LM+MFGED                 +QEYKKAQ +N+K+          KKMVEEQ
Sbjct: 1675 EFDNLMKMFGEDAMDKFSRNSFFKKFADFLQEYKKAQTYNMKLEEEEKAYERRKKMVEEQ 1734

Query: 1727 HKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLKNAGPGKSDPSSXXXXXXXX 1786
             +RAR   E+    DG+ A+  TA S G+RDVMD+LLEKLKNAGPGKSDPSS        
Sbjct: 1735 QRRARESNEQENSVDGN-ADDNTAAS-GDRDVMDRLLEKLKNAGPGKSDPSSARKRAIAR 1792

Query: 1787 XXXXDGKRSSANILDNFEVDEAAPVNQSLVYSPETTLKAANAAHAESPTPKA-SRQGSVA 1845
                 G  S++ ILDNFE+++  P  +SLVYSPE    + +  H  SPTP    R+G   
Sbjct: 1793 RKLLQGSSSNSTILDNFEIEK--PEGKSLVYSPEQVTLSNSVDH--SPTPDVRKREGQ-- 1846

Query: 1846 GSGATATPLLESPSKQASAGPEDVADRARNLLKELRGPESEKRKPLLEDHR-EKMRARRR 1904
               +TA+ +  S S        D+ DRARNLL ELRGPES  R+   +D R  K+RARR+
Sbjct: 1847 ---STASEVQTSESS-------DLTDRARNLLIELRGPESPSRRASSKDQRISKLRARRK 1896

Query: 1905 RVNEGAS-SENKLVFVGGASEAPTDS 1929
                G S S+N L FVG    A  DS
Sbjct: 1897 NDGSGNSGSDNHLNFVGQEGAALPDS 1922

>KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] {ON}
            similar to uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1842

 Score =  856 bits (2212), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/1160 (44%), Positives = 705/1160 (60%), Gaps = 147/1160 (12%)

Query: 27   LFSNLKKLTGSGNNANTSNKIEPSD-----ISSPKIVSTPA-----VPEFSGKPLSKQTT 76
            LFSNLKKL   GN+ ++    +PS      ISSPK V T A      P    KPL+K ++
Sbjct: 29   LFSNLKKLATGGNHGSS----QPSQTRKELISSPKRVFTTASLESATPIGGSKPLNKISS 84

Query: 77   LNTQNLSSYVDMNTPHHNRSPSG-MSGSPTKYSYSRRSSQWSNGNNIGNGGRLSRQQTNQ 135
            LNT NLS Y  M+   ++RS S  +  SPTKYSYSRRSSQ            L+R  TN+
Sbjct: 85   LNTHNLSHYT-MDPEANSRSQSASLLTSPTKYSYSRRSSQ------------LTRSSTNK 131

Query: 136  SLSSASIFSQGSMTN--LTKFMGADGKVKLDRPSNPQEIEDLFAELMHKRNFFQSLPAAG 193
            S+ S+S  S  S +   L +F+  DG +KLDRP NP+EI  LF +L+ KRN F S+ +  
Sbjct: 132  SIISSSAVSVSSNSTSILNRFLTNDGTLKLDRPENPEEINGLFMDLLIKRNVFDSVSSQD 191

Query: 194  QKELMNYDLDKKWLLVKQDLQSELKKLANKKNTHVXXXXXXXXXXXXXXXXXXXXXXXXX 253
            QK+++NY ++KKWL+VKQDLQSE K+L + K                             
Sbjct: 192  QKDMLNYPIEKKWLMVKQDLQSEFKRLKSTK---------------------------PR 224

Query: 254  XXXXXXXXXSKGHNSTSSPILGGGGFYESGNQNSSTATLSQDPLHLSPDYYVRKIISDKI 313
                      K   STS       G   +     S  +    P H  P+YYVR+IIS KI
Sbjct: 225  FSANDTQNMLKRKTSTSKLNTQYEGMLHTNESQGSLLS----PSHFPPEYYVRQIISKKI 280

Query: 314  STKQLKDLWVSLRTEQLDWVVGFLDAQGQVAIANVLLRFFHKESPD---ALLNDEALDKE 370
              K+L DLWVSLRTE LDWV+ FL+AQGQVAIAN+++   H+++ D   A+ + + L++E
Sbjct: 281  KNKELNDLWVSLRTEPLDWVISFLEAQGQVAIANLIITSMHQDTTDNQNAVTDPQFLERE 340

Query: 371  FAFFKCLKTLLNLKEGANEAVRTKLVVSAITDGLLSLRISTRRIASEMLVFITQWDIPY- 429
             A FKCL+ LLN++E   EAV + LV +A+ +GLLS +I TRR+A+E L+++   D  + 
Sbjct: 341  TALFKCLRVLLNIRECLEEAVNSTLVTNALVEGLLSTKIPTRRLATETLIYLVTKDEDFK 400

Query: 430  ----GLNQ---VIGELDQESHVSSNVHLQARLLSANKRDSLLAQDHELDLTRDHASKKFE 482
                GL+    V+  L+ E+ +  N+H++A+  + +      + D E +       K  +
Sbjct: 401  SRTAGLDCFSLVMESLNHETSLVQNIHMKAKFSTND------STDPESNPQLYQVCKILQ 454

Query: 483  QWLFVVEYTLDGRGKMGSLVGASEDFKSAGGENAILEYGYLTLLLVNQLCNTPADVNQRT 542
            QWL+VVE TLDGRGKMGSLVGAS+++++  GEN+I EY   +++L++QLC    DV +R 
Sbjct: 455  QWLYVVEQTLDGRGKMGSLVGASDEYRNNTGENSIYEYLVDSIVLIDQLCLNNEDVKKRH 514

Query: 543  LLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTADDYNTIMASKSINHNVDMENPL 602
            ++R++ KS GL+RI+QK++LL+Y  +   L  FED   DDYN+++ S+    NVDM++P+
Sbjct: 515  MMRTQLKSFGLNRILQKMQLLDYPPLSTMLLQFEDAAIDDYNSLIDSQKFTENVDMDDPV 574

Query: 603  SLLQNLWESYKGTGAEKYLVSLVQHLFIASSKVQDEGDDPTEASKQLKLIDSLVSNVTMS 662
            S+LQ L  S+KGT AE YL+S++Q+LF++S+K   E DDP +  +QLKLIDSL+SNV ++
Sbjct: 575  SILQKLTSSFKGTEAESYLLSMLQNLFLSSNKNAQESDDPGKNVQQLKLIDSLISNVAIT 634

Query: 663  SIDTESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEVKAERDYLGEKLSKAEGGL 722
            ++D+ES+FN AIQRLYDSMQTDE+ARRAI+E+RELT+K EEVKAERDYL +K+SKAE GL
Sbjct: 635  TLDSESNFNVAIQRLYDSMQTDEIARRAILESRELTKKLEEVKAERDYLNDKISKAENGL 694

Query: 723  VGQLQNELSQRDRILEKNQRVTEQLQADXXXXXXXXXXXXXXXXXXXXXXXTILNSRPQG 782
            VGQLQ EL++RD IL+K QRVTEQLQ++                       TI+NS+   
Sbjct: 695  VGQLQKELAERDLILDKTQRVTEQLQSELEELKKRHLLEKHEHEIELRKMLTIVNSK--- 751

Query: 783  SSAVQEEEAGTASSSAPGVLHADRKLAIQKALQDRLQQTKKDLTKESKRLGTTLGTTLEP 842
                 + E+G+   + P  L+ +RK AIQ  LQ  LQ+T++DL  ES+RLGT +G+    
Sbjct: 752  --TSDDLESGSTVQNDPKPLNPERKTAIQNVLQRSLQKTEQDLLNESRRLGTAVGS---- 805

Query: 843  NRRLKLLRSRMEDIENEARELEMTNFADIQRQTVEEQTXXXXXXXXXXXXXDRAPKAKKQ 902
              RLKLLRS+MEDIEN+ARELEMTNFAD++ +                    +  K K+Q
Sbjct: 806  KSRLKLLRSKMEDIENQARELEMTNFADVKPK--------------------QNQKFKEQ 845

Query: 903  VKEDQVRKLRELRQRLASVQKESNDVSKFNVEERINELFNDKKLSALDRLKELETKYKGF 962
            VK  Q  KL ELR++LA +Q ESND++KFN+E R+NELF DKKL+ALDRLK+LE KY GF
Sbjct: 846  VKGQQATKLAELRKKLAIIQNESNDITKFNIEARVNELFQDKKLAALDRLKDLENKYNGF 905

Query: 963  GIDFQADPELSAMLSDAPPENHHAKDGQAHPSLDPKHLSRKIEEMSKIVDELTAFKKEIE 1022
             IDF  DPEL  +L+ +             PSLDP  + RK+EEM+ I+DEL A K+E++
Sbjct: 906  HIDFADDPELKELLTQS---------SNGGPSLDPTIVQRKVEEMNSIIDELNALKEEMK 956

Query: 1023 NGPPX----------XXXXXXDEELEQDDRASIHSGNASTG-SFLETLSQKYGTGQNAGP 1071
            N P                   E+     +AS  S   S G SFLE+LSQKY TGQ    
Sbjct: 957  NRPKTGSSSSSSSSLSSASSSSEDGSSQSQASHGSDIVSNGSSFLESLSQKYSTGQQTA- 1015

Query: 1072 TASSRAMVGRESNYPGRGYHRRSFMERVKKSDA---------APFLSELTQKVAPKTPID 1122
            T+++   VGRE+ YPG GYHR+SF+ R+K +            PFL+EL  KV     ID
Sbjct: 1016 TSTNGGRVGRETRYPGSGYHRKSFLNRLKNTTVNPTATSEHLPPFLTELKSKVKMTDDID 1075

Query: 1123 GAYEIEVGARSEEEHIGIGI 1142
               ++ VG       IGI +
Sbjct: 1076 ---DVPVG-------IGISV 1085

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/650 (54%), Positives = 447/650 (68%), Gaps = 42/650 (6%)

Query: 1307 FERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEKAFAAREIKLL 1366
            FERYPRPKKKLKQLHWEKI++ G+SIWK+A+AEK ADDL+ERGVL+QLEKAFAARE K L
Sbjct: 1226 FERYPRPKKKLKQLHWEKIDNAGDSIWKNAQAEKVADDLFERGVLSQLEKAFAARETKSL 1285

Query: 1367 ANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLK 1426
              + KE   K+TFLSRDVSQQFGINLHM++ L VK+VV K+++CD++FL + SVI+FL K
Sbjct: 1286 KGKSKEANEKITFLSRDVSQQFGINLHMFSNLDVKDVVGKVMKCDREFLSTPSVIEFLSK 1345

Query: 1427 PEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWAS 1486
            P I+EV+NNLAR F PYST+WEGV+SVD+AK PEKDP ELQRADQLY+E M+NLQ YW S
Sbjct: 1346 PTIIEVTNNLARYFNPYSTDWEGVTSVDDAKPPEKDPNELQRADQLYVEFMINLQPYWGS 1405

Query: 1487 RMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAH 1546
            RMRA+ +ITTYEK+YSDL+TKLR ID+AV  I+ S++LR VF+VILAVGNYMNDSSKQA 
Sbjct: 1406 RMRAITMITTYEKDYSDLVTKLRKIDRAVQCIEQSESLRHVFDVILAVGNYMNDSSKQAQ 1465

Query: 1547 GFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAA 1606
            GFKL+TLQRLTFIKDEKNSMTFLNYVEKIIRENY E++ F++ELEP+  V KIS+EQL  
Sbjct: 1466 GFKLSTLQRLTFIKDEKNSMTFLNYVEKIIRENYPEYSHFVEELEPIFSVTKISIEQLVT 1525

Query: 1607 DCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLM 1666
            DC+EFSQ+++NVERSIE+GNLSD SKFHP DRVL KV+PVLPEARK++DLLSDE+KL+L+
Sbjct: 1526 DCKEFSQSVINVERSIEIGNLSDPSKFHPLDRVLNKVVPVLPEARKKADLLSDEIKLSLL 1585

Query: 1667 EFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKKMVEEQ 1726
            EF+ LM+ FGED                 I E+KKA+ HN+K+          KKM+E+Q
Sbjct: 1586 EFENLMKKFGEDANDKFSKNSFFQKFADFITEFKKAKTHNVKLEEEERAYERRKKMIEDQ 1645

Query: 1727 HKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLKNAGPGKSDPSSXXXXXXXX 1786
             ++ +    K    + S ++  +     +RD ++KLL+KLKNA P K DPSS        
Sbjct: 1646 QRKQQEADSKATAKNLSTSQEPS----DDRDDIEKLLDKLKNAAPSKGDPSSTRKRALAR 1701

Query: 1787 XXXXDGKRSSANILDNFEVDEAAPVNQSLVYSPETTLKA---ANAAHAESPTPKASRQGS 1843
                DGK S A+I DN   D              +T++A    N    ESPT K S    
Sbjct: 1702 KKLLDGK-SGASIFDNITAD--------------STIEAFVEQNRTLTESPTAKKS---- 1742

Query: 1844 VAGSGATATPLLESPSKQASAGPEDVADRARNLLKELRGPESEK--RKPLLEDHREKMRA 1901
                   + P  ES     S+  +D ADRARNLL ELRGP+  K      ++   +    
Sbjct: 1743 ------ASLPETES----LSSSKQDPADRARNLLLELRGPDERKDASPSPIKAKDKLRDL 1792

Query: 1902 RRRRVNEGASSENKLVFVGGASEAPTDSHKGLPNDTTADIPATPVSADDE 1951
            +++  +      NKL FVG     P   H   P   T D+  T  S++DE
Sbjct: 1793 KKKDSSVKVDQPNKLQFVGSLEVGP---HPK-PLSPTQDLMDTSNSSEDE 1838

>Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON}
            similar to Ashbya gossypii AFR669W
          Length = 2091

 Score =  840 bits (2169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/1037 (48%), Positives = 673/1037 (64%), Gaps = 106/1037 (10%)

Query: 27   LFSNLKKLTGSGNNANTSNKIEPSDISSPKIVSTPAVPEFS-GKPLSKQTTLNTQNLSSY 85
            LFSNL KLTGS ++A +  +I  SDISSPK VS P+  + S  KPLSK +TLNT +LS Y
Sbjct: 36   LFSNLMKLTGS-SSALSQQRIATSDISSPKKVSIPSSLDLSTAKPLSKHSTLNTSSLSQY 94

Query: 86   VDMNTPHHNRSPSGMS--GSPTKYSYSRRSSQWSNGNN----------IGNGGRLSRQQT 133
             D      +R+PSG    GSP+KYSYS+RSSQWS GN+            +   LSRQ T
Sbjct: 95   AD--EIAQSRTPSGPVSLGSPSKYSYSKRSSQWSGGNSNKQLLLLPQPQHSQHTLSRQPT 152

Query: 134  NQSLSSASIFSQGSMTNLTKFMGADGKVKLDRPSNPQEIEDLFAELMHKRNFFQSLPAAG 193
            NQS +S +  S  S+T L K   +DG + L++P  PQEIE+L+ EL+ KRN   S+    
Sbjct: 153  NQSNNSDN--SFSSVTLLQKITDSDGNLSLEKPKYPQEIEELYQELLQKRNILNSVSVHS 210

Query: 194  QKELMNYDLDKKWLLVKQDLQSELKKLANKKNTHVXXXXXXXXXXXXXXXXXXXXXXXXX 253
             +ELM YDLDKKWL+VKQDLQ+ELK++ N                               
Sbjct: 211  HRELMGYDLDKKWLMVKQDLQAELKRMKNNVPQSTVADPL-------------------- 250

Query: 254  XXXXXXXXXSKGHNSTSSPILGGGGFYESGN-------QNSSTA-TLSQDPLHLSPDYYV 305
                          S S  +    G + S N       QNS+    +S DP HLSPD+YV
Sbjct: 251  --------------SNSVHLKSPRGSFSSSNMSARSISQNSAKQLAVSYDPSHLSPDHYV 296

Query: 306  RKIISDKISTKQLKDLWVSLRTEQLDWVVGFLDAQGQVAIANVLLRFFHKESPDALLNDE 365
            RKIISD+I+  +L DLWVSLRTE +DWV+GF+DAQGQVAIAN L++F  +ES ++LL+ +
Sbjct: 297  RKIISDRITAYELNDLWVSLRTESIDWVIGFIDAQGQVAIANRLIKFAQRESLESLLDSD 356

Query: 366  ALDKEFAFFKCLKTLLNLKEGANEAVRTKLVVSAITDGLLSLRISTRRIASEMLVFI--- 422
             L+KE A++KCL+ L NL+EG   A+ +KLV+SA+ +GLLS+R++TRRIA+E L+++   
Sbjct: 357  LLEKETAYYKCLRVLTNLREGMQAALSSKLVISAVVEGLLSIRLTTRRIATETLLYMLTD 416

Query: 423  -------TQWDIPYGLNQVIGELDQESHVSSNVHLQARLLSANKRDSLLAQDHELDLTRD 475
                   T +D  +    V+  LDQES  SS++HL+ RL   NKR SL     +L +   
Sbjct: 417  DELKTADTDFDAIF---PVLHALDQESKYSSSIHLRGRLHETNKRRSLPTGRADLHVI-- 471

Query: 476  HASKKFEQWLFVVEYTLDGRGKMGSLVGASEDFKSAGGENAILEYGYLTLLLVNQLCNTP 535
              +KK EQWL+V+EYTLDGRG+MGSLVGASED+K+  GEN +LEY   +++L+N LC++ 
Sbjct: 472  --AKKIEQWLYVLEYTLDGRGRMGSLVGASEDYKN--GENTVLEYLLYSMILINLLCSSH 527

Query: 536  ADVNQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTADDYNTIMASKSINHN 595
             D++QR LLRSR KS GLSR+++K+ELL Y  ++ ++  FEDRT DDYN++MAS +++ +
Sbjct: 528  PDLHQRNLLRSRLKSYGLSRVIKKMELLKYPALENEVSKFEDRTLDDYNSLMASSTVDSS 587

Query: 596  VDMENPLSLLQNLWESYKGTGAEKYLVSLVQHLFIASSKVQDEGDDPTEASKQLKLIDSL 655
            VDM++P SL  N W  +KGT +E +L+SL+QHLF+ SSK   E  DP E SKQLKL+D+L
Sbjct: 588  VDMKDPESLWNNFWTRHKGTESEAHLLSLMQHLFLWSSKAFSESTDPAEGSKQLKLLDAL 647

Query: 656  VSNVTMSSIDTESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEVKAERDYLGEKL 715
            VSNVT SSIDTES FNGAIQRLYD+MQTDEVARRAI+E+RELT+K EE+KAERD+L  KL
Sbjct: 648  VSNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKCEEMKAERDHLQTKL 707

Query: 716  SKAEGGLVGQLQNELSQRDRILEKNQRVTEQLQADXXXXXXXXXXXXXXXXXXXXXXXTI 775
            ++A+ GLVGQLQ E+ Q  RILEK+ RVT+QL+AD                       TI
Sbjct: 708  AQAQDGLVGQLQGEVQQLQRILEKSNRVTDQLKADLHDLKKKHLLEKHEHEVELRKMLTI 767

Query: 776  LNSRPQGSSAVQEEEAGTASSSAPGVLHADRKLAIQKALQDRLQQTKKDLTKESKRLGTT 835
            LNS+P  +S       G  ++  P  L  ++K+AIQKALQDRL+QT+KDLT++S+R GT 
Sbjct: 768  LNSKPNDASNDAVSPDGI-NNKTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSRRFGTV 826

Query: 836  LGTTLEPNRRLKLLRSRMEDIENEARELEMTNFADIQRQTVEEQTXXXXXXXXXXXXXDR 895
                  PNRRLK+LRS+M+DIE EA  LEMTNFA+ +++T  E                 
Sbjct: 827  PA----PNRRLKMLRSKMDDIEKEALMLEMTNFAEFKKETKVEDLPRLQS---------- 872

Query: 896  APKAKKQVKEDQVRKLRELRQRLASVQKESNDVSKFNVEERINELFNDKKLSALDRLKEL 955
             PK ++ V+ ++V++L  LRQRLA +Q+ESN++SKFNVEER+NELF +KK  ALDRL++L
Sbjct: 873  PPKIERNVRSEKVKELAALRQRLAVIQQESNEISKFNVEERVNELFYEKKTKALDRLRDL 932

Query: 956  ETKYKGFGIDFQADPEL----------SAMLSDAPPENHHAKDGQAHPSLDPKHLSRKIE 1005
            E KY+ FGIDF  + EL           A + +A   N  A +      LDP  L  KIE
Sbjct: 933  EEKYRSFGIDFNMESELLIETDREGDGDASVGEA--SNSTAPNSLDSCVLDPARLDAKIE 990

Query: 1006 EMSKIVDELTAFKKEIE 1022
            EM+KI++EL   K +++
Sbjct: 991  EMTKILEELNRLKCQVD 1007

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/666 (57%), Positives = 474/666 (71%), Gaps = 27/666 (4%)

Query: 1307 FERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEKAFAAREIKLL 1366
            FE+YPRPKK+LKQLHWEKI+D  NSIW++A+AEK+ADDLYERGVL +LEKAFAAREIK L
Sbjct: 1400 FEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEKAFAAREIKSL 1459

Query: 1367 ANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLK 1426
             +R+K D NKVTFLSRD+SQQFGINLHMY++L+V ++V KIL+CDKDFL + S I+FL K
Sbjct: 1460 ISRKK-DENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSK 1518

Query: 1427 PEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWAS 1486
             EIVEVS N+AR FAPY+T+WEGVSSV+EAK PEKDP ELQRADQLYL+++VNLQ YW S
Sbjct: 1519 HEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNS 1578

Query: 1487 RMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAH 1546
            RMRALK+ITTYEK+Y+DL+ KLRS+DKAV +IQ S+NLR+VF+VILAVGNYMNDSSKQA 
Sbjct: 1579 RMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQ 1638

Query: 1547 GFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAA 1606
            GFKL+TLQRLTFIKDEKNSMTFLNYVEKI+R NY  F+ FLQELEPVL VVKIS+EQLA 
Sbjct: 1639 GFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLAN 1698

Query: 1607 DCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLM 1666
            DC EF   + NVERS+E+GNLSDSSKFHP DRVL KVLPVLPEARKR++LL+DEV+L+LM
Sbjct: 1699 DCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLM 1758

Query: 1667 EFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKKMVEEQ 1726
            EF+ LM++FGED                 I EYK+AQ  N KM          K M+EEQ
Sbjct: 1759 EFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQ 1818

Query: 1727 HKRAR--LEAEKGGVDDGSEAEGVTAVSRG-ERDVMDKLLEKLKNAGPGKSDPSSXXXXX 1783
             KRAR  ++ +      GS     +  + G +RDVMD+LLEKLKNAGP K+DPSS     
Sbjct: 1819 QKRARKNIQIDTSFSRRGSSLSTSSISASGDDRDVMDRLLEKLKNAGPSKADPSSARKRA 1878

Query: 1784 XXXXXXXDGKRSSANILDNFEVDEAAPV-----------NQSLVYSPETTLKAANAAHAE 1832
                   DGK+S + ILD  +V+E A +           N +++ SP +T+ A       
Sbjct: 1879 LARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSDSNPAILGSPTSTVGATADVEGL 1938

Query: 1833 SP---TPKASRQGSVAGSGATATPLLESPSKQASAGPEDVADRARNLLKELRGPE--SEK 1887
            +P    P A          +  +   ESPSK+     + V  RARNLL+ELR  +  +E 
Sbjct: 1939 NPDHDLPSAPISAEKGSVSSALSHSSESPSKKI-LDEDAVTHRARNLLQELRSSDDHTED 1997

Query: 1888 RKPLLEDHREKMRARR-RRVNEGASSENKLVFVGGASEAPTDSHKGLPNDTTA----DIP 1942
            RK LL++H+EK+R RR +++ E +   N    V  A  + T++H+  PN  +     DIP
Sbjct: 1998 RKSLLDEHKEKVRQRRNKKLIEESGGNNTSNEVMEAVRS-TENHESTPNFKSVSPNNDIP 2056

Query: 1943 ATPVSA 1948
             T  SA
Sbjct: 2057 ITTPSA 2062

 Score = 66.2 bits (160), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 67/137 (48%), Gaps = 20/137 (14%)

Query: 1050 ASTGSFLETLSQKYGTGQNAGPT-------ASSRAMVGRESNYPGRGYHRRSFMERVKKS 1102
             S  SFLE+LSQKYGTG N  P        +SS A    +S+    GYHR+SF+ R+KK+
Sbjct: 1106 TSNTSFLESLSQKYGTGTNLQPAEDGAKRLSSSSAFRAGDSSQRNSGYHRKSFVNRMKKN 1165

Query: 1103 D---AAPFLSELTQKVAPKTPIDGAYEIEVGARS--------EEEHIGIGIPSK--RNGT 1149
                ++ F+ E++QK+ P         ++  A S         E+ +GIGI SK    G 
Sbjct: 1166 STPKSSSFVDEVSQKMTPVHVAQSPDSLQNTATSSSTPQSAKSEDAVGIGIFSKGTNTGM 1225

Query: 1150 VVEGMKDADNSGVSNAE 1166
             V+   D     + N E
Sbjct: 1226 AVDTANDGQTPWIENGE 1242

>TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_1.82
            YNL271C
          Length = 1879

 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/1123 (43%), Positives = 683/1123 (60%), Gaps = 57/1123 (5%)

Query: 27   LFSNLKKLTGSGNNANTSNKIEPSDISSPKIVSTPAVPEFSG--KPLSKQTTLNTQNLSS 84
            L SNLK+  GS  + + S +IE SDISSP+ VS P+    +   +PL+K++T+NTQNLS 
Sbjct: 26   LLSNLKRFAGSSGSQSGSQRIETSDISSPRKVSVPSRVSNANDLRPLNKKSTMNTQNLSH 85

Query: 85   YVDMNTP------HHNRSPSGMSGSPTKYSYSRRSSQWSNGNNIGNGGRLSRQQTNQSLS 138
            Y++  +       +H+RSPS  S   TKY+YSRRSS  S+ +  G    L+R+ TNQSLS
Sbjct: 86   YMNGKSSAESLSSNHSRSPSVQSS--TKYTYSRRSS--SHLSTPGVNSTLTREPTNQSLS 141

Query: 139  SASIFSQGSMTNLTKFMGADGKVKLDRPSNPQEIEDLFAELMHKRNFFQSLPAAGQKELM 198
            S+S+ SQ S +NL  FM  DGK+KLD PS+  E+E+LF ++M+KRN  Q+L    QKELM
Sbjct: 142  SSSVLSQDSFSNLAIFMTPDGKIKLDMPSS-HEVENLFEDMMYKRNILQNLSPDKQKELM 200

Query: 199  NYDLDKKWLLVKQDLQSELKKLANK--KNTHVXXXXXXXXXXXXXXXXXXXXXXXXXXXX 256
            +YD+DKKWL+VKQDLQ++ KKL  K     H                             
Sbjct: 201  DYDVDKKWLIVKQDLQNDFKKLLAKGVPAAHAAISSSNSDSLPSSLKVSSPRSSMTYESI 260

Query: 257  XXXXXXSKGHNSTSSPILGGGG--FYESGNQNSSTATLSQDPLHLSPDYYVRKIISDKIS 314
                  +K +N +SS           +  ++NSST+TL+ + ++  P +YV++II+DK++
Sbjct: 261  QQAIKFNKTNNGSSSGPASNNKSKLQQLSDKNSSTSTLTTEKINRPPIHYVKRIIADKLT 320

Query: 315  TKQLKDLWVSLRTEQLDWVVGFLDAQGQVAIANVLLRFFHKESPDALLNDEALDKEFAFF 374
              ++ DLWV+LRTEQLDWV GFL+ QG +A+ANVL    +K  P+  L+ + L+KE AFF
Sbjct: 321  GNEMNDLWVTLRTEQLDWVDGFLEHQGHIAMANVLTTSIYKTDPETPLSYDLLEKEHAFF 380

Query: 375  KCLKTLLNLKEGANEAVRTKLVVSAITDGLLSLRISTRRIASEMLVFITQWDIPYGLNQV 434
            +C + L  L +G  E  R  ++   + +GL S+R++TR++A+E+ V + +         V
Sbjct: 381  RCFRVLSVLTQGLYELSRHNIMAETVANGLFSVRLATRKMATEIFVCMLEKKNKVRFEAV 440

Query: 435  IGELDQESHVSSNVHLQARLLSANKRDSLLAQDHELDLTRDHASKKFEQWLFVVEYTLDG 494
            +  LD++  +  N+H+   + ++ +        H    TRD   K  + WLF VE +L+G
Sbjct: 441  LNALDKKFKIGENLHMLHYMKNSPQ--------HFSHFTRDSQFKIVQSWLFAVEQSLEG 492

Query: 495  RGKMGSLVGASEDFKSAGGENAILEYGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLS 554
            RGKMGSLVGASEDFK++GGENAILEY   T++ +N  CN    +NQR LLR+R ++ G  
Sbjct: 493  RGKMGSLVGASEDFKASGGENAILEYSQWTMVFINHFCNGTDVINQRILLRTRLENAGGL 552

Query: 555  RIMQKLELLNYDKIDEQLRIFEDRTADDYNTIMASKSINHNVDMENPLSLLQNLWESYKG 614
            RIM + +LL+YDK+ E +  +E+   DD N+++ + +   ++DM +  SLL+ L++  KG
Sbjct: 553  RIMNQFKLLDYDKVMELVEAYENLKLDDLNSVLETGAHASDIDMNDSASLLKKLFDYCKG 612

Query: 615  TGAEKYLVSLVQHLFIASSKVQDEGDDPTEASKQLKLIDSLVSNVTMSSIDTESSFNGAI 674
            T +EK L SLV+HLF+++S++ ++  DPT+ SKQL+L+DSLV+NV++S++D  SS N AI
Sbjct: 613  TESEKLLNSLVKHLFLSTSRLMEDNQDPTKLSKQLRLMDSLVTNVSVSAVDESSSINMAI 672

Query: 675  QRLYDSMQTDEVARRAIMEARELTRKFEEVKAERDYLGEKLSKAEGGLVGQLQNELSQRD 734
            QRLYDSMQTDEVARRAI+E+R LT+K EE +AERD+L +KLSK   GLVGQL+ E+ QRD
Sbjct: 673  QRLYDSMQTDEVARRAILESRTLTKKLEEAQAERDFLSQKLSKTGNGLVGQLEKEVQQRD 732

Query: 735  RILEKNQRVTEQLQADXXXXXXXXXXXXXXXXXXXXXXXTILNSRPQGSSAVQEEEAGTA 794
             ILEKNQRVT QLQ +                       TILNSRP+G  +    +    
Sbjct: 733  DILEKNQRVTLQLQDELEELKKKHLLEKHEHEVELRKMLTILNSRPEGDLS---RKGSVH 789

Query: 795  SSSAPGVLHADRKLAIQKALQDRLQQTKKDLTKESKRLGTTLGTTLEPNRRLKLLRSRME 854
            S + PG+L  D+K  IQ+ALQD L +TKKDL+ +SKR     G T++PN+RLK+LR +ME
Sbjct: 790  SKAQPGILDPDKKSTIQQALQDGLLKTKKDLSVDSKR----FGITVQPNKRLKMLRLQME 845

Query: 855  DIENEARELEMTNFADIQRQTVEEQTXXXXXXXXXXXXXDRAPKAKKQVKEDQVRKLREL 914
            DIE EARELEMTNFAD  +  ++                 RA       KE +  KL EL
Sbjct: 846  DIEQEARELEMTNFADHNKAVLQAPVKVESSNYVRKENELRA-------KELKANKLSEL 898

Query: 915  RQRLASVQKESNDVSKFNVEERINELFNDKKLSALDRLKELETKYKGFGIDFQADPELSA 974
            R+ LA +QKESN VSKFNVEER+NELF  KKLSALDRL +LE  YK +GID         
Sbjct: 899  RKALADIQKESNGVSKFNVEERVNELFKQKKLSALDRLNDLENMYKEYGIDLST----HF 954

Query: 975  MLSDAPPENHHAKDGQAHPS-LDPKHLSRKIEEMSKIVDELTAFKKEIENG-------PP 1026
             + D P E+  ++     PS LDP+    K++E+ +I  EL   K E++N         P
Sbjct: 955  PIQDEPQESAESEKNAEGPSTLDPRAYQAKLDEIDRISKELIEMKSELKNDKALRRHESP 1014

Query: 1027 XXXXXXXDEELEQDDRASIHSGNASTGSFLETLSQKYGTGQNAGPTASSRAMVGRESNYP 1086
                   DE  +     +    ++ T SFLE+LSQKYGTG+NA    ++  +   E    
Sbjct: 1015 SKQDTDDDEIQDTGSMVNEDLQSSGTSSFLESLSQKYGTGKNATNMLTNDILNSSER--- 1071

Query: 1087 GRGYHRRSFMERVKKSDAAP-FLSELTQKVAPKTPIDGAYEIE 1128
             +G+ R+SFMER+KK    P +L EL  KV PK P  G  E E
Sbjct: 1072 -KGHSRQSFMERMKKPSGVPAYLEELPLKV-PKAPPLGVAETE 1112

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/678 (53%), Positives = 461/678 (67%), Gaps = 44/678 (6%)

Query: 1288 KAMYRAATXXXXXXXXXXXFERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYE 1347
            K  YR A            F  YPR +KKLKQLHWEK++ T NSIW   KAEK+A DLYE
Sbjct: 1232 KMAYRTAVPSPLLPQSPSLFSSYPRARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYE 1291

Query: 1348 RGVLAQLEKAFAAREIKLLANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKI 1407
            +GVL  LEKAFAAREIK LA +++EDL+K+TFLSRDVSQQFGINLHMY+ LSV+E+V KI
Sbjct: 1292 KGVLEDLEKAFAAREIKSLATKKREDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKI 1351

Query: 1408 LRCDKDFLGSASVIDFLLKPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQ 1467
            L+C++DF+ + SV++FL KPEI+EVS NLARN++PYST+W+GVS V++AK+PEKDP ELQ
Sbjct: 1352 LKCERDFMDTPSVLEFLSKPEIIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQ 1411

Query: 1468 RADQLYLEMMVNLQGYWASRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSV 1527
            RADQLYL+++ NLQ YW SRMRAL+VIT+YE+EYS+L+TKLR +DKAV+ IQ S NLR+V
Sbjct: 1412 RADQLYLQLIYNLQPYWGSRMRALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNV 1471

Query: 1528 FEVILAVGNYMNDSSKQAHGFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFL 1587
            F VILAVGNYMNDS+KQA GFKL+TLQRLTFIKD  NSMTFLNYVEKI+R+NY  FN FL
Sbjct: 1472 FNVILAVGNYMNDSAKQAQGFKLSTLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFL 1531

Query: 1588 QELEPVLDVVKISVEQLAADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVL 1647
            ++L+PVLDVVKIS+EQL +DC+EFSQ+I NVERSI++GNL+DSSKFHP D+VLVKVLPVL
Sbjct: 1532 EDLQPVLDVVKISIEQLISDCKEFSQSITNVERSIDIGNLNDSSKFHPLDKVLVKVLPVL 1591

Query: 1648 PEARKRSDLLSDEVKLTLMEFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNI 1707
            PEA KR +LL +EVKL++MEF+ LMQ +GED                 I EYK+AQA N+
Sbjct: 1592 PEASKRVELLDEEVKLSIMEFESLMQRYGEDSADKFAKNSFFKKFADFINEYKRAQAQNL 1651

Query: 1708 KMXXXXXXXXXXKKMVEEQHKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLK 1767
            K           KKMVEEQ KRA    EK   ++ +E E  +  +   R +MDKLLE+LK
Sbjct: 1652 KAEEEERLYQTHKKMVEEQQKRAE---EKERSENATE-EDASEENEDRRAMMDKLLEQLK 1707

Query: 1768 NAGPGKSDPSSXXXXXXXXXXXXDGKRSSANILDNFEVDEAAPVNQSLVYSPETTLKAAN 1827
            NAGP K+DP S            +   + +++LD+ + ++      S++YSPE      N
Sbjct: 1708 NAGPVKADPLSARKRAMIRKKMLNDSEAVSDVLDSIQQED-----DSMIYSPEKQEGITN 1762

Query: 1828 AAHAESPTPKASRQGSVAGSGATATPLLESPSKQASAGPED---VADRARNLLKELRGPE 1884
                  PT  +S                +SPSK A+   +D   + DRA+ LL  LRG E
Sbjct: 1763 ------PTGDSS----------------QSPSKGAANNQQDEEEITDRAKALLMGLRGGE 1800

Query: 1885 S-EKRKPLLEDHREKMRARRRRVNEGASSENKLVF----VGGASEAPTD-----SHKGLP 1934
            S  KR  +L  H+EK+RARRR+ N   S E   +F     G  S A TD           
Sbjct: 1801 SPSKRNNVLNGHKEKLRARRRKTNTDMSPEGSFLFNEEVRGTISSADTDYSNEQQSNSEA 1860

Query: 1935 NDTTADIPATPVSADDEP 1952
            N  T  I +T    +D+P
Sbjct: 1861 NTLTKSIRSTLTEENDDP 1878

>Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {ON}
            YNL271C (REAL)
          Length = 1952

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/1175 (41%), Positives = 689/1175 (58%), Gaps = 134/1175 (11%)

Query: 27   LFSNLKKL---------TGSGNNANTSNKIEPSD---------------ISSP-KIVSTP 61
            LF NLK+L         TGS  N +   +  P +               ++ P + +ST 
Sbjct: 23   LFQNLKRLANSNAANNNTGSPTNVSPQQQHSPVEHEAATSPASSSSFRKLNGPSRSISTE 82

Query: 62   AVPEFSGKPLSKQTTLNTQNLSSY----VDMNTP---HHNRSPSGMSGSPTKYSYSRR-S 113
            A      +PL+K++TLNTQNLS Y    +  + P    H RS S  S    KYSYS+R S
Sbjct: 83   A------RPLNKKSTLNTQNLSQYMNGKISADVPVSSQHARSHSMQS----KYSYSKRNS 132

Query: 114  SQWSNGNNIGNGGRLSRQQTNQSLSSASIFSQGSMTNLTKFMGADGKVKLDRPSNPQEIE 173
            SQ SN        +L+RQ T QS S +S+ SQGS+TNL+KF   DGK+ L+ PS+P E+E
Sbjct: 133  SQASN--------KLTRQHTGQSHSVSSLLSQGSLTNLSKFTTPDGKIHLEMPSDPYEVE 184

Query: 174  DLFAELMHKRNFFQSLPAAGQKELMNYDLDKKWLLVKQDLQSELKKL-ANKKNTH----- 227
             LF ++M+KRN FQSL    Q+ LM+Y  +KKWL+VKQDLQ+ELKKL AN  ++      
Sbjct: 185  VLFEDIMYKRNIFQSLSGDKQEALMSYSTEKKWLIVKQDLQNELKKLRANTTSSSTASRT 244

Query: 228  -----------VXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKGHNSTSSPILGG 276
                                                          S G +++ S  L G
Sbjct: 245  SIASDHHPILTANSSLSSPKSVLMTSASSPTSTVYSNSLNHSTTLSSVGTSTSKSKKLMG 304

Query: 277  GGF---------YESGNQNSSTA-TLSQDPLHLSPDYYVRKIISDKISTKQLKDLWVSLR 326
            G           Y  G++N+++A TL  D  +  P +YV++I++DK++T ++KDLWV+LR
Sbjct: 305  GSLKKQPSLNNIYRGGSENNTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLR 364

Query: 327  TEQLDWVVGFLDAQGQVAIANVLLRFFHKESPDALLNDEALDKEFAFFKCLKTLLNLKEG 386
            TEQLDWV  F+D QG +A+ANVL+   +K +P   L  E L+KE +FFKC + L  L +G
Sbjct: 365  TEQLDWVDAFIDHQGHIAMANVLMNSIYKTAPRDSLTKELLEKENSFFKCFRVLSMLSQG 424

Query: 387  ANEAVRTKLVVSAITDGLLSLRISTRRIASEMLVFITQWDIPYGLNQVIGELDQESHVSS 446
              E    +L+   + +GL S R++TR++A+E+ V + +         V+  LD++  +  
Sbjct: 425  LYEFSTHRLMTDTVAEGLFSTRLATRKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQ 484

Query: 447  NVHLQARLLSANKRDSLLAQDHELDLTRDHASKKFEQWLFVVEYTLDGRGKMGSLVGASE 506
            N+H+        +  S L  +  L        K  + WLF VE TLDGRGKMGSLVGAS+
Sbjct: 485  NLHMIQNFKKMPQYFSHLTLESHL--------KIIQAWLFAVEQTLDGRGKMGSLVGASD 536

Query: 507  DFKSAGGENAILEYGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLELLNYD 566
            +FK+ GGENAILEY   T++ +N LC+   ++NQR LLR++ ++CG+ RIM K++LL+YD
Sbjct: 537  EFKNGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYD 596

Query: 567  KIDEQLRIFEDRTADDYNTIMASKSINHNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQ 626
            K+ +Q+ ++++   DD+N  + + +   NVD+++PLSLL+NLW+  KGT  EK LVSLVQ
Sbjct: 597  KVMDQIELYDNNKLDDFNVRLEANNKAFNVDLQDPLSLLKNLWDICKGTENEKLLVSLVQ 656

Query: 627  HLFIASSKVQDEGDDPTEASKQLKLIDSLVSNVTMSSI-DTESSFNGAIQRLYDSMQTDE 685
            HLF++SSK+ +E  +P++ +KQLK++DSLV++V+++S  D ES+ N AIQRLYD+MQTDE
Sbjct: 657  HLFLSSSKLIEENQNPSKLTKQLKVMDSLVTSVSIASTSDEESNMNMAIQRLYDAMQTDE 716

Query: 686  VARRAIMEARELTRKFEEVKAERDYLGEKLSKAEGGLVGQLQNELSQRDRILEKNQRVTE 745
            VARRAI+E+R LT+K EE++AERD L EKLSKAE GLVGQL++EL  RDRIL KNQRV +
Sbjct: 717  VARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQLEDELHGRDRILAKNQRVMQ 776

Query: 746  QLQADXXXXXXXXXXXXXXXXXXXXXXXTILNSRPQGSSAVQEEEAGTASSSAPGVLHAD 805
            QL+A+                       TILNSRP+ +S++ E   G  SS     L++ 
Sbjct: 777  QLEAELEELKKKHLLEKHQQEVELRKMLTILNSRPEENSSINEGIRGKNSS-----LNSS 831

Query: 806  RKLAIQKALQDRLQQTKKDLTKESKRLGTTLGTTLEPNRRLKLLRSRMEDIENEARELEM 865
             K  IQK LQD L +      K+ K      G TL+PN+RLK+LR +ME+IENEAR+LEM
Sbjct: 832  EKANIQKVLQDGLSRA----KKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEM 887

Query: 866  TNFADIQRQTVEEQTXXXXXXXXXXXXXDRAPKAKKQVKEDQVRKLRELRQRLASVQKES 925
            TNFA+ ++  +E                D+   ++ Q  E  + KL +LR+ LA +Q ES
Sbjct: 888  TNFAEFEKDHLEPPIQIKKPKLKKIKHKDKKLISRPQ--EVDMNKLNDLRRALAEIQMES 945

Query: 926  NDVSKFNVEERINELFNDKKLSALDRLKELETKYKGFGIDFQADPELSAMLSDAPPENHH 985
            ND+SKFNVEER+NELFN+KK  AL RLKELETKYKGFGIDF  +  + +   ++   N  
Sbjct: 946  NDISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEEIMESPKKNSA--NER 1003

Query: 986  AKDGQAHPSLDPKHLSRKIEEMSKIVDE---LTAFKKEIENGPPXXXXXXXDEELE---- 1038
             +DG  + SLDP+    K++E+++I D+   L A  K+ + G           E E    
Sbjct: 1004 KEDGANYSSLDPRTYQNKLDEINRITDQLLDLQAQTKQDDGGVSSLSSSSSSAEGEDVYQ 1063

Query: 1039 ----------QDDRASIHSGNASTGSFLETLSQKYGTGQNAGPTASSRAMVG-RESNYPG 1087
                      ++   S+ SG   +GSFL+ LSQKYGTGQN      +   VG R+S+Y  
Sbjct: 1064 DAFPAQEVRSENSELSVESG---SGSFLDALSQKYGTGQN------NTVSVGLRDSDYVS 1114

Query: 1088 RGYH-----RRSFMERVKKSDA--APFLSELTQKV 1115
               H      ++FM +++KS A  AP+L ELTQKV
Sbjct: 1115 VIGHMPSKVEKTFMNKLRKSTASSAPYLEELTQKV 1149

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/617 (59%), Positives = 453/617 (73%), Gaps = 17/617 (2%)

Query: 1307 FERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEKAFAAREIKLL 1366
            FE+YPRP KKLKQLHWEK++ T NSIW   KAEK+ADDLYE+GVLA LEKAFAAREIK L
Sbjct: 1347 FEKYPRPHKKLKQLHWEKLDSTDNSIWGTGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1406

Query: 1367 ANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLK 1426
            A +RKEDL K+TFLSRD+SQQFGINLHMY++LSV ++V KIL CD+DFL + SV++FL K
Sbjct: 1407 ATKRKEDLKKITFLSRDISQQFGINLHMYSSLSVTDLVKKILNCDRDFLQTPSVVEFLSK 1466

Query: 1427 PEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWAS 1486
            PEI+EVS NLARN+APYST+WEGV ++ +AK PEKDP +LQRADQ+YL++MVNL+ YW S
Sbjct: 1467 PEIIEVSVNLARNYAPYSTDWEGVKNLKDAKPPEKDPNDLQRADQIYLQLMVNLESYWGS 1526

Query: 1487 RMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAH 1546
            RMRAL V+T+YEKEY++LLTKLR +DKAV ++Q SDNLR+VF VILAVGN+MND+SKQA 
Sbjct: 1527 RMRALIVVTSYEKEYNELLTKLRKVDKAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQ 1586

Query: 1547 GFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAA 1606
            GFKL+TLQRLTFIKD  NSMTFLNYVEKIIR NY  FN FL+ELEPVLDVVK+S+EQL  
Sbjct: 1587 GFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVN 1646

Query: 1607 DCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLM 1666
            DCR+FSQ+IVNVERS+E+GNLSDSSKFHP D++L+K LPVLPEARK+ DLL DEVKLT+M
Sbjct: 1647 DCRDFSQSIVNVERSVEIGNLSDSSKFHPLDKILIKTLPVLPEARKKGDLLEDEVKLTIM 1706

Query: 1667 EFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKKMVEEQ 1726
            EF+ LM  +GED                 I EYKKAQ+ N+            KK+VEEQ
Sbjct: 1707 EFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQSQNLAAEEEERIYEKHKKIVEEQ 1766

Query: 1727 HKRAR-LEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLKNAGPGKSDPSSXXXXXXX 1785
             KRA+  E +K   +  S        +   R VMDKLLE+LKNAGPGKSDPSS       
Sbjct: 1767 QKRAQEREKQKENSNSSSSEGNEEDEAEDRRAVMDKLLEQLKNAGPGKSDPSSARKRALV 1826

Query: 1786 XXXXXDGKRSSANILDNFEVDEAAPVNQSLVYSPETTLKAANAA-HAESPTPKASRQGSV 1844
                   K +S  +L++ + +E      S++YSPE     A+A  HAESPTP  +R    
Sbjct: 1827 RKRYLSDKDNSQQLLNDLDNEEG-----SILYSPEALDPDADAVIHAESPTPLTTR---- 1877

Query: 1845 AGSGATATPL-LESPSKQAS-AGPEDVADRARNLLKELRGPESE-KRKPLLEDHREKMRA 1901
               G    P  L SPSK ++    E+++DRA+ LLKELRG ++  K+  +L++H EK+RA
Sbjct: 1878 ---GTLNIPEDLPSPSKASTLEDQEEISDRAKMLLKELRGSDTPVKQNSILDEHLEKLRA 1934

Query: 1902 RRRRVNEGASSENKLVF 1918
            R+ R     S+ NKL F
Sbjct: 1935 RKERTIGEGSAGNKLSF 1951

>CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} similar
            to uniprot|P41832 Saccharomyces cerevisiae YNL271c BNI1
            regulator of budding
          Length = 1898

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/1138 (41%), Positives = 684/1138 (60%), Gaps = 100/1138 (8%)

Query: 27   LFSNLKKLTGSG-NNANTSNK---IEPSDIS---SPKIVSTPAVPEFSG-----KPLSKQ 74
            LF NL++LT    +N N S K   ++  +IS   +  I  + AV    G     +PL+K+
Sbjct: 21   LFQNLRRLTTKDRDNRNKSPKRTSLDNDNISQRSTKNINVSQAVSSRHGSIDQSRPLNKK 80

Query: 75   TTLNTQNLSSYVDMN---TP----HHNRSPSGMSGSPTKYSYSRRSS-QWSNGNNIGNGG 126
            +TLN+QNLS YV+     +P    +H+R+ S  SG   KYSYSRRSS Q S   +     
Sbjct: 81   STLNSQNLSQYVNNGKALSPESGSNHHRTDSTQSG--FKYSYSRRSSGQVSMAPSSMGNI 138

Query: 127  RLSRQQTNQSLSSASIFSQGSMTNLTKFMGADGKVKLDRPSNPQEIEDLFAELMHKRNFF 186
             L+R  TN S SSAS+ S GS+TNL++FM  DGK+ L  PS+P E+E LF ++M+KRN  
Sbjct: 139  NLTRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVESLFEDIMYKRNIL 198

Query: 187  QSLPAAGQKELMNYDLDKKWLLVKQDLQSELKKL--ANKKNTHVXXXXXXXXXXXXXXXX 244
            QSLP   Q ELM+Y ++KKWL+VKQDLQ+E K++  +NK ++                  
Sbjct: 199  QSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKASNKGDSRTGMSMPDLGSDPSNSVS 258

Query: 245  XXXXXXXXXXXXXXXXXXS----------KGHNSTSSPILGGGG-FYESGNQNSSTATLS 293
                              S          K +   S PI       Y    +N+S++T+ 
Sbjct: 259  PPGPISSSGSSIFSSDVTSTAPSTYSRSGKKNIPISKPIAATSTELYHIAERNTSSSTIQ 318

Query: 294  QDPLHLSPDYYVRKIISDKISTKQLKDLWVSLRTEQLDWVVGFLDAQGQVAIANVLLRFF 353
             D  +  P +YV+KI+ DK+S  ++KDLWV+LRTEQLDWV  FL+ QG +A+AN+L++  
Sbjct: 319  SDKANRPPIHYVKKIVDDKLSKDEMKDLWVTLRTEQLDWVDAFLENQGHIAMANILMKSI 378

Query: 354  HKESPDALLNDEALDKEFAFFKCLKTLLNLKEGANEAVRTKLVVSAITDGLLSLRISTRR 413
            +K +P   +++  LDKE AFFKC + L  L +G +E     L+   I  GL S R++TR+
Sbjct: 379  YKTTPKDKVSEPLLDKENAFFKCFRVLAVLSQGLHEFTIHSLMTDTIAQGLFSGRLATRK 438

Query: 414  IASEMLVFITQWDIPYGLNQVIGELDQESHVSSNVHLQARLLSANKRDSLLAQDHELDLT 473
            +A+E+ VF+ +         V+  LD+   +  N H+       N+    L Q +   LT
Sbjct: 439  MATEIFVFLLEKKNKKRFESVLSSLDKNFIIGQNSHM-------NESYKKLPQ-YFTHLT 490

Query: 474  RDHASKKFEQWLFVVEYTLDGRGKMGSLVGASEDFKSAGGENAILEYGYLTLLLVNQLCN 533
             +   K  + WLF VE TLDGRGKMGSLVGASED+K+AGGENAILEY   T++ +N LC+
Sbjct: 491  SNSNLKVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAGGENAILEYCQWTMVFINHLCS 550

Query: 534  TPADVNQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTADDYNTIMASKSIN 593
            +  ++NQRTLLR + ++CG+ RIM K++LL+Y+K+ +Q+ ++E+   DD+N ++ S   N
Sbjct: 551  SSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIELYENNKLDDFNALLESNKKN 610

Query: 594  HNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQHLFIASSKVQDEGDDPTEASKQLKLID 653
             NVD+++P+SL++NL ++ KGT  EK LVSLVQH+F+ +SK+ DE  DP + +KQLKL+D
Sbjct: 611  INVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQDPNKVTKQLKLMD 670

Query: 654  SLVSNVTMSSIDTESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEVKAERDYLGE 713
            SLV+NV+++S +  S+ N AIQRLYDSMQTDEVARRAI+E+R LT+K EE++AERD L E
Sbjct: 671  SLVTNVSVTSTEEGSNVNMAIQRLYDSMQTDEVARRAILESRTLTKKLEEMEAERDMLVE 730

Query: 714  KLSKAEGGLVGQLQNELSQRDRILEKNQRVTEQLQADXXXXXXXXXXXXXXXXXXXXXXX 773
            KLSKAE GLVGQL+ E+ +RDRIL KNQRV +QL+++                       
Sbjct: 731  KLSKAEHGLVGQLEMEVKERDRILAKNQRVMKQLESELEELKKKHLLEKHEQEVELRKML 790

Query: 774  TILNSRPQGSSAVQEEEAGTASSSAPGVLHADRKLAIQKALQDRLQQTKKDLTKESKRLG 833
            TILNSRP   +  Q+++ G+        + A  K  +Q+ALQ  LQ+      K+ K   
Sbjct: 791  TILNSRP-AKTKEQKKKIGS--------IEASEKEDLQRALQSGLQKA----KKDFKDDS 837

Query: 834  TTLGTTLEPNRRLKLLRSRMEDIENEARELEMTNFADIQRQTVEEQTXXXXXXXXXXXXX 893
               G T++PN+RLK+LR +ME IENEAR+LEMTNFA+ +++ ++                
Sbjct: 838  KKFGMTIQPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKPPANVQK--------- 888

Query: 894  DRAPKAKKQVKEDQVRKLRELRQRLASVQKESNDVSKFNVEERINELFNDKKLSALDRLK 953
             ++    +  KE +++KL ELR +L  +Q ESNDVSKFNV+ER+NELFNDKK +AL RLK
Sbjct: 889  -KSKPISELNKEQRIQKLNELRDKLRRIQMESNDVSKFNVDERVNELFNDKKRTALQRLK 947

Query: 954  ELETKYKGFGIDFQADPELSAMLSDAPPENHHAKDGQAHPSLDPKHLSRKIEEMSKIVDE 1013
            ELETKYKGFGIDF+ + + +   +D+  E         + SLDPK    K++E++KI +E
Sbjct: 948  ELETKYKGFGIDFKVE-DFTHESTDSSNE--------GYSSLDPKVYQDKLDEITKISEE 998

Query: 1014 LTAFKKEIENGPPXXXXXXXDEE------------LEQDDRASIHSGNAS---TGSFLET 1058
            L   K E+E           D E            L  +   +  S N S   +GSFL+T
Sbjct: 999  LLQQKNELETTQTSSSESNSDSESSSDSDDSMEDALTNNKDINGTSSNVSDLASGSFLDT 1058

Query: 1059 LSQKYGTGQNAGPTASSRAMVGRESNYPGRGYHRRSFMERVKKSDAAP-FLSELTQKV 1115
            L+QKYGTGQ A P  S    VG  SN      + +SF++R+K++   P ++ EL++K+
Sbjct: 1059 LTQKYGTGQ-AEPIQSP---VGHYSN-----RNEKSFVDRMKRNSRVPSYVEELSKKM 1107

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/618 (56%), Positives = 446/618 (72%), Gaps = 16/618 (2%)

Query: 1307 FERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEKAFAAREIKLL 1366
            FE YPRP+KKLKQLHWEK+E T NSIW   KAEK+ADDLYE+GVL++LEKAFAAREIK L
Sbjct: 1255 FENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEKAFAAREIKSL 1314

Query: 1367 ANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLK 1426
            A R+KEDL K++FLS D+SQQFGINLHMY+ L+V + V K+L+C++DF+ + SVI+FL K
Sbjct: 1315 ATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSK 1374

Query: 1427 PEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWAS 1486
             EIVEVS NLARN+APYST+WEG+  +++AK PEKDP ELQRADQ+YL++MVNLQ YWAS
Sbjct: 1375 QEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWAS 1434

Query: 1487 RMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAH 1546
            RMRA+++IT+YE+EY++LL KL  +DKAV S+Q SDNL+++F VILAVGN+MNDS+KQA 
Sbjct: 1435 RMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAK 1494

Query: 1547 GFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAA 1606
            GFKL+TLQRLTFIKD  NSMTFLNYVEKI+R NY EFN+FL ELEPVL+VVK+S+EQL  
Sbjct: 1495 GFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVN 1554

Query: 1607 DCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLM 1666
            DC +F Q I NVERSIE+GNLSDSSKFHP D+VL+KVLP L EARK+ +LL+DE+KLT+M
Sbjct: 1555 DCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIM 1614

Query: 1667 EFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKKMVEEQ 1726
            EF+ +MQ +GED                 I EYKKAQA NIK+          KKMVEEQ
Sbjct: 1615 EFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQ 1674

Query: 1727 HKRARLEAEKGGVDDGSEAEG---VTAVSRGERDVMDKLLEKLKNAGPGKSDPSSXXXXX 1783
             ++A+ +A K  +++ S   G       S   R VMDKLLE+LKNAG  K+DP+S     
Sbjct: 1675 QRKAQEDASK--LNENSSQTGNSDEEEESEDRRAVMDKLLEQLKNAGQVKTDPTSARKRA 1732

Query: 1784 XXXXXXXDGKRSSANILDNFEVDEAAPVNQSLVYSPETTLKAANAAHAESPTPKASRQGS 1843
                     + S ++ L   +V        SL+YSP+   +     H  SPTPK    G 
Sbjct: 1733 LLRKKIHSSEESESSPLAEMQVG-----GDSLIYSPDAKEQIELEIHMASPTPKTKEDGK 1787

Query: 1844 VAGSGATATPLLESPSKQASAGPEDVADRARNLLKELRGPES-EKRKPLLEDHREKMRAR 1902
            + G+G  +    ESP K+ +   E++ DRA+ LL ELRG ++   R   L++H+E++RAR
Sbjct: 1788 L-GTGENSNG--ESPLKKINED-EEIGDRAKTLLMELRGSDALMDRNTALDEHKERLRAR 1843

Query: 1903 RRRVNEG-ASSENKLVFV 1919
            R+R +     S N+L FV
Sbjct: 1844 RKRTDSNKIPSSNRLKFV 1861

>KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1.82
            YNL271C
          Length = 1957

 Score =  773 bits (1996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/1140 (42%), Positives = 680/1140 (59%), Gaps = 93/1140 (8%)

Query: 27   LFSNLKKLTGSGNNANTSNK------IEPSDISSP--------------KIVSTPAVPEF 66
            LF NLK+LT   NN+N ++K      I  S ISSP                 S  +    
Sbjct: 23   LFQNLKRLTS--NNSNNTSKYTESYSINKSSISSPLQKHDTNLPPSSSSSPSSNASAITT 80

Query: 67   SGKPLSKQTTLNTQNLSSYVDMNTPHHNRSPSGMSGSPTKYSYSRRSSQWSNGNNIGNGG 126
            + KPL+K++TLNTQNLS Y+D    H   S +  + +    S  R S+Q S   ++    
Sbjct: 81   TNKPLNKKSTLNTQNLSQYMD----HARSSSTNSASASKYSSSRRSSTQVSTSESLR--- 133

Query: 127  RLSRQQTNQSLSSASIFSQGS-MTNLTKFMGADGKVKLDRPSNPQEIEDLFAELMHKRNF 185
            RLSRQ T QS SSASI SQ S   N +KF+  DGK  L+ P +P+EIE+LF E+M+KRN 
Sbjct: 134  RLSRQHTGQS-SSASIHSQNSSYINFSKFITPDGKTNLEMPRDPKEIENLFEEIMYKRNI 192

Query: 186  FQSLPAAGQKELMNYDLDKKWLLVKQDLQSELKKL-ANK---KNTHVXXXXXXXXXXXXX 241
             Q+L    Q+ELMNYD+ KKWL+VKQD+Q+E K++ A K   KN+ +             
Sbjct: 193  LQNLSVEKQRELMNYDVRKKWLIVKQDIQNEFKRIRATKNGPKNSSLVNVEQLVYSPTTT 252

Query: 242  XXXXXXXXXXXXXXXX--XXXXXSKGHNSTSSPIL---GGGGFYESGNQNSSTATLSQDP 296
                                   S  +   +SP          Y+    N+ST+TLS D 
Sbjct: 253  TTNNNNNNNNSNYNNTSPMASVASNEYYPMTSPQTKKPTSHELYQLTESNASTSTLSSDK 312

Query: 297  LHLSPDYYVRKIISDKISTKQLKDLWVSLRTEQLDWVVGFLDAQGQVAIANVLLRFFHKE 356
             +  P+ YV KII+DK+S  +++DLWV+LRTEQLDWV  FL+ QG +A+AN+L++  +K 
Sbjct: 313  TNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLENQGHIAMANILMKQIYKT 372

Query: 357  SPDALLNDEALDKEFAFFKCLKTLLNLKEGANEAVRTKLVVSAITDGLLSLRISTRRIAS 416
            +P   L+ + L+KE +FFKC K L  L +G  E  + KL+   I  GL S R+ TR++A 
Sbjct: 373  TPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLMTDTIARGLFSTRLGTRKMAI 432

Query: 417  EMLVFITQWDIPYGLNQVIGELDQESHVSSNVHLQARLLSANKRDSLLAQDHELDLTRDH 476
            E+ V + +         ++  LDQ   + SN H+   L         L Q + + LT D 
Sbjct: 433  EIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNLKK-------LPQ-YFIHLTPDS 484

Query: 477  ASKKFEQWLFVVEYTLDGRGKMGSLVGASEDFKSAGGENAILEYGYLTLLLVNQLCNTPA 536
              K  + WLF +E T+DGRGKMGSLVGAS D K++GGENAILEY   T++ VN LCN   
Sbjct: 485  HLKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNMLCNAST 544

Query: 537  DVNQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTADDYNTIMASKSINHNV 596
             + QR LLR++ ++ G  RIM K++LLNY+K+ +++  +E+   DD+N ++ SK+ N NV
Sbjct: 545  IIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLMLESKNKNSNV 604

Query: 597  DMENPLSLLQNLWESYKGTGAEKYLVSLVQHLFIASSKVQDEGDDPTEASKQLKLIDSLV 656
            ++++P+SLL NLW+S KGT  EK L+SL+QHLF++SS++ +E DDPT+ SKQLKL+DSLV
Sbjct: 605  NLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKLSKQLKLMDSLV 664

Query: 657  SNVTMSSI-DTESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEVKAERDYLGEKL 715
            +NV+ SS  D ES+ N AIQRLYDSMQTDEVARRAI+E+R LT+K EE++AE+D L EKL
Sbjct: 665  TNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKDLLHEKL 724

Query: 716  SKAEGGLVGQLQNELSQRDRILEKNQRVTEQLQADXXXXXXXXXXXXXXXXXXXXXXXTI 775
            SKAE GLVGQL+N+L++RD+IL KNQRVT+QLQ++                       TI
Sbjct: 725  SKAENGLVGQLENDLNERDQILAKNQRVTQQLQSELEELKKKHLLEKHEHEVELRKMLTI 784

Query: 776  LNSRPQ---GSSAVQEEEAGTASSSAPGVLHADRKLAIQKALQDRLQQTKKDLTKESKRL 832
            LN+R     G+  + +++   +       L+  +   IQK LQD L + K D T ++K+ 
Sbjct: 785  LNTRSSTNDGAKTIDKDKDNISK------LNLQKHENIQKVLQDGLIRAKNDFTIDAKK- 837

Query: 833  GTTLGTTLEPNRRLKLLRSRMEDIENEARELEMTNFADIQRQTVEEQTXXXXXXXXXXXX 892
                G T++PN+RLK+LR +MEDIENEAR+LEMTNF + +R+ +E               
Sbjct: 838  ---FGMTVQPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTKPKHRHKKH 894

Query: 893  XDRAPKAKKQVKEDQ---VRKLRELRQRLASVQKESNDVSKFNVEERINELFNDKKLSAL 949
              +  K  +Q   DQ   + KL +LR+ LA +Q ESN++SKFN+EER+NELFN+KKL AL
Sbjct: 895  --KIEKINQQESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKAL 952

Query: 950  DRLKELETKYKGFGIDFQADPELSAMLSDAPPENHHAKDG---QAHPSLDPKHLSRKIEE 1006
             RLKELETKYK FGI+F    E+   L + P  N   K+G   + + SLDPK   +K+++
Sbjct: 953  QRLKELETKYKDFGINF----EMKDFLENKP--NDGTKEGSTEEEYESLDPKIYEKKLDD 1006

Query: 1007 MSKIVDELTAFKKEIENGPPXXXXXXXDEELEQDDRASIHSGNAS-------TGSFLETL 1059
            + ++ ++L   +K  E            E  E++D   I   ++S       T SFLETL
Sbjct: 1007 IDRLTEQLLNLQKTQELREESSSSYSSSESDEENDDDEIFVASSSSKPAGSGTRSFLETL 1066

Query: 1060 SQKYGTGQ-NAGPTASSRAMVGRESNYPGRGYHRRSFMERVKKSD-AAPFLSELTQKVAP 1117
            S+KYGTGQ N   TA+  + +  +S         + F++R+++S  AAPFL ELT+KVAP
Sbjct: 1067 SEKYGTGQKNVAMTATPNSRIVTQS--------EKQFLDRMRRSSTAAPFLQELTEKVAP 1118

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/617 (58%), Positives = 447/617 (72%), Gaps = 24/617 (3%)

Query: 1307 FERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEKAFAAREIKLL 1366
            FERYPR +KK+KQLHWEKIE T NSIW   KAE++ADDL+E+GV + LEKAFAARE+K L
Sbjct: 1300 FERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVFSNLEKAFAAREVKSL 1359

Query: 1367 ANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLK 1426
            A++RK+DL+K+TFLSRD+SQQFGINLHMY++LSV+++V KIL+CD+DFL + SVI+FL K
Sbjct: 1360 ASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCDRDFLHTPSVIEFLSK 1419

Query: 1427 PEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWAS 1486
            PEI EVS NLARN++PY+T+WEG+ S+++AK PEKDP +LQRADQ+YL++MVNLQ YWAS
Sbjct: 1420 PEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQIYLQLMVNLQPYWAS 1479

Query: 1487 RMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAH 1546
            RMRALK+ITTYEKEY++LL KLR +DKAV S+Q S+NLR+VF VILAVGNYMND+SKQA 
Sbjct: 1480 RMRALKIITTYEKEYNELLLKLRKVDKAVGSLQESENLRNVFNVILAVGNYMNDTSKQAQ 1539

Query: 1547 GFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAA 1606
            GFKL+TLQRLTFIKD  NSMTFLNYVEKIIR NY  FNSFLQELEPVL+VVKIS+EQLA 
Sbjct: 1540 GFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELEPVLEVVKISIEQLAN 1599

Query: 1607 DCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLM 1666
            DC+EF Q++ NVERSIE+GNLSDSSKFHP DRVL KVLP LP+ RK+ DLL+DEV LTLM
Sbjct: 1600 DCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVRKKGDLLNDEVNLTLM 1659

Query: 1667 EFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKKMVEEQ 1726
            EFDGLMQ++GED                 I EY+KAQ  NIK+          K+MVEEQ
Sbjct: 1660 EFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVEEEEEAYERHKRMVEEQ 1719

Query: 1727 HKRA-RLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLKNAGPGKSDPSSXXXXXXX 1785
             ++A R EA+     D +E +      R  R  MDKLLE+LKN GP ++DPSS       
Sbjct: 1720 QRKAERKEAKNQNNIDENEDDDQERTDR--RGTMDKLLEQLKNVGPSRADPSSARKRALA 1777

Query: 1786 XXXXXDGKRSSANILDNFEVDEAAPVNQSLVYSPETTLKAANAAHAESPTPKASRQGSVA 1845
                   K  + N++ + E +     + S++YSP+      N A   +P       G+  
Sbjct: 1778 RKKMLTDKEGTVNMMHDLETE-----SDSIIYSPD------NKAIGSTPF------GANG 1820

Query: 1846 GSGATATPLLESPSK--QASAGPEDVADRARNLLKELRGPES-EKRKPLLEDHREKMRAR 1902
             S         SPSK  +     E++++RA+ LL  LRG  S  KR  +L++H+EK+RAR
Sbjct: 1821 ASSHKQNSNELSPSKGFRDDLSEEEISERAKTLLMGLRGTASPSKRNSMLDEHKEKLRAR 1880

Query: 1903 RRRVNEG-ASSENKLVF 1918
            RRR N    S  NKL F
Sbjct: 1881 RRRTNNDLPSGSNKLKF 1897

>Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847 bp,
            1948 aa] {ON} YNL271C (REAL)
          Length = 1948

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/1113 (42%), Positives = 653/1113 (58%), Gaps = 97/1113 (8%)

Query: 68   GKPLSKQTTLNTQNLSSY----VDMNTP---HHNRSPSGMSGSPTKYSYSRR-SSQWSNG 119
             +PL+K+ TLNTQNLS Y    +  + P    H RS S  S    KYSYS+R SSQ SN 
Sbjct: 82   ARPLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQS----KYSYSKRTSSQASN- 136

Query: 120  NNIGNGGRLSRQQTNQSLSSASIFSQGSMTNLTKFMGADGKVKLDRPSNPQEIEDLFAEL 179
                   +L+RQ T QS S+ S+ S GS+TNL+KF   DGK+ L+ PS+P E+E LF ++
Sbjct: 137  -------KLTRQHTGQSHSATSLLSLGSLTNLSKFTTPDGKIHLEMPSDPYEVEVLFEDI 189

Query: 180  MHKRNFFQSLPAAGQKELMNYDLDKKWLLVKQDLQSELKKL-AN------------KKNT 226
            M+KRN FQSL    Q+ELM+Y  +KKWL+VKQDLQ+ELKK+ AN              + 
Sbjct: 190  MYKRNIFQSLSGDKQEELMSYSTEKKWLIVKQDLQNELKKIRANTTSSSAASRTSIASDQ 249

Query: 227  H-VXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKGHNSTSSP--------ILGG- 276
            H +                                  +     TS+P        I GG 
Sbjct: 250  HPILTANSTLSSPKSALMTSASSPTSTVYSNTLNHSTTLSSVGTSTPKGHNNKKTIAGGL 309

Query: 277  ------GGFYESGNQ-NSSTATLSQDPLHLSPDYYVRKIISDKISTKQLKDLWVSLRTEQ 329
                     Y  G + N+S +TL  D  +  P +YV++I++DK++T ++KDLWV+LRTEQ
Sbjct: 310  KKQPSLNSIYRGGPEINTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQ 369

Query: 330  LDWVVGFLDAQGQVAIANVLLRFFHKESPDALLNDEALDKEFAFFKCLKTLLNLKEGANE 389
            LDWV  F+D QG +A+ANVL+   +K +P   L  E L+KE +FFKC + L  L +G  E
Sbjct: 370  LDWVDAFIDHQGHIAMANVLMNSIYKTAPREHLTKELLEKENSFFKCFRVLSMLSQGLYE 429

Query: 390  AVRTKLVVSAITDGLLSLRISTRRIASEMLVFITQWDIPYGLNQVIGELDQESHVSSNVH 449
                +L+   + +GL S ++ TR++A+E+ V + +         V+  LD++  +  N+H
Sbjct: 430  FSTHRLMTDTVAEGLFSTKLVTRKMATEIFVCMLEKKNKNRFEAVLTALDKKFRIGQNLH 489

Query: 450  LQARLLSANKRDSLLAQDHELDLTRDHASKKFEQWLFVVEYTLDGRGKMGSLVGASEDFK 509
            +        +  S L  +  L        K  + WLF VE TLDGRGKMGSLVGAS++FK
Sbjct: 490  MIQNFKKMPQYFSHLTLESHL--------KIIQAWLFAVEQTLDGRGKMGSLVGASDEFK 541

Query: 510  SAGGENAILEYGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLELLNYDKID 569
            + GGENAILEY   T++ +N LC+   +VNQR LLR++ ++CG+ RIM K++LL+YDK+ 
Sbjct: 542  NGGGENAILEYCQWTMVFINHLCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVI 601

Query: 570  EQLRIFEDRTADDYNTIMASKSINHNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQHLF 629
            +Q+ ++++   DD+N  + + +   NVD+++PLSLL+NLWE  KGT  EK LVSLVQHLF
Sbjct: 602  DQIELYDNNKLDDFNVKLEASNKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLF 661

Query: 630  IASSKVQDEGDDPTEASKQLKLIDSLVSNVTMSSI-DTESSFNGAIQRLYDSMQTDEVAR 688
            ++SSK+ +E  +P++ SKQLKL+DSLV+NV+++S  D ES+ N AIQRLYD+MQTDEVAR
Sbjct: 662  LSSSKLIEENQNPSKLSKQLKLMDSLVTNVSVASTADEESNMNMAIQRLYDAMQTDEVAR 721

Query: 689  RAIMEARELTRKFEEVKAERDYLGEKLSKAEGGLVGQLQNELSQRDRILEKNQRVTEQLQ 748
            RAI+E+R LT+K EE++AERD L EKL KAE GLVGQL+NEL  RDRIL KNQRV +QL+
Sbjct: 722  RAILESRTLTKKLEEIQAERDSLSEKLGKAEHGLVGQLENELHGRDRILAKNQRVMQQLE 781

Query: 749  ADXXXXXXXXXXXXXXXXXXXXXXXTILNSRPQGSSAVQEEEAGTASSSAPGVLHADRKL 808
            ++                       TILNSRP+ SS + +   GT   +    L++  K 
Sbjct: 782  SELEELKKKHLLEKHQQEVELRKMLTILNSRPEESSDLSK---GTKDINPS--LNSSEKA 836

Query: 809  AIQKALQDRLQQTKKDLTKESKRLGTTLGTTLEPNRRLKLLRSRMEDIENEARELEMTNF 868
             IQK LQD L +      K+ K      G TL+PN+RLK+LR +ME+IENEAR+LEMTNF
Sbjct: 837  NIQKVLQDGLSRA----KKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNF 892

Query: 869  ADIQRQTVEEQTXXXXXXXXXXXXXDRAPKAKKQVKEDQVRKLRELRQRLASVQKESNDV 928
            A+ +++ +E                 +    K Q  +  + KL +LR+ LA +Q ESND+
Sbjct: 893  AEFEKERLEPPIEIKKPKIKHKKHKIKKSSVKTQGAD--MNKLNDLRRALAEIQMESNDI 950

Query: 929  SKFNVEERINELFNDKKLSALDRLKELETKYKGFGIDFQADPELSAMLSDAPPENHHAKD 988
            SKFNVEER+NELFN+KK  AL RLKELETKYKGFGIDF  +  +      +  E + A  
Sbjct: 951  SKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEEFIETPKKFSVDEENDA-- 1008

Query: 989  GQAHPSLDPKHLSRKIEEMSKIVDELTAFKKEIENGPPXXXXXX---------------- 1032
              A+PSLDPK    K++E+++I DEL   + +++                          
Sbjct: 1009 --AYPSLDPKAYQSKLDEINRITDELLDLQTQVKQETEEDEDEETKSSSSSSDADDDEIY 1066

Query: 1033 XDEELEQDDRA--SIHSGNASTGSFLETLSQKYGTGQNAGPTASSRAMVGRESNYPGRGY 1090
             D    Q+ R   S  S  +  GSFL+ LSQKYGTGQN   +A  R   G   + P    
Sbjct: 1067 QDASPSQERRGEYSELSAGSGPGSFLDALSQKYGTGQNVTASAGLRDNRG-SGHMPSNV- 1124

Query: 1091 HRRSFMERVKKSDA--APFLSELTQKVAPKTPI 1121
              +SF+ R++KS A  AP+L ELTQKV    P 
Sbjct: 1125 -EKSFINRLRKSTASSAPYLEELTQKVNKVEPF 1156

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/616 (59%), Positives = 450/616 (73%), Gaps = 17/616 (2%)

Query: 1307 FERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEKAFAAREIKLL 1366
            FE+YPRP KKLKQLHWEKI+ T NSIW   KAEK+ADDLYE+GVLA LEKAFAAREIK L
Sbjct: 1345 FEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1404

Query: 1367 ANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLK 1426
            A +RKEDL KVTFLSRD+SQQFGINLHMY++LSV ++V KIL+CD+DFL + SV++FL K
Sbjct: 1405 ATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFLSK 1464

Query: 1427 PEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWAS 1486
            PEI EVS NLARN+APYST+WEG+  +++AK PEKDP +LQRADQ+YL++MVNL+ YW S
Sbjct: 1465 PEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQYWGS 1524

Query: 1487 RMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAH 1546
            RMRAL V+T+YEKEY++LL KLR +D+AV ++Q SDNLR+VF VILAVGN+MND+SKQA 
Sbjct: 1525 RMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQ 1584

Query: 1547 GFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAA 1606
            GFKL+TLQRLTFIKD  NSMTFLNYVEKIIR NY  FN FL+ELEPVLDVVK+S+EQL  
Sbjct: 1585 GFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVN 1644

Query: 1607 DCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLM 1666
            DC++FSQ+IVNVERS+E+GNLSDSSKFHP D+VL+K LPVLPEAR++ DLL DEVKLT+M
Sbjct: 1645 DCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLTIM 1704

Query: 1667 EFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKKMVEEQ 1726
            EF+ LMQ +GED                 + EYK+AQ+ N+            KKMVEEQ
Sbjct: 1705 EFESLMQTYGEDSGDKFAKISFFKKFADFVNEYKRAQSQNLAAEEEERLYEKHKKMVEEQ 1764

Query: 1727 HKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLKNAGPGKSDPSSXXXXXXXX 1786
             KRA+ + EK               +   R VMDKLLE+LKNAGP KSDPSS        
Sbjct: 1765 QKRAQ-DKEKHREHSALPEGNEEEETEDRRAVMDKLLEQLKNAGPAKSDPSSARKRALVR 1823

Query: 1787 XXXXDGKRSSANILDNFEVDEAAPVNQSLVYSPE-TTLKAANAAHAESPTPKASRQGSVA 1845
                  K +SA +L++   +E      S++YSPE TT       HAESPTP A+R     
Sbjct: 1824 KKYISDKDNSAQVLNDLNDEEG-----SILYSPEATTPDTDTVIHAESPTPLATR----- 1873

Query: 1846 GSGATATPL-LESPSK-QASAGPEDVADRARNLLKELRGPESE-KRKPLLEDHREKMRAR 1902
              G   TP  L SPSK  A    E++ DRAR LLKELRG ++  K+  +L++H EK+RAR
Sbjct: 1874 --GFMNTPEDLPSPSKASALEDQEEITDRARMLLKELRGSDAPVKQNSILDEHLEKLRAR 1931

Query: 1903 RRRVNEGASSENKLVF 1918
            + R N   ++ NKL F
Sbjct: 1932 KERANGETNTGNKLSF 1947

>ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} some
            similarities with uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1994

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/1109 (41%), Positives = 650/1109 (58%), Gaps = 100/1109 (9%)

Query: 46   KIEPSDISSPKIVSTPAVPEFSG--KPLSKQTTLNTQNLSSYVDMNTPHHNRSPSGMSGS 103
            +IE  DISSPK VS P+    +   +PL+     +  +  S          R+PS  S +
Sbjct: 55   RIETGDISSPKKVSVPSRVTNANDLRPLNHHYNHHHNHHHS----------RTPSQQS-T 103

Query: 104  PTKYSYSRRSSQWSNGNNIG-------------NGGRLSRQQTNQSL-----SSASIFSQ 145
             +KY+Y +R+S    G N                 G+LSRQQTN S      S+AS+ SQ
Sbjct: 104  GSKYTYPKRTSSSITGGNPSLPSSSATPIPAPVTPGQLSRQQTNHSHANSQSSAASVLSQ 163

Query: 146  GSMTNLTKFMGADGKVKLDRPSNPQEIEDLFAELMHKRNFFQSLPAAGQKELMNYDLDKK 205
            GS+TNL +FM  DGKV+LD P +  E+E LF ++M+KRN  Q+LP   Q+EL NYD+DKK
Sbjct: 164  GSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNYDIDKK 223

Query: 206  WLLVKQDLQSELKKLANKKNTHVXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXSK 264
            WL+V+QDL S+LKK+  K ++                                     SK
Sbjct: 224  WLIVRQDLSSDLKKMMAKSSSSATQASANTTDLSLTNTISSHDYSDATSIRHMKTNASSK 283

Query: 265  GHNSTSSPILGGGGFYESGNQNSSTATLSQDPLHLSPDYYVRKIISDKISTKQLKDLWVS 324
              NS           Y + N NSS  T++ + ++  P YYV+KII+D ++  +L DLWV+
Sbjct: 284  SLNS---------NLYSNANANSSNTTVNTEKINRPPTYYVKKIIADDLTIDELNDLWVT 334

Query: 325  LRTEQLDWVVGFLDAQGQVAIANVLLRFFHKESPDALLNDEALDKEFAFFKCLKTLLNLK 384
            LRTEQLDWV  FL+ QG +A+ANVL++  +K + +  L +++L++E ++FKC + L+ L 
Sbjct: 335  LRTEQLDWVDAFLEHQGHIAMANVLMKSLYKTTQEVKLTEKSLEREASYFKCFRVLVMLA 394

Query: 385  EGANEAVRTKLVVSAITDGLLSLRISTRRIASEMLVFITQWDIPYGLNQVIGELDQESHV 444
            +G  E  +  ++   +   L S+R+ TR++A+E+ V + +       + ++  LD++  +
Sbjct: 395  QGLYEFTKHAIMAETVAYALFSIRLPTRKMATEIFVCMLEKKNKSRFDVILTALDKKFMI 454

Query: 445  SSNVHLQARLLSANKRDSLLAQDHELDLTRDHASKKFEQWLFVVEYTLDGRGKMGSLVGA 504
              N+H+   + ++ ++         + L RD   K  + WL  +E  L GRGKMGSLVGA
Sbjct: 455  GENLHMMQFVKNSPQQ--------FIHLKRDSQFKIVQAWLTGLETALQGRGKMGSLVGA 506

Query: 505  SEDFKSAGGENAILEYGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLELLN 564
            SE+ ++AGGEN+ILEY   T++ +N LC     VNQR LLR+R ++ G  RIM + +LL+
Sbjct: 507  SEEVRAAGGENSILEYSQWTMVFINHLCMGTDVVNQRVLLRTRLENAGALRIMNRFKLLD 566

Query: 565  YDKIDEQLRIFEDRTADDYNTIMASKSINHNVDMENPLSLLQNLWESYKGTGAEKYLVSL 624
            YDKI  Q+  +E+   DD N ++ S+  N  V+M++P+ +LQ +W+  KGT  EK  +SL
Sbjct: 567  YDKITAQIEYYENGKLDDINNLLESEGRNTQVNMQDPMMMLQTMWDYCKGTENEKTFISL 626

Query: 625  VQHLFIASSKVQDEGDDPTEASKQLKLIDSLVSNVTMSSIDTESSFNGAIQRLYDSMQTD 684
            ++HLF++SSKV D+  DP++ +KQLKL+DSLV+NV++S++D ESS N AIQRLYD+MQTD
Sbjct: 627  IKHLFLSSSKVADDRGDPSKLAKQLKLMDSLVANVSVSAVDEESSVNVAIQRLYDAMQTD 686

Query: 685  EVARRAIMEARELTRKFEEVKAERDYLGEKLSKAEGGLVGQLQNELSQRDRILEKNQRVT 744
            EVARRAI+E+R+LT++ EE++AERD+L +KL+    G+VG+L+ EL QRD IL KNQRV 
Sbjct: 687  EVARRAILESRQLTKELEEIQAERDFLRQKLNSTGDGIVGRLEEELKQRDDILAKNQRVN 746

Query: 745  EQLQADXXXXXXXXXXXXXXXXXXXXXXXTILNSRPQGSSAVQEEEAGTASSSAPGVLHA 804
              LQA+                       TILN+RP   +  +     T  + +   L  
Sbjct: 747  RHLQAELEELKKKHLLEKHEHEVELRKMLTILNARPDDENLAK----STKVTKSVNGLDP 802

Query: 805  DRKLAIQKALQDRLQQTKKDLTKESKRLGTTLGTTLEPNRRLKLLRSRMEDIENEARELE 864
            DR+ +IQKALQD LQ+T+KDL+ +SKR     G T++PN+RL++LR +ME IE EARELE
Sbjct: 803  DRQTSIQKALQDGLQRTRKDLSVDSKR----FGITVQPNKRLRMLRMKMEGIEQEARELE 858

Query: 865  MTNFADIQRQTVEEQTXXXXXXXXXXXXXDRAPKAKKQVKEDQVRKLRELRQRLASVQKE 924
            MTNFA+ + + +EE                  P      K+  VRKL ELR++L+ +QKE
Sbjct: 859  MTNFAEHEEKQLEE------------------PVGTGTKKKAGVRKLSELRKQLSDIQKE 900

Query: 925  SNDVSKFNVEERINELFNDKKLSALDRLKELETKYKGFGIDFQADPELSAMLSDAPPENH 984
            +N+V+KFNVEER+ ELFN K+L AL RLKELET YKGFGIDF A+  L +   D    N 
Sbjct: 901  TNEVTKFNVEERVKELFNQKRLKALKRLKELETTYKGFGIDFNANALLESKGGDI-HWND 959

Query: 985  HAKDGQAHPSLDPKHLSRKIEEMSKIVDELTAFKK--EIENGPPXXXXXXXDEELEQDDR 1042
               DGQ     D +    K++EM +I +ELTA K   EI+N          +   E DD 
Sbjct: 960  DEIDGQ-----DLQGAQEKMDEMDRIANELTAMKMKVEIQNQQQHTDSSSTESSSEDDDG 1014

Query: 1043 A-----------SIHSGNASTGSFLETLSQKYGTGQNAGPTASSRAMVGRESNYPGRGYH 1091
            A           S  S  +  GSFLE LSQKYG GQN   + S    V R+S+      H
Sbjct: 1015 ATGSRTDTASEFSQKSFGSGAGSFLEALSQKYGAGQNTTISNSPFPGVDRKSS-----NH 1069

Query: 1092 RRSFMERVKKSDAAPFLSELTQKVAPKTP 1120
            R SF  R+KKS+A P+  ELT+KVA K P
Sbjct: 1070 RTSFANRMKKSNATPYFDELTRKVA-KAP 1097

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/637 (53%), Positives = 440/637 (69%), Gaps = 27/637 (4%)

Query: 1308 ERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEKAFAAREIKLLA 1367
            + YP+P KKLKQLHWEK++ T +SIW    AEK+A DLYE+GVLA LEKAFAAREIK LA
Sbjct: 1257 DNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLYEKGVLAGLEKAFAAREIKNLA 1316

Query: 1368 NRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLKP 1427
             ++KEDL K+TFLS D SQQFGINLHMY+ +SV ++V KIL+CD+DF+ + SVI+FL K 
Sbjct: 1317 TKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEFLSKS 1376

Query: 1428 EIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWASR 1487
            EI EVS NLARNF+PYST+W+G+ S+++AK PEKDP +LQRADQ+YL+++ NLQ YW SR
Sbjct: 1377 EITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQLIFNLQAYWGSR 1436

Query: 1488 MRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAHG 1547
            MRA+KVIT+Y+KEY +L+TKLR +DKAV +I  S+NL ++F VILAVGN+MND++K+A G
Sbjct: 1437 MRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDTAKRAQG 1496

Query: 1548 FKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAAD 1607
            FKL+TLQRLTFIKD  NSMTFLNYVEKIIR NY  FN FL+ELEPVL+V KIS++QL  D
Sbjct: 1497 FKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKISIDQLVND 1556

Query: 1608 CREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLME 1667
            C E+ Q + NVERSIE+GNLSDSSKFHP DRVL+KVLPVLPEARK+ DLL DEV+L++ME
Sbjct: 1557 CNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDEVRLSIME 1616

Query: 1668 FDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKKMVEEQH 1727
            F+ LMQ +GED                 +QEYKKAQ  N+K+          KKMVEEQ 
Sbjct: 1617 FENLMQKYGEDTGDKFAKNSFFKKFADFVQEYKKAQNQNLKVEEEERVYERHKKMVEEQQ 1676

Query: 1728 KRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLKNAGPGKSDPSSXXXXXXXXX 1787
            +R +  ++        + +      +  R +MDKLL++LKNAGP  SDPSS         
Sbjct: 1677 RREQTPSKNRDYVVNEDEDIADDDDQDRRAMMDKLLDQLKNAGPTTSDPSSARKRALMRR 1736

Query: 1788 XXXDGKRSSANILDNFEVDEAAPVNQSLVYSPETTLKAANAAHAESPTPKASRQGSVAGS 1847
                 K ++A+++ + + +E      S+VYSP  +     +A+AE  +P   +     GS
Sbjct: 1737 KLQADKDAAAHLISDLDSNE-----DSIVYSPNAS--QDQSANAEEASPTVHK-----GS 1784

Query: 1848 GATATPL---LESPSKQA-------SAGPEDVADRARNLLKELRGPES-EKRKPLLEDHR 1896
                 P+   LESP K +           E+++D+A+NLL EL G  +  +R+ LL  H+
Sbjct: 1785 NKNNKPVLSDLESPIKASRNADRNNENEEEEISDKAKNLLMELSGNGAPTRREELLNGHK 1844

Query: 1897 EKMRARRRRVNEGAS--SENKLVFVGGASE--APTDS 1929
            E++RARRRR        S NKL F+   +    PTDS
Sbjct: 1845 ERLRARRRRTQGHGELISSNKLAFLDDETPPVTPTDS 1881

>YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}
            BNI1Formin, nucleates the formation of linear actin
            filaments, involved in cell processes such as budding and
            mitotic spindle orientation which require the formation
            of polarized actin cables, functionally redundant with
            BNR1
          Length = 1953

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/617 (59%), Positives = 455/617 (73%), Gaps = 17/617 (2%)

Query: 1307 FERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEKAFAAREIKLL 1366
            FE+YPRP KKLKQLHWEK++ T NSIW   KAEK+ADDLYE+GVLA LEKAFAAREIK L
Sbjct: 1348 FEKYPRPHKKLKQLHWEKLDCTDNSIWGTGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1407

Query: 1367 ANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLK 1426
            A++RKEDL K+TFLSRD+SQQFGINLHMY++LSV ++V KIL CD+DFL + SV++FL K
Sbjct: 1408 ASKRKEDLQKITFLSRDISQQFGINLHMYSSLSVADLVKKILNCDRDFLQTPSVVEFLSK 1467

Query: 1427 PEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWAS 1486
             EI+EVS NLARN+APYST+WEGV ++++AK PEKDP +LQRADQ+YL++MVNL+ YW S
Sbjct: 1468 SEIIEVSVNLARNYAPYSTDWEGVRNLEDAKPPEKDPNDLQRADQIYLQLMVNLESYWGS 1527

Query: 1487 RMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAH 1546
            RMRAL V+T+YE+EY++LL KLR +DKAVS++Q SDNLR+VF VILAVGN+MND+SKQA 
Sbjct: 1528 RMRALTVVTSYEREYNELLAKLRKVDKAVSALQESDNLRNVFNVILAVGNFMNDTSKQAQ 1587

Query: 1547 GFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAA 1606
            GFKL+TLQRLTFIKD  NSMTFLNYVEKI+R NY  FN FL ELEPVLDVVK+S+EQL  
Sbjct: 1588 GFKLSTLQRLTFIKDTTNSMTFLNYVEKIVRLNYPSFNDFLSELEPVLDVVKVSIEQLVN 1647

Query: 1607 DCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLM 1666
            DC++FSQ+IVNVERS+E+GNLSDSSKFHP D+VL+K LPVLPEARK+ DLL DEVKLT+M
Sbjct: 1648 DCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARKKGDLLEDEVKLTIM 1707

Query: 1667 EFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKKMVEEQ 1726
            EF+ LM  +GED                 I EYKKAQA N+            KK+VEEQ
Sbjct: 1708 EFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAAEEEERLYIKHKKIVEEQ 1767

Query: 1727 HKRARLEAEKGGVDDGSEAEGVTAVSRGE--RDVMDKLLEKLKNAGPGKSDPSSXXXXXX 1784
             KRA+ E EK   +  S +         E  R VMDKLLE+LKNAGP KSDPSS      
Sbjct: 1768 QKRAQ-EKEKQKENSNSPSSEGNEEDEAEDRRAVMDKLLEQLKNAGPAKSDPSSARKRAL 1826

Query: 1785 XXXXXXDGKRSSANILDNFEVDEAAPVNQSLVYSPETTLKAANAA-HAESPTPKASRQGS 1843
                    K ++  +L++ + +E      S++YSPE     A+   HAESPTP A+R   
Sbjct: 1827 VRKKYLSEKDNAPQLLNDLDTEEG-----SILYSPEAMDPTADTVIHAESPTPLATR--- 1878

Query: 1844 VAGSGATATPLLESPSKQAS-AGPEDVADRARNLLKELRGPESE-KRKPLLEDHREKMRA 1901
              G   T+   L SPSK ++    E+++DRAR LLKELRG ++  K+  +L++H EK+RA
Sbjct: 1879 --GVMNTSED-LPSPSKTSALEDQEEISDRARMLLKELRGSDTPVKQNSILDEHLEKLRA 1935

Query: 1902 RRRRVNEGASSENKLVF 1918
            R+ R    AS+ N+L F
Sbjct: 1936 RKERSIGEASTGNRLSF 1952

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/875 (44%), Positives = 541/875 (61%), Gaps = 57/875 (6%)

Query: 277  GGFYESGNQNSSTA-TLSQDPLHLSPDYYVRKIISDKISTKQLKDLWVSLRTEQLDWVVG 335
               Y  G +N+++A TL  D  +  P +YV++I++DK+++ ++KDLWV+LRTEQLDWV  
Sbjct: 313  NNIYRGGAENNTSASTLPGDRTNRPPIHYVQRILADKLTSDEMKDLWVTLRTEQLDWVDA 372

Query: 336  FLDAQGQVAIANVLLRFFHKESPDALLNDEALDKEFAFFKCLKTLLNLKEGANEAVRTKL 395
            F+D QG +A+ANVL+   +K +P   L  E L+KE +FFKC + L  L +G  E    +L
Sbjct: 373  FIDHQGHIAMANVLMNSIYKTAPRENLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRL 432

Query: 396  VVSAITDGLLSLRISTRRIASEMLVFITQWDIPYGLNQVIGELDQESHVSSNVHLQARLL 455
            +   + +GL S +++TR++A+E+ V + +         V+  LD++  +  N+H+     
Sbjct: 433  MTDTVAEGLFSTKLATRKMATEIFVCMLEKKNKSRFEAVLTSLDKKFRIGQNLHMIQNFK 492

Query: 456  SANKRDSLLAQDHELDLTRDHASKKFEQWLFVVEYTLDGRGKMGSLVGASEDFKSAGGEN 515
               +  S L  +  L        K  + WLF VE TLDGRGKMGSLVGAS++FK+ GGEN
Sbjct: 493  KMPQYFSHLTLESHL--------KIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGEN 544

Query: 516  AILEYGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIF 575
            AILEY   T++ +N LC+   ++NQR LLR++ ++CG+ RIM K++LL+YDK+ +Q+ ++
Sbjct: 545  AILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELY 604

Query: 576  EDRTADDYNTIMASKSINHNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQHLFIASSKV 635
            ++   DD+N  + + +   NVD+ +PLSLL+NLW+  KGT  EK LVSLVQHLF++SSK+
Sbjct: 605  DNNKLDDFNVKLEANNKAFNVDLHDPLSLLKNLWDICKGTENEKLLVSLVQHLFLSSSKL 664

Query: 636  QDEGDDPTEASKQLKLIDSLVSNVTMSSI-DTESSFNGAIQRLYDSMQTDEVARRAIMEA 694
             +E  + ++ +KQLKL+DSLV+NV+++S  D E++ N AIQRLYD+MQTDEVARRAI+E+
Sbjct: 665  IEENQNSSKLTKQLKLMDSLVTNVSVASTSDEETNMNMAIQRLYDAMQTDEVARRAILES 724

Query: 695  RELTRKFEEVKAERDYLGEKLSKAEGGLVGQLQNELSQRDRILEKNQRVTEQLQADXXXX 754
            R LT+K EE++AERD L EKLSKAE GLVGQL++EL +RDRIL KNQRV +QL+A+    
Sbjct: 725  RALTKKLEEIQAERDSLSEKLSKAEHGLVGQLEDELHERDRILAKNQRVMQQLEAELEEL 784

Query: 755  XXXXXXXXXXXXXXXXXXXTILNSRPQGSSAVQEEEAGTASSSAPGVLHADRKLAIQKAL 814
                               TILNSRP+ S    E   G  SS     L++  K  IQK L
Sbjct: 785  KKKHLLEKHQQEVELRKMLTILNSRPEESFNKNEGTRGMNSS-----LNSSEKANIQKVL 839

Query: 815  QDRLQQTKKDLTKESKRLGTTLGTTLEPNRRLKLLRSRMEDIENEARELEMTNFADIQRQ 874
            QD L +      K+ K      G TL+PN+RLK+LR +ME+IENEAR+LEMTNFA+ ++ 
Sbjct: 840  QDGLSRA----KKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKD 895

Query: 875  TVEEQTXXXXXXXXXXXXXDRAPKAKKQVKEDQVRKLRELRQRLASVQKESNDVSKFNVE 934
             +E                DR P  K Q  E  V KL +LR+ LA +Q ESND+SKFNVE
Sbjct: 896  RLEPPIHIKKPKVKKMKNKDRKPLVKPQ--EADVNKLNDLRRALAEIQMESNDISKFNVE 953

Query: 935  ERINELFNDKKLSALDRLKELETKYKGFGIDFQADPELSAMLSDAPPENH---HAKDGQA 991
            ER+NELFN+KK  AL RLKELETKYKGFGIDF  D      + D+P +N      ++   
Sbjct: 954  ERVNELFNEKKSLALKRLKELETKYKGFGIDFNVDE-----IMDSPKKNTGDVETEEDAN 1008

Query: 992  HPSLDPKHLSRKIEEMSKIVDELTAFKKEIEN----------------GPPXXXXXXXDE 1035
            + SLDPK   +K++E+++I D+L   + + E+                          D 
Sbjct: 1009 YASLDPKTYQKKLDEINRITDQLLDIQTQTEHEIQVEEDGESDLSSSSSDDESEEIYQDA 1068

Query: 1036 ELEQDDRA--SIHSGNASTGSFLETLSQKYGTGQNAGPTASSRAMVGRESNYPGRG-YH- 1091
               Q+ R+  S  S  +  GSFL+ LSQKYGTGQN   TAS  A  G  +N  G G  H 
Sbjct: 1069 SPTQELRSEHSELSSGSGPGSFLDALSQKYGTGQNV--TAS--AAFGENNNGSGIGPLHS 1124

Query: 1092 --RRSFMERVKKS--DAAPFLSELTQKVAPKTPID 1122
               ++FM R++KS   +AP+L ELTQKV    P +
Sbjct: 1125 KVEKTFMNRLRKSTVSSAPYLEELTQKVNKVEPYE 1159

 Score =  149 bits (376), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 97/222 (43%), Positives = 130/222 (58%), Gaps = 42/222 (18%)

Query: 27  LFSNLKKLTGSGNNANTSNKIEPSDIS----SP----------------KIVSTPAVPEF 66
           +F NLK+L  S  NA  SN   P+  S    SP                K+ +       
Sbjct: 23  IFQNLKRLANS--NATNSNTGSPTYASQQQHSPVGNEVSTSPASSSSFRKLNAPSRSTST 80

Query: 67  SGKPLSKQTTLNTQNLSSYVDMN-------TPHHNRSPSGMSGSPTKYSYSRR-SSQWSN 118
             +PL+K++TLNTQNLS Y++         +  H RS S  S    KYSYS+R SSQ SN
Sbjct: 81  EARPLNKKSTLNTQNLSQYMNGKLSGDVPVSSQHARSHSMQS----KYSYSKRNSSQASN 136

Query: 119 GNNIGNGGRLSRQQTNQSLSSASIFSQGSMTNLTKFMGADGKVKLDRPSNPQEIEDLFAE 178
                   +L+RQ T QS S++S+ SQGS+TNL+KF   DGK+ L+ PS+P E+E LF +
Sbjct: 137 --------KLTRQHTGQSHSASSLLSQGSLTNLSKFTTPDGKIYLEMPSDPYEVEVLFED 188

Query: 179 LMHKRNFFQSLPAAGQKELMNYDLDKKWLLVKQDLQSELKKL 220
           +M+KRN FQSL    Q+ LM Y ++KKWL+VKQDLQ+ELKK+
Sbjct: 189 IMYKRNIFQSLSEDKQEALMGYSIEKKWLIVKQDLQNELKKM 230

>NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {ON}
            Anc_1.82
          Length = 1946

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/647 (57%), Positives = 462/647 (71%), Gaps = 27/647 (4%)

Query: 1307 FERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEKAFAAREIKLL 1366
            FE YPRP+KKLKQLHWEK++ T NSIWK  KAEK+ADDLYE+GVL  LEKAFAAREIK L
Sbjct: 1288 FENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVLTDLEKAFAAREIKSL 1347

Query: 1367 ANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLK 1426
            A+++KEDL+K++FLSRD+SQQFGINLHMYA L V +VV KIL+CD+DFL + SVI+FL K
Sbjct: 1348 ASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFLHTPSVIEFLSK 1407

Query: 1427 PEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWAS 1486
            PEIVEVS NLARN+APYST+WEGV SV++AK PEKDP ELQRADQLYL++++NLQ YW S
Sbjct: 1408 PEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQLIINLQSYWGS 1467

Query: 1487 RMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAH 1546
            RMRAL VITT++KEY++LLTKLR +DKAVSS+Q S+NL++VF VILAVGNYMND+SKQA 
Sbjct: 1468 RMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVGNYMNDTSKQAQ 1527

Query: 1547 GFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAA 1606
            GFKLATLQRLTFIKD  NSMTFLNYVEKI+R NY  FN FL ELEPVLDVVKIS+EQL +
Sbjct: 1528 GFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELEPVLDVVKISIEQLVS 1587

Query: 1607 DCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLM 1666
            DC+EFSQ+IVNVERS+E GNLSDSSKFHP DRVL KVLP+LP+ARK+ +LL DEVKLT+M
Sbjct: 1588 DCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGELLGDEVKLTIM 1647

Query: 1667 EFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKKMVEEQ 1726
            EF  LMQ++GED                 I EYKKAQ  NIK           KKMVE+Q
Sbjct: 1648 EFLRLMQIYGEDSEDKFAKNSFFKKFADFITEYKKAQNQNIKAEEEEQVYERHKKMVEDQ 1707

Query: 1727 HKRARLEAEKG--GVDDGSEAEGVTAVSRGERDVMDKLLEKLKNAGPGKSDPSSXXXXXX 1784
             K+ + E E G  G ++G E  G  +  R  R +MDKLL++LKNAGP K+DPSS      
Sbjct: 1708 QKKLQ-EQENGSNGSENGEEGSGDDSGDR--RAMMDKLLDQLKNAGPSKTDPSSARKRAL 1764

Query: 1785 XXXXXXDGKRSSANILDNFEVDEAAPVNQSLVYSPETTLKAANAAHAESPTPKASRQGSV 1844
                       S  +L + E ++      S++YSPE      N    ++P  ++      
Sbjct: 1765 VRKKLM---TESTALLKDIETED-----DSIIYSPEGKNPFVNPVDLDTPHDESEM---- 1812

Query: 1845 AGSGATATPLLE--SPSKQASAGPED---VADRARNLLKELRGPES-EKRKPLLEDHREK 1898
                 +++P+    SPS+ ++   +D   V DRA+ LL ELRG  +  KR  LL++H+EK
Sbjct: 1813 ---DVSSSPIQRSLSPSRNSTLLSDDQDEVTDRAKALLMELRGSNTPSKRNSLLDEHKEK 1869

Query: 1899 MRARRRRVNEGASSENKLVFVG-GASEAPTDSHKGLPNDTTADIPAT 1944
            +RARRR+ N    S  +L FVG    E   +   G P+ T+ ++  T
Sbjct: 1870 LRARRRKTNSDLHSGTRLQFVGETVPEKEVEPITGEPDGTSTELEET 1916

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/927 (41%), Positives = 563/927 (60%), Gaps = 76/927 (8%)

Query: 270  SSPILGGGGFYESGNQNSSTATLSQDPLHLSPDYYVRKIISDKISTKQLKDLWVSLRTEQ 329
            S+PI      Y+   +N+S++++S D  +  P +YV++II+D I+++++KDLWV+LRTEQ
Sbjct: 286  SNPI-PNADMYKLSMRNTSSSSMS-DKTNRPPIHYVKRIIADTITSEEMKDLWVTLRTEQ 343

Query: 330  LDWVVGFLDAQGQVAIANVLLRFFHKESPDALLNDEALDKEFAFFKCLKTLLNLKEGANE 389
            +DWV  F++ QG +A+AN+L++  +K S D   N + L+KE AFFKC + L  L +G  E
Sbjct: 344  IDWVDAFIEHQGHIAMANILMKSLYKTSSDGTPNPQLLEKENAFFKCFRVLSMLSQGLRE 403

Query: 390  AVRTKLVVSAITDGLLSLRISTRRIASEMLVFITQWDIPYGLNQVIGELDQESHVSSNVH 449
              R +++   +  GL S+ +STRR+A+E+ V + +   P     ++  LDQ+  +  N H
Sbjct: 404  FTRHEIMSQTVARGLFSITLSTRRMATEIFVCMLEKKNPERFKVILNALDQKFKIGYNAH 463

Query: 450  LQARLLSANKRDSLLAQDHELDLTRDHASKKFEQWLFVVEYTLDGRGKMGSLVGASEDFK 509
            +   +         +  D+   LT D   K  + WLF VE+TLDGRGKMGSLVGAS+DFK
Sbjct: 464  MTQNIK--------MFPDYFTHLTLDSQLKVTQAWLFAVEHTLDGRGKMGSLVGASDDFK 515

Query: 510  SAGGENAILEYGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLELLNYDKID 569
            ++GGENAILEY   +++ +N LC+  +++NQR LLR++ ++CG+ RIM K++ L+YDK+ 
Sbjct: 516  NSGGENAILEYCQWSMIFINHLCSCSSNINQRMLLRTKLENCGILRIMNKVKTLDYDKVI 575

Query: 570  EQLRIFEDRTADDYNTIMASKSINHNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQHLF 629
            EQ+ ++E+   DD NT++ S + N N+++++P S+L+NLW++ KGT  EK L+SL+QHLF
Sbjct: 576  EQIDLYENNKLDDLNTLLESNNKNANINLQDPTSMLRNLWDACKGTENEKLLISLMQHLF 635

Query: 630  IASSKVQDEGDDPTEASKQLKLIDSLVSNVTMSSIDTESSFNGAIQRLYDSMQTDEVARR 689
            ++SS+  +E  DP + S+QLKL+DSLV+NV++SS D E+S N AIQRLYD+MQTDEVARR
Sbjct: 636  LSSSQFIEEKKDPVKLSRQLKLLDSLVTNVSVSSTDQEASMNMAIQRLYDAMQTDEVARR 695

Query: 690  AIMEARELTRKFEEVKAERDYLGEKLSKAEGGLVGQLQNELSQRDRILEKNQRVTEQLQA 749
            +I+E+R LT+K EEV+AERD L +KL  AE GLVGQLQ+EL+QRDRIL KNQRV EQLQ 
Sbjct: 696  SILESRTLTKKLEEVQAERDLLSQKLKNAEHGLVGQLQDELAQRDRILSKNQRVMEQLQG 755

Query: 750  DXXXXXXXXXXXXXXXXXXXXXXXTILNSRPQGSSAVQEEEAGTASSSA--PGVLHADRK 807
            +                       TILN+RP+    + E    +  + A  P  L   +K
Sbjct: 756  ELEELKKKHLLEKHEQEVELRKMLTILNARPE----IVEGNGTSKKTKAKNPSALDPSKK 811

Query: 808  LAIQKALQDRLQQTKKDLTKESKRLGTTLGTTLEPNRRLKLLRSRMEDIENEARELEMTN 867
             +IQ+ALQD L +TKKD + +++      G T++PN+RLKLLR +MEDIENEARELEMTN
Sbjct: 812  QSIQQALQDGLSRTKKDYSVDAR----NFGMTIQPNKRLKLLRMQMEDIENEARELEMTN 867

Query: 868  FADIQRQTVEEQTXXXXXXXXXXXXXDRAPKAKKQVKEDQVRKLRELRQRLASVQKESND 927
            F + +++ +E  +                        +  + KL +LRQ LA +Q ESND
Sbjct: 868  FTEYEKRKLEAPSKIKKPKKVATKKE----------IDPSINKLNDLRQTLAEIQMESND 917

Query: 928  VSKFNVEERINELFNDKKLSALDRLKELETKYKGFGIDFQADPELSAMLSDAPPENHHAK 987
            +SKFNV+ER+NELFN K+++AL RL++LETKYK FGIDF  D  + +   D    N  + 
Sbjct: 918  ISKFNVDERVNELFNQKRITALKRLQDLETKYKDFGIDFNIDELVDSASKDENGNNQQSG 977

Query: 988  DGQAHPSLDPKHLSRKIEEMSKIVDELTAFKKEIENGPPXXXXXXXDEE----------- 1036
            D   + SLDPK   RK++E++++ DEL   K ++                          
Sbjct: 978  D---YSSLDPKAYQRKLDELNRLTDELLRVKNKVNASDNNLSSRRPSASSSSESASSSSD 1034

Query: 1037 -------LEQDDRASIHSG-NASTGSFLETLSQKYGTGQNAGPTASSRAMVGRESNYPGR 1088
                   +E+ D  S  SG +A  GSFLE L+QKY TGQ +   AS R    R  +    
Sbjct: 1035 SDDGESLIERQDTQSNFSGTSAGPGSFLEALTQKYATGQKS---ASPRDQSTRMKD---- 1087

Query: 1089 GYHRRSFMERVKKSDAA-PFLSELTQKVAPKTPIDGAY-----EIEVGARSEEEHIGIGI 1142
                  F+ R+K+++ A PFL ELT KVA   P++ +         +   S+EE     +
Sbjct: 1088 ----NIFINRIKQTNVAPPFLDELTDKVAEAPPVEASLAEPDNNNTINESSKEETGEANL 1143

Query: 1143 PSKRNGTVVEGMKDADNSGVSNAEVAP 1169
             S  N  V +         +SN EV+P
Sbjct: 1144 TSSDNEVVAQA-------SLSNPEVSP 1163

 Score =  150 bits (378), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 128/204 (62%), Gaps = 22/204 (10%)

Query: 27  LFSNLKKLTG-SGNNANTSNKIEPSDISSPKIVSTPAVPEF--------SGKPLSKQTTL 77
           +F NL++LT  S N+ N S    PS  SSP+   +P             S KPL+K+T+L
Sbjct: 25  IFQNLRRLTNPSSNHTNKS----PSG-SSPRTSYSPERDSTTTRESHTNSLKPLNKKTSL 79

Query: 78  NTQNLSSYV-DMNTPHHNRSPSGMSGSPTKYSYSRRSSQWSNGNNIGNGGRLSRQQTNQS 136
           NTQNLS Y+ D ++P H RS S  S S   YS    S    +  N     +++RQ TNQS
Sbjct: 80  NTQNLSQYINDKHSPQHTRSASVQSSSKYSYSRRSSSQTLGSTLN-----QIARQHTNQS 134

Query: 137 LSSASIFSQGSMTNLTKFMGADGKVKLDRPSNPQEIEDLFAELMHKRNFFQSLPAAGQKE 196
             SASI SQGS TNL+KF+  DGK+ L+ P +P E+E LF ++M KRN  QSLP   Q E
Sbjct: 135 --SASILSQGSFTNLSKFIAPDGKINLEMPRDPNEVEVLFEDIMLKRNILQSLPTDKQNE 192

Query: 197 LMNYDLDKKWLLVKQDLQSELKKL 220
           LM+YDL+KKWL+VKQDLQ+E+KK+
Sbjct: 193 LMSYDLEKKWLIVKQDLQNEMKKM 216

>TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_1.82
            YNL271C
          Length = 1940

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/1156 (38%), Positives = 647/1156 (55%), Gaps = 126/1156 (10%)

Query: 27   LFSNLKKLTGSGNNANTSNKIEPSDISSPKI-VSTPAVPEFSGKPLSKQTTLNTQNLSSY 85
            L  NLKKLT S +  + +N I  SDISSPK  + T  +     KPL+K+T+LN QNLS Y
Sbjct: 26   LLHNLKKLTNSSSTTSQNNAINKSDISSPKSQLLTNKLSMDDLKPLNKRTSLNNQNLSQY 85

Query: 86   V------------------------------DMNTPHHNRSPSGMSGSPTKYSYSRRSSQ 115
            +                              D ++P+HNRS S  S        S + S 
Sbjct: 86   INGKLPKSQSDSSHLGNVKSNHKYEINENIQDGSSPNHNRSASVQS--------SAKYSY 137

Query: 116  WSNGNNIGNGGRLSRQQTNQSLSSASIFSQGSMTNLTKFMGADGKVKLDRPSNPQEIEDL 175
                +N     RLSRQ TN S S+ S+FSQGS  NL+K+M ++G++ LD P++  EIE L
Sbjct: 138  SRRSSNSTAATRLSRQSTNFSGSTPSVFSQGSYANLSKYMDSNGRLNLDMPTDTHEIESL 197

Query: 176  FAELMHKRNFFQSLPAAGQKELMNYDLDKKWLLVKQDLQSELKKLANKK----------- 224
            F ELM+KRN  Q+L    Q+++MNYD  KKW++VKQDLQ+ELK++  K            
Sbjct: 198  FEELMYKRNILQALSPDKQRDIMNYDTKKKWMIVKQDLQNELKRIKLKNNNINNSDTTII 257

Query: 225  -----NTHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKGHNSTSSPILGGGGF 279
                 ++++                                  S  + +T++P      +
Sbjct: 258  PSSMPSSNISERSSVNTMDNNLRTIDTNASNPRIHRKGQKSMSSLSNATTTAPSGVNAEY 317

Query: 280  YESGNQNSSTATLSQDPLHLSPDYYVRKIISDKISTKQLKDLWVSLRTEQLDWVVGFLDA 339
             +  + + S+   +  P+H     YVRKI+SD +S  +L DLWV+LRTEQLDWV  FL+ 
Sbjct: 318  SKIRSISESSDKTNIAPIH-----YVRKILSDTLSKNELNDLWVTLRTEQLDWVDAFLEH 372

Query: 340  QGQVAIANVLLRFFHKESPDALLNDEALDKEFAFFKCLKTLLNLKEGANEAVRTKLVVSA 399
            QG +AIAN L+R  +K +P + L+DE ++KE+ FFKC + L  L +G  E  + KL++  
Sbjct: 373  QGHIAIANNLIRCIYKTAPGSNLSDELIEKEYGFFKCFRVLAMLDQGLYEFTKHKLMMDT 432

Query: 400  ITDGLLSLRISTRRIASEMLVFITQWDIPYGLNQVIGELDQESHVSSNVHLQARLLSANK 459
            +  GL S R+STR++A E+LV+I           VI  LD+   +S N+++   +     
Sbjct: 433  LAFGLFSTRVSTRKMALEILVYIINKKNTQRFESVIMSLDRFFRLSENLNMLKIITQFGG 492

Query: 460  RDSLLAQDHELDLTRDHASKKFEQWLFVVEYTLDGRGKMGSLVGASEDFKSAGGENAILE 519
              S  + D +         K F+ ++  +E TL+GRGKMGS VGAS+DFK +GGENAILE
Sbjct: 493  AFSRTSPDTQF--------KIFQAFVISLESTLNGRGKMGSKVGASDDFKVSGGENAILE 544

Query: 520  YGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFEDRT 579
            Y    L+ +N+LCN   ++NQR +LR++F++ G  R+M KL+L++Y+K+  Q+  +ED  
Sbjct: 545  YCLWALIFINKLCNFSDELNQRVVLRTKFENLGGLRVMTKLKLMDYEKMTVQVENYEDHK 604

Query: 580  ADDYNTIMASKSINHNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQHLFIASSKVQDEG 639
             DD+N+++  KS +  ++M++P SL+ +LWE  KGT  EK L+SL+QHLF++SSK+ D+ 
Sbjct: 605  LDDFNSLLEMKSSSAQINMQDPTSLIGSLWEVCKGTENEKLLLSLMQHLFLSSSKLVDDK 664

Query: 640  DDPTEASKQLKLIDSLVSNVTMSSIDTESSFNGAIQRLYDSMQTDEVARRAIMEARELTR 699
             +P + SKQLKL+DSL++N+T S +D ++  N AIQRLYDSMQTD+VARRAI+E R L++
Sbjct: 665  REPAKLSKQLKLMDSLMTNITASEVDEQTHMNLAIQRLYDSMQTDDVARRAILETRTLSK 724

Query: 700  KFEEVKAERDYLGEKLSKAEGGLVGQLQNELSQRDRILEKNQRVTEQLQADXXXXXXXXX 759
            K EEV AE++YL EKLSKAE GLVGQL+ EL QRD IL K+QRVT+QLQA+         
Sbjct: 725  KLEEVTAEKEYLKEKLSKAENGLVGQLELELEQRDNILTKSQRVTKQLQAELEDLKKKHL 784

Query: 760  XXXXXXXXXXXXXXTILNSRPQGSSAVQEEEAGTASSSAPGVLHADRKLAIQKALQDRLQ 819
                          TI+N+     +++                 +D+K  IQKAL+  L 
Sbjct: 785  LEKHEHEVELRKILTIVNTNTDADASLNNS--------------SDKKHNIQKALETELS 830

Query: 820  QTKKDLTKESKRLGTTLGTTLEPNRRLKLLRSRMEDIENEARELEMTNFADIQRQTVEE- 878
            +TKKDL  + K+     G +++PN+RL++LR +MEDIE EARELEMTNF++ Q+ ++E  
Sbjct: 831  RTKKDLNNDVKK----FGISVQPNKRLRMLRLQMEDIEKEARELEMTNFSEHQKLSLESP 886

Query: 879  --------------QTXXXXXXXXXXXXXDRAPKAKKQVKEDQVRKLRELRQRLASVQKE 924
                          +               RA   KKQ       KL ELR+ LA +Q E
Sbjct: 887  AVLNKTKKETKKKSKKKSKSSKSKEENNRKRANAIKKQ-------KLLELRRDLAMIQAE 939

Query: 925  SNDVSKFNVEERINELFNDKKLSALDRLKELETKYKGFGIDFQADPELSAMLSDAPPENH 984
            +NDVSKFNV++R+NELF +KK  AL+RL+ LE KYK F IDF  +    A L        
Sbjct: 940  TNDVSKFNVDKRVNELFKEKKHEALNRLQMLEKKYKSFEIDFDPNDFKQAQLD------- 992

Query: 985  HAKDGQAHPSLDPKHLSRKIEEMSKIVDELTAFKKEIENGPPXXXXXXXDEELEQDDRAS 1044
                  ++ SLDP  +++KI ++ +I DEL AF  +  +          ++   + +   
Sbjct: 993  ---SNASYESLDPNFVTKKITDIDRIADELDAFSGDGTSSYSSSSLSDSEKNYYESNAVP 1049

Query: 1045 I---HSGNASTGSFLETLSQKYGTGQNAGPTASSRAMVGRESNYPGRGYHRRSFMERVK- 1100
                  G     SFLE+LS+KYGT QN   T  S + +  ++     G   +SFM R K 
Sbjct: 1050 TIGPQKGLIDGSSFLESLSEKYGTAQNTEGT--SLSPLSPQNRIASLG--EKSFMNRFKR 1105

Query: 1101 KSDAAPFLSELTQKVA 1116
            K  +  FL EL+QKV 
Sbjct: 1106 KPSSMQFLEELSQKVG 1121

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/672 (53%), Positives = 459/672 (68%), Gaps = 44/672 (6%)

Query: 1290 MYRAATXXXXXXXXXXXFERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERG 1349
            MYR+             + +YPRP+KKLKQLHW+K++D+  SIW  A AE++ADDLYE+G
Sbjct: 1243 MYRSGDGSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKG 1302

Query: 1350 VLAQLEKAFAAREIKLLANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILR 1409
            VL  LEKAFAAREIK LAN++KEDL+K++FLSRD+SQQFGINLHM+ +L+V E+V KIL+
Sbjct: 1303 VLHNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILK 1362

Query: 1410 CDKDFLGSASVIDFLLKPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRA 1469
            C++D + + SVI+FL KPEI +VS NLARN+APY T+WEGV  V++AK PEK    LQRA
Sbjct: 1363 CNRDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRA 1422

Query: 1470 DQLYLEMMVNLQGYWASRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFE 1529
            DQ+Y+++MVNLQ YW SRMRA+KVIT+YEKEY++L+TKLR ID AVS+IQ SDNL ++F 
Sbjct: 1423 DQIYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFN 1482

Query: 1530 VILAVGNYMNDSSKQAHGFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQE 1589
            VILAVGNYMNDSSKQA GFKL TLQRLTFIKD  NSMTFLNYVEKIIRENY EFN F++E
Sbjct: 1483 VILAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEE 1542

Query: 1590 LEPVLDVVKISVEQLAADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPE 1649
            LEPVLDVVKISVEQL  DC EF+Q+I+NVERS+E+GNLSDSSKFHP D+V+ KVLPVLPE
Sbjct: 1543 LEPVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPE 1602

Query: 1650 ARKRSDLLSDEVKLTLMEFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKM 1709
            A K+SDLL+DEVKLT MEF+ LMQ FGED                 I EYKKA+A N+K 
Sbjct: 1603 ATKKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKA 1662

Query: 1710 XXXXXXXXXXKKMVEEQHKRARLEAEKGGVDDG-SEAEGVTAVSRGE-RDVMDKLLEKLK 1767
                      K+MVEEQ ++A+ E EK  ++ G S++E  +A ++G+ R  MDKLL +LK
Sbjct: 1663 EEEVRKYERHKQMVEEQQRKAK-EQEKNYMETGVSDSE--SAEAKGDNRGHMDKLLAQLK 1719

Query: 1768 NAGPGKSDPSSXXXXXXXXXXXXDGKRSSANILDNFEVDEAAPVNQSLVYSPETTLKAAN 1827
            NAGP +SDPSS              K S++ ILD+    +      S++YSP TT K  +
Sbjct: 1720 NAGPARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDG-----SIIYSP-TTDKVVD 1773

Query: 1828 AAHAE------SPTPKA------------SRQGSVAGSGA-------TATPLLESPSKQA 1862
             +  E      SPTPK+            SR  ++              T + +  +   
Sbjct: 1774 TSLGEDEMILKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITDDGNSNG 1833

Query: 1863 SAGPEDVADRARNLLKELRGPES-EKRKPLLEDHREKMRARRRRVNEGASSE------NK 1915
                E + DRA+ LL ELRG ++  K+   L+D REK+R+RR R  +    E      N+
Sbjct: 1834 DGEDEVITDRAKALLMELRGSQTPSKKNSHLDDQREKLRSRRNRRRQTFGEESNSTPSNR 1893

Query: 1916 LVFVGGASEAPT 1927
            L FV   + +PT
Sbjct: 1894 LTFVSDEN-SPT 1904

>AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YNL271C (BNI1)
          Length = 1918

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/754 (51%), Positives = 531/754 (70%), Gaps = 41/754 (5%)

Query: 282  SGNQNSSTA-TLSQDPLHLSPDYYVRKIISDKISTKQLKDLWVSLRTEQLDWVVGFLDAQ 340
            S +QNS+    ++ +P HLSPD+YVRKIISD+++ ++L DLW+SLRTE +DWV+GF+DAQ
Sbjct: 276  SISQNSAKPMAVAYEPAHLSPDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQ 335

Query: 341  GQVAIANVLLRFFHKESPDALLNDEALDKEFAFFKCLKTLLNLKEGANEAVRTKLVVSAI 400
            GQVAIAN LL+F  +ES D L + +AL+KE A++KCL+ L NL+EG  EA+++KLV+S++
Sbjct: 336  GQVAIANRLLKFVQRESLDILHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLVISSV 395

Query: 401  TDGLLSLRISTRRIASEMLVFI----------TQWDIPYGLNQVIGELDQESHVSSNVHL 450
             +GLLS R+STRR+A+E L+++          T  D  + L   +  LDQES  ++N+HL
Sbjct: 396  VEGLLSSRLSTRRVATETLLYMLSDDELKTADTGQDAIFPL---LVALDQESKFAANIHL 452

Query: 451  QARLLSANKRDSLLAQDHELDLTRDHASKKFEQWLFVVEYTLDGRGKMGSLVGASEDFKS 510
            + RL   NKR SL     +  +     +K+ EQWL+V+EYTLDGRG+MGSLVGAS+D+K 
Sbjct: 453  RGRLHETNKRKSLPTGRADFHVV----AKRLEQWLYVIEYTLDGRGRMGSLVGASDDYK- 507

Query: 511  AGGENAILEYGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLELLNYDKIDE 570
             GGEN +LEY   +++L+N LC+   DV QR LLRSR KS GL+RI++K+ELL Y  ++ 
Sbjct: 508  -GGENTVLEYLLYSMILLNLLCSNHPDVQQRNLLRSRLKSYGLARIIKKMELLKYPALEN 566

Query: 571  QLRIFEDRTADDYNTIMASKSINHNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQHLFI 630
            ++R FED T DDYN +M S +++  VDM++P +L Q+ W  ++GT AE +L+SL+QHL  
Sbjct: 567  EVRKFEDATLDDYNLLMTSTTVDSAVDMKDPAALWQDFWTQHRGTEAEGHLLSLLQHL-F 625

Query: 631  ASSKVQDEGDDPTEASKQLKLIDSLVSNVTMSSIDTESSFNGAIQRLYDSMQTDEVARRA 690
              S+   E  DP E+ KQLKL+D+LV+NVT SSIDTES FNGAIQRLYD+MQTDEVARRA
Sbjct: 626  LWSRAFAEYRDPAESIKQLKLLDALVTNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRA 685

Query: 691  IMEARELTRKFEEVKAERDYLGEKLSKAEGGLVGQLQNELSQRDRILEKNQRVTEQLQAD 750
            I+E+RELT+K+EE+KAERD L  KLS+A+ GLVGQLQ+E+ Q +RILEK+ RVT+QL+ +
Sbjct: 686  ILESRELTKKYEEIKAERDNLASKLSQAQNGLVGQLQSEVEQLERILEKSNRVTDQLKGE 745

Query: 751  XXXXXXXXXXXXXXXXXXXXXXXTILNSRPQGSSAVQEEEAGTASSSAPGVLHADRKLAI 810
                                   TILNS+P G +    E     ++S P  L  ++K+AI
Sbjct: 746  LHALKKKHLLEKHEHEVELRKMLTILNSKPHGENGGSPE----VNTSTPSPLKPEKKMAI 801

Query: 811  QKALQDRLQQTKKDLTKESKRLGTTLGTTLEPNRRLKLLRSRMEDIENEARELEMTNFAD 870
            QKALQDRL+QT+KDLT++SKRL T       PNRRLK+LRS+M+ IE EAR LEMTNFAD
Sbjct: 802  QKALQDRLRQTEKDLTRDSKRLNTVPA----PNRRLKMLRSKMDIIEKEARLLEMTNFAD 857

Query: 871  IQRQTVEEQTXXXXXXXXXXXXXDRAPKAKKQVKEDQVRKLRELRQRLASVQKESNDVSK 930
             +++  EE                  PK ++ ++ +QV++L  LR+RLA +Q+ESN+VSK
Sbjct: 858  FKKEPEEENEPKLLS----------PPKIQRSLRGEQVKELAALRKRLAIIQQESNEVSK 907

Query: 931  FNVEERINELFNDKKLSALDRLKELETKYKGFGIDFQADPELSAM-LSDAPPE-NHHAKD 988
            FNVEER+NELF +KK  ALDRL++LE KYKGFGIDF  DPEL ++ L++   + +    D
Sbjct: 908  FNVEERVNELFYEKKNKALDRLRDLENKYKGFGIDFNEDPELMSLRLANGSVDLDGPTID 967

Query: 989  GQAHPSLDPKHLSRKIEEMSKIVDELTAFKKEIE 1022
             ++   LDP HL  KIEEM+KI+D L   KK+I+
Sbjct: 968  LESSAPLDPAHLDAKIEEMTKILDRLNKLKKDID 1001

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/596 (59%), Positives = 433/596 (72%), Gaps = 50/596 (8%)

Query: 1307 FERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEKAFAAREIKLL 1366
            FERYPRPKKKLKQLHWEKI+D  NSIW++A+AEK+ADDLYE+GVL++LEKAFAAREIK  
Sbjct: 1367 FERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEKAFAAREIKSF 1426

Query: 1367 ANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLK 1426
              R+K++ NK+TFLSRD+SQQFGINLHMY++L V  VV KIL+CDKDFL + S I+FL K
Sbjct: 1427 KGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSK 1486

Query: 1427 PEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWAS 1486
            PEIVEVS N+AR+FAPY+T+WEGVSSV++AK+PEKDP ELQR+DQL+L ++VNLQ YW+S
Sbjct: 1487 PEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSS 1546

Query: 1487 RMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAH 1546
            RMR LK+ITTYEK+Y+DL+ KLRS+DKAV +IQ S+NLR+VF+VILAVGNYMND+SKQA 
Sbjct: 1547 RMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQ 1606

Query: 1547 GFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAA 1606
            GFKL+TLQRLTFIKDEKNSMTFLNYVE+I+ +NY  FNSFLQELEPVL VVKIS+EQLA 
Sbjct: 1607 GFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLAN 1666

Query: 1607 DCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLM 1666
            DC EF   + NVERS+E+GNLSDSSKFHP DRVL KVLP+LPEARK+++LL+DEV+L+LM
Sbjct: 1667 DCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLM 1726

Query: 1667 EFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKKMVEEQ 1726
            EF+ LM+MFGED                 I EYK+AQ  N K+          K M++EQ
Sbjct: 1727 EFENLMRMFGEDADDKFAKNSFFKKFADFILEYKRAQEFNRKIDEEERAYERRKLMIQEQ 1786

Query: 1727 HKRARLEAEKGGVDDGSEAEGVTAVSRG--ERDVMDKLLEKLKNAGPGKSDPSSXXXXXX 1784
             +RA+L  E     D +    ++A+S    +RDVMDKLLEKLKNAGP K DPSS      
Sbjct: 1787 QRRAKLVQE----GDETTCARLSAISASGDDRDVMDKLLEKLKNAGPSKGDPSSARKRAL 1842

Query: 1785 XXXXXXDGKRSSANILDNFEVDE---AAPVNQSLVYSPETTLKAANAAHAESPTPKASRQ 1841
                   G+  S  IL+  +VD+   AAP  Q     P+T L+AA+              
Sbjct: 1843 ARKKLMGGREGSI-ILEGLDVDDLQSAAPDVQ-----PDTPLRAAS-------------- 1882

Query: 1842 GSVAGSGATATPLLESPSKQASAGPEDVADRARNLLKELR-GPESEKRKPLLEDHR 1896
                                AS  P+  ADRAR+LL ELR G   E RK +L++H+
Sbjct: 1883 --------------------ASPPPDPAADRARHLLLELRNGEHPESRKSMLDEHK 1918

 Score =  129 bits (323), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 98/219 (44%), Positives = 129/219 (58%), Gaps = 31/219 (14%)

Query: 27  LFSNLKKLTGSGNNANTSNKIEPSDISSPKIVSTPAVPEFSG-KPLSKQTTLNTQNLSSY 85
           LFSNL KLTGS      S +I  SDISSPK V+ P+  + SG KPL+K  T+N  NL   
Sbjct: 34  LFSNLMKLTGSSG----SQRIATSDISSPKKVTLPSNLDLSGAKPLNKLNTINASNLPQV 89

Query: 86  VDMNTPHHNRSPSGMS-GSPTKYSYSRRSSQWSNGNNIGN-------------------- 124
               T    RS SG +  SP+KYSYS+RSSQW++     +                    
Sbjct: 90  SGEVT--QARSASGAALSSPSKYSYSKRSSQWASSKQANHPEHDQQYPQHLNHLFVQPHP 147

Query: 125 -GGRLSRQQTNQSLSSASIFSQGSMTNLTKFMGADGKVKLDRPSNPQEIEDLFAELMHKR 183
               L+RQ TNQS  SAS ++  S++ L K    DG + L++P +PQEIE+L+ EL+ KR
Sbjct: 148 HHSALTRQMTNQSNYSASSYT--SLSLLHKATDIDGTLTLEKPEDPQEIEELYQELLQKR 205

Query: 184 NFFQSLPAAGQKELMNYDLDKKWLLVKQDLQSELKKLAN 222
           N  QS+   G +ELM+Y +DKKWL+VKQDLQ+E KK+ N
Sbjct: 206 NIPQSVSVHGHRELMSYGIDKKWLMVKQDLQTEYKKMKN 244

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 48/79 (60%), Gaps = 12/79 (15%)

Query: 1051 STGSFLETLSQKYGTGQNAGP--TASSRAMVG------RES-NYPGRGYHRRSFMERVKK 1101
            S  SFLETLSQKYGTG  +G    +SS  M G      R S N    G HR+SF+ R+K+
Sbjct: 1084 SNASFLETLSQKYGTGSQSGAASVSSSEHMRGVVNVKRRTSQNSINSGNHRKSFVNRMKR 1143

Query: 1102 S---DAAPFLSELTQKVAP 1117
            +    ++ FL ELTQKV+P
Sbjct: 1144 TITPTSSNFLEELTQKVSP 1162

>Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {ON}
            YNL271C (REAL)
          Length = 1946

 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/626 (58%), Positives = 454/626 (72%), Gaps = 35/626 (5%)

Query: 1307 FERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEKAFAAREIKLL 1366
            FE+YPRP KKLKQLHWEK++ T NSIW   KAEK+ADDLYE+GVLA LEKAFAAREIK L
Sbjct: 1341 FEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1400

Query: 1367 ANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLK 1426
            A +RKEDL K+TFLSRD+SQQFGINLHMY++LSV ++V K+L CD+DFL + SV++FL K
Sbjct: 1401 ATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSK 1460

Query: 1427 PEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWAS 1486
             EI+EVS NLARN+APYST+WEGV ++D+AK PEKDP +LQRADQ+YL++M+NL+ YW S
Sbjct: 1461 TEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESYWGS 1520

Query: 1487 RMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAH 1546
            RMRAL V+T+YE+EY++LL KLR +DKAV ++Q SDNLR+VF VILAVGN+MND+SKQA 
Sbjct: 1521 RMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQ 1580

Query: 1547 GFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAA 1606
            GFKL+TLQRLTFIKD  NSMTFLNYVEKIIR NY  FN FL+ELEPVLDVVK+S+EQL  
Sbjct: 1581 GFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQLVN 1640

Query: 1607 DCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLM 1666
            DC++FSQ+IVNVERS+E+GNLSDSSKFHP D+VL+K LPVLPEAR++ DLL DEVKLT+M
Sbjct: 1641 DCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLTIM 1700

Query: 1667 EFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKKMV--- 1723
            EF+ LMQ +GED                 I EYKKAQA N+            KK+V   
Sbjct: 1701 EFESLMQTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAGEEEERLYEKHKKLVEEQ 1760

Query: 1724 -------EEQHKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLKNAGPGKSDP 1776
                   E+Q +R+   + +G  +D +E           RDVMDKLLE+LKNAGP K+DP
Sbjct: 1761 QKKAQEKEKQKERSASPSPEGNEEDEAE---------DRRDVMDKLLEQLKNAGPAKTDP 1811

Query: 1777 SSXXXXXXXXXXXXDGKRSSANILDNFEVDEAAPVNQSLVYSPE-TTLKAANAAHAESPT 1835
            SS              K S+  +L++ + +E      S++YSPE TT     A HAESPT
Sbjct: 1812 SSARKRALVRKKYLSDKDSAPQLLNDLDNEEG-----SILYSPEATTPDTYTAVHAESPT 1866

Query: 1836 PKASRQGSVAGSGATATPL-LESPSKQ-ASAGPEDVADRARNLLKELRGPE-SEKRKPLL 1892
            P A+R       G   TP  L SPSK  A    E+++DRAR LLKELRG E S K+   L
Sbjct: 1867 PLATR-------GLMNTPEDLPSPSKAPALEDQEEISDRARMLLKELRGSEISVKQNSTL 1919

Query: 1893 EDHREKMRARRRRVNEGASSENKLVF 1918
            ++H EK+RAR+ R +   ++ NKL F
Sbjct: 1920 DEHLEKLRARKERASSETNTGNKLSF 1945

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/894 (43%), Positives = 554/894 (61%), Gaps = 70/894 (7%)

Query: 277  GGFYESGNQNS-STATLSQDPLHLSPDYYVRKIISDKISTKQLKDLWVSLRTEQLDWVVG 335
               Y  G++N+ S +TL  D  +  P +YV++I++DK++T ++KDLWV+LRTEQLDWV  
Sbjct: 312  NNIYRGGSENNISASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDA 371

Query: 336  FLDAQGQVAIANVLLRFFHKESPDALLNDEALDKEFAFFKCLKTLLNLKEGANEAVRTKL 395
            F++ QG +A+ANVL+   +K +P   L  E L+KE +FFKC + L  L +G  E    +L
Sbjct: 372  FIEHQGHIAMANVLMNSMYKTAPRDNLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRL 431

Query: 396  VVSAITDGLLSLRISTRRIASEMLVFITQWDIPYGLNQVIGELDQESHVSSNVHLQARLL 455
            +   + +GL S +++T+++A+E+ V + +         V+  LD++  +  N+H+     
Sbjct: 432  MTDTVAEGLFSTKLATKKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFK 491

Query: 456  SANKRDSLLAQDHELDLTRDHASKKFEQWLFVVEYTLDGRGKMGSLVGASEDFKSAGGEN 515
               +  S L  +  L        K  + WLF VE TLDGRGKMGSLVGAS+DFK+ GGEN
Sbjct: 492  KMPQYFSHLTLESHL--------KIIQAWLFAVEQTLDGRGKMGSLVGASDDFKNGGGEN 543

Query: 516  AILEYGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIF 575
            AILEY   T++ +N LC+   ++NQR LLR++ ++CG+ RIM K++LL+YDK+ +Q+ ++
Sbjct: 544  AILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLY 603

Query: 576  EDRTADDYNTIMASKSINHNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQHLFIASSKV 635
            ++   DD+N  + + +   NVD+++PLSLL+NLW   KGT  EK LVSLVQHLF++SSK+
Sbjct: 604  DNNKLDDFNVKLEANNEAFNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSKL 663

Query: 636  QDEGDDPTEASKQLKLIDSLVSNVTM-SSIDTESSFNGAIQRLYDSMQTDEVARRAIMEA 694
             +E  + ++ +KQLKL+DSLV+NV++ S+ D ES+ N AIQRLYD+MQTDEVARRAI+E+
Sbjct: 664  IEENQNSSKLTKQLKLMDSLVTNVSIASAADEESNLNMAIQRLYDAMQTDEVARRAILES 723

Query: 695  RELTRKFEEVKAERDYLGEKLSKAEGGLVGQLQNELSQRDRILEKNQRVTEQLQADXXXX 754
            R LT+K EE++AERD L EKLSKAE GLVGQL++EL +RD IL KNQRV +QL+++    
Sbjct: 724  RALTKKLEEIQAERDSLSEKLSKAEHGLVGQLEDELHERDHILAKNQRVMQQLESELEEL 783

Query: 755  XXXXXXXXXXXXXXXXXXXTILNSRPQGSSAVQEEEAGTASSSAPGVLHADRKLAIQKAL 814
                               TILNSRP+ SS + E   GT +      L+   K  IQK L
Sbjct: 784  KKKHLLEKHQQEVELRKMLTILNSRPEESSDINE---GTRNIDPS--LNFSEKANIQKVL 838

Query: 815  QDRLQQTKKDLTKESKRLGTTLGTTLEPNRRLKLLRSRMEDIENEARELEMTNFADIQRQ 874
            QD L +      K+ K      G TL+PN+RLK+LR +ME+IENEAR+LEMTNFA+ +++
Sbjct: 839  QDGLSRA----KKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKE 894

Query: 875  TVEEQTXXXXXXXXXXXXXDRAPKAKKQVKEDQVRKLRELRQRLASVQKESNDVSKFNVE 934
             +E                D+   A+ Q  E  + KL +LR+ LA +Q ESN++SKFNVE
Sbjct: 895  RLEPPIQIKKPKLKKNKHKDKNFLARAQ--EADMNKLNDLRRALADIQMESNNISKFNVE 952

Query: 935  ERINELFNDKKLSALDRLKELETKYKGFGIDFQADPELSAMLSDAPPENHHA--KDGQA- 991
            ER+NELFN+KK  AL RLKELETKYKGFGIDF  +      + ++P +   A  ++G A 
Sbjct: 953  ERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEK-----IMESPKKLSVADEREGDAR 1007

Query: 992  HPSLDPKHLSRKIEEMSKIVDELTAFK-------KEIENGP---PXXXXXXXDEELEQDD 1041
            + SLDPK   +K++E+++I DEL   +       KE ENG            D+E+ QD 
Sbjct: 1008 YSSLDPKAYQKKLDEINRITDELLDLQTQTKQETKEEENGKSSFSSSSSDADDDEVYQDA 1067

Query: 1042 RAS--IHSGN------ASTGSFLETLSQKYGTGQNAGPTASSRAMVGRESNY-PGRGYH- 1091
              +  I S N      +  GSFL+ LSQKYGTGQN   +A       R+S Y  G G+  
Sbjct: 1068 SPTHEIRSENSELSAGSGPGSFLDALSQKYGTGQNVTASAGL-----RDSGYVSGLGHTP 1122

Query: 1092 ---RRSFMERVKKS--DAAPFLSELTQKVAPKTPIDGAYEIEVGARSEEEHIGI 1140
                ++FM R+K+S  ++AP+L ELTQKV    P +           + EH+ I
Sbjct: 1123 SKVEKTFMNRLKRSTVNSAPYLEELTQKVNKVEPCE-----------QNEHVNI 1165

 Score =  146 bits (368), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 83/161 (51%), Positives = 109/161 (67%), Gaps = 20/161 (12%)

Query: 68  GKPLSKQTTLNTQNLSSYVD----MNTP---HHNRSPSGMSGSPTKYSYSRR-SSQWSNG 119
            +PL+K++TLNTQNLS Y+      + P    H RS S  S    KYSYS+R SSQ SN 
Sbjct: 81  ARPLNKKSTLNTQNLSQYMSGKMSADVPISSQHARSHSVQS----KYSYSKRNSSQASN- 135

Query: 120 NNIGNGGRLSRQQTNQSLSSASIFSQGSMTNLTKFMGADGKVKLDRPSNPQEIEDLFAEL 179
                  +L+RQ T QS S++S+ SQGS+TNL+KF   DGK+ L+ PS+P E+E LF ++
Sbjct: 136 -------KLTRQHTGQSHSASSLLSQGSLTNLSKFTTPDGKIHLEMPSDPYEVEILFEDI 188

Query: 180 MHKRNFFQSLPAAGQKELMNYDLDKKWLLVKQDLQSELKKL 220
           M+KRN FQSL    Q+ LM Y  +KKWL+VKQDLQ+ELKK+
Sbjct: 189 MYKRNIFQSLSGDKQEALMGYSTEKKWLIVKQDLQNELKKM 229

>KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON} 
          Length = 2028

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/643 (56%), Positives = 451/643 (70%), Gaps = 26/643 (4%)

Query: 1307 FERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEKAFAAREIKLL 1366
            FE+YPRP+KKLKQLHWEK++ T NSIW  +KAEK+ADDLYE+GVL+ LEKAFAARE+K L
Sbjct: 1373 FEKYPRPQKKLKQLHWEKLDSTNNSIWSASKAEKFADDLYEKGVLSNLEKAFAAREVKSL 1432

Query: 1367 ANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLK 1426
            ++++ +D +K+TFL+RDVSQQFGINLHM+  LSV+E+V KIL+CD++ L S SVI+FL K
Sbjct: 1433 SSKKGDD-SKITFLTRDVSQQFGINLHMFGNLSVEELVTKILKCDREVLNSPSVIEFLSK 1491

Query: 1427 PEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWAS 1486
             E+VEVS NLARN++PYST+WEGV  +++AK PEKDP ELQRADQLY+ +MVNLQ YW+S
Sbjct: 1492 QEVVEVSVNLARNYSPYSTDWEGVKRIEDAKAPEKDPNELQRADQLYMSLMVNLQPYWSS 1551

Query: 1487 RMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAH 1546
            RMRALKVITTYE+EY++LL KLR +DKAV S+Q S+NL++V  VILAVGNYMND+SKQA 
Sbjct: 1552 RMRALKVITTYEREYAELLEKLRKVDKAVGSLQQSENLKNVLNVILAVGNYMNDTSKQAQ 1611

Query: 1547 GFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAA 1606
            GFKLATLQRLTFIKD  NSMTFLNYVEKI+R+NY  FN FL EL+PVLDVVKIS++QL +
Sbjct: 1612 GFKLATLQRLTFIKDTTNSMTFLNYVEKIVRKNYPTFNDFLNELQPVLDVVKISIDQLVS 1671

Query: 1607 DCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLM 1666
            DC+EFS ++VNVERSIE+GNLSDSSKFHP DRVLVKVLPVLPEARK++DLL+DEVKLT++
Sbjct: 1672 DCQEFSGSVVNVERSIEIGNLSDSSKFHPSDRVLVKVLPVLPEARKKADLLTDEVKLTML 1731

Query: 1667 EFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKKMVEEQ 1726
            EF+ LMQ +GED                 IQEYKKAQ  N+            KK+VEEQ
Sbjct: 1732 EFNNLMQTYGEDSADKFAKNSFFKKFADFIQEYKKAQVQNVAAEEEEQQYERHKKIVEEQ 1791

Query: 1727 HK-----RARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLKNAGPGKSDPSSXXX 1781
             +     R RLE+      +G +   V   ++  R +MDKLLE+LKNAG  K+DPSS   
Sbjct: 1792 QRQGEEARKRLESASPDATNGEDTTAVDDETKDRRAIMDKLLEQLKNAGTVKADPSSARK 1851

Query: 1782 XXXXXXXXXDGKRSSANILDNFEVDEAAPVNQSLVYSPETTLKAANAAHAESPTPKASRQ 1841
                       K +++ +L + + D+      SLVYSP+T  ++       SPTP     
Sbjct: 1852 RALARRKLLGDKDAASALLHDIDTDD-----DSLVYSPDTKRQSVGHLIGGSPTPGDKLL 1906

Query: 1842 GSVAGSGATATPLLESPSKQASAGPEDVADRARNLLKELRGPESEK-RKPLLEDHREKMR 1900
            GS        TP  E  S  A    EDV DRA+ LL ELRG +S   +K    D + +  
Sbjct: 1907 GS--------TPTKELSSPTAGQDDEDVTDRAKALLMELRGGQSSPMKKNAFLDEQRERI 1958

Query: 1901 ARRRRVNEGASSE-----NKLVFVGGASEAPTDSHKGLPNDTT 1938
              RRR NE A +E     NKL F    +E    +H    NDTT
Sbjct: 1959 RSRRRRNELAGTEPLRGGNKLSFFEAETETSETAHDA-DNDTT 2000

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/857 (40%), Positives = 522/857 (60%), Gaps = 58/857 (6%)

Query: 287  SSTATLSQDPLHLSPDYYVRKIISDKISTKQLKDLWVSLRTEQLDWVVGFLDAQGQVAIA 346
            SS++TL+ D  +  P +YV+KII+D++S  +L DLWV+LRTEQLDWV  FLD QG +A+A
Sbjct: 404  SSSSTLASDKTNRLPIHYVKKIIADQLSQDELNDLWVTLRTEQLDWVDAFLDNQGHIAMA 463

Query: 347  NVLLRFFHKESPDALLNDEALDKEFAFFKCLKTLLNLKEGANEAVRTKLVVSAITDGLLS 406
            NVL++  +K SP+  L+   LDKE ++FKC K L  L +G  E    +L+   I  GL S
Sbjct: 464  NVLMKSLYKTSPNVSLSGPLLDKEQSYFKCFKVLSMLAQGLREFTDHRLITDTIARGLFS 523

Query: 407  LRISTRRIASEMLVFITQWDIPYGLNQVIGELDQESHVSSNVHLQARLLSANKRDSLLAQ 466
             R+ TR++A+E+ V + +       + VI  LDQ   + SN H+   L            
Sbjct: 524  SRLPTRKMATEIFVCMLETKNQTRFDAVITSLDQNFQIGSNAHMVNNLQKM--------P 575

Query: 467  DHELDLTRDHASKKFEQWLFVVEYTLDGRGKMGSLVGASEDFKSAGGENAILEYGYLTLL 526
            D+ + L      K  + WLF ++ TLDGRGKMGSLVGAS++FK   GEN++LEY   TL+
Sbjct: 576  DYFIHLNLQSTLKVVQAWLFAIDQTLDGRGKMGSLVGASDEFKRIDGENSVLEYCQWTLV 635

Query: 527  LVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTADDYNTI 586
             VN+ C +  ++NQR LLR++ ++ G  RIM K++LL+Y+KI +Q+  +E    DD+N++
Sbjct: 636  FVNKFCQSSNNLNQRMLLRTKLENAGFLRIMNKMKLLDYEKIRDQIEFYEAGKLDDFNSL 695

Query: 587  MASKSINHNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQHLFIASSKVQDEGDDPTEAS 646
            + S++ + N+DM+NPLSLLQNLW++ +GT +E  LVSLVQHLF++S+++     DPT+ +
Sbjct: 696  LESQNKHANIDMQNPLSLLQNLWDACRGTDSENLLVSLVQHLFLSSTRLIQNNKDPTQLA 755

Query: 647  KQLKLIDSLVSNV--TMSSI-DTESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEE 703
            KQLKLIDSLV+NV  ++S++ D E++ +  IQRL+DSMQTDEVARRAI+E+R LT+K EE
Sbjct: 756  KQLKLIDSLVTNVGSSVSAVADEETTMSMTIQRLFDSMQTDEVARRAIIESRTLTKKMEE 815

Query: 704  VKAERDYLGEKLSKAEGGLVGQLQNELSQRDRILEKNQRVTEQLQADXXXXXXXXXXXXX 763
            ++AE+D LG+KLSKAEGGLVG+LQ ++ +RD IL KNQRV +QL+ +             
Sbjct: 816  LQAEKDRLGDKLSKAEGGLVGELQRDIRERDAILAKNQRVNKQLENELEELKRKTLMEKH 875

Query: 764  XXXXXXXXXXTILNSRPQGSSAVQEEEAGTASSSAPG---VLHADRKLAIQKALQDRLQQ 820
                      TI+NS+   + A Q   A    S  P     L ++++  IQK LQD L +
Sbjct: 876  EHEVELRKMLTIINSKASPNLA-QNPSASVLKSHDPKNKESLLSEQQSKIQKVLQDGLTR 934

Query: 821  TKKDLTKESKRLGTTLGTTLEPNRRLKLLRSRMEDIENEARELEMTNFADIQRQTV---- 876
            TKKD T ++K+     G T++PN+RL+LLR ++EDIENEAR+LEMTNFADI++       
Sbjct: 935  TKKDFTNDAKK----FGMTVQPNKRLQLLRMKVEDIENEARQLEMTNFADIEKNATPVIL 990

Query: 877  -EEQTXXXXXXXXXXXXXDRAPKAKKQVKEDQVRKLRELRQRLASVQKESNDVSKFNVEE 935
             +                D+  +A ++ +  ++  L +LR  L ++Q ESND+SKFNVEE
Sbjct: 991  TKGTKKKKSKKKLKTAQPDKKQRANQRNENQKIEALNKLRMALTAIQSESNDISKFNVEE 1050

Query: 936  RINELFNDKKLSALDRLKELETKYKGFGIDFQADPELSAMLSDAPPENHHAKDGQAHPSL 995
             +NELF ++K  AL RL++LE+K+ G   +F  D     +++          DG    SL
Sbjct: 1051 HVNELFTERKFKALQRLRDLESKFNGLNTNFNIDD----IIASTEKALTATDDGY---SL 1103

Query: 996  DPKHLSRKIEEMSKIVDELTAFK---KEIENGP----PXXXXXXXDEELEQDDRASIHSG 1048
            DP+    K++E+ ++ ++L+      KE E               +     ++ +++ S 
Sbjct: 1104 DPRRADNKLDEIERLTNDLSKLHDSMKEQEQATLQSDNSSESSDSESVESDNEGSTVQSD 1163

Query: 1049 ----NASTGSFLETLSQKYGTGQNAGPTASSRAMVGRESNYPGRGYHRRSFMERVKKSDA 1104
                   +GSFL +LSQKY TGQ             ++ N P    ++++FM R+K+S  
Sbjct: 1164 VSEPTVGSGSFLASLSQKYETGQ-------------KQPNSPV-TVNQKAFMTRLKRSSG 1209

Query: 1105 AP-FLSELTQKVAPKTP 1120
            AP +L EL++K+ P+ P
Sbjct: 1210 APLYLQELSKKI-PQRP 1225

 Score =  125 bits (315), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 110/183 (60%), Gaps = 30/183 (16%)

Query: 61  PAVPEFSGKPLSKQTTLNTQNLSSYVD------------MNTPH--HNRSPSGMSGSPTK 106
           P VP    KPLSK+ T+N+QNLS Y              M +P   H+R+ SG +   + 
Sbjct: 148 PGVP----KPLSKKATMNSQNLSHYTSGVSATSSDGDGGMASPEYTHSRTQSGQTSRFSY 203

Query: 107 YSYSRRSSQWSNGNNIGNGGRLSRQQTNQSLSSASIFSQGSMTNL-TKFMGA-DGKVKLD 164
            S SRRSS         +  +L++  T QS S  SI SQGS++ L  +F+   DGK++L+
Sbjct: 204 TSPSRRSS---------SDAKLAKYHTAQS-SQNSIASQGSLSTLYNRFISPEDGKLRLE 253

Query: 165 RPSNPQEIEDLFAELMHKRNFFQSLPAAGQKELMNYDLDKKWLLVKQDLQSELKKLANKK 224
            P +P E+E L+ ++M+KRN  Q+LP   Q ELMNYD+ KKWL+VKQDLQ+E KKL  K 
Sbjct: 254 MPDDPAEVELLYEDIMYKRNILQNLPTDKQLELMNYDVKKKWLIVKQDLQNERKKLKTKT 313

Query: 225 NTH 227
           ++H
Sbjct: 314 SSH 316

>TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa] {ON}
            Anc_1.82 YNL271C
          Length = 2170

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/645 (54%), Positives = 448/645 (69%), Gaps = 19/645 (2%)

Query: 1288 KAMYRAATXXXXXXXXXXXFERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYE 1347
            K+MYR  +           FE+YPR +KKLKQLHWEK++DT NSIW + KAE++ADDL+E
Sbjct: 1418 KSMYRTDSAPDFSTSPNF-FEKYPRSQKKLKQLHWEKLDDTDNSIWVNGKAEEFADDLFE 1476

Query: 1348 RGVLAQLEKAFAAREIKLLANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKI 1407
            +GVL +LE AFAAREIK LA+++KED  K+T+LSRD+SQQFGINLHM++ L+V +++ KI
Sbjct: 1477 KGVLKRLESAFAAREIKSLASKKKEDSTKITYLSRDISQQFGINLHMFSNLTVDQLIEKI 1536

Query: 1408 LRCDKDFLGSASVIDFLLKPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQ 1467
            +RCD+  L + SVIDFL K EIVEVS NLAR++APYST+WEGV  V +AK PEKDP ELQ
Sbjct: 1537 IRCDRSILNTPSVIDFLSKQEIVEVSVNLARSYAPYSTDWEGVKDVKDAKPPEKDPNELQ 1596

Query: 1468 RADQLYLEMMVNLQGYWASRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSV 1527
            RADQ+YL++MVNLQ YW SRM ALKV+T+YEK++ +L+ KLR +D AV SIQ S+NL++V
Sbjct: 1597 RADQIYLQLMVNLQSYWGSRMIALKVVTSYEKDFDELIRKLRRVDLAVGSIQKSENLKNV 1656

Query: 1528 FEVILAVGNYMNDSSKQAHGFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFL 1587
            F VILAVGN+MND+SKQA GFKLATLQRLTFIKD  N+MTFLNYVE IIR+NY EFN FL
Sbjct: 1657 FNVILAVGNFMNDASKQAQGFKLATLQRLTFIKDSTNNMTFLNYVESIIRQNYPEFNDFL 1716

Query: 1588 QELEPVLDVVKISVEQLAADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVL 1647
             EL+PVLDVVK+S+EQL  DC+EFSQ I+NV RS+E+G LSDSSKFHP D+VL+KVLPVL
Sbjct: 1717 NELQPVLDVVKVSIEQLVRDCKEFSQGIINVGRSVEIGKLSDSSKFHPQDKVLIKVLPVL 1776

Query: 1648 PEARKRSDLLSDEVKLTLMEFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNI 1707
            PEA K++DLLSDEVKL++MEF+ LMQ+FGED                 I EYK+AQ  N+
Sbjct: 1777 PEATKKADLLSDEVKLSIMEFENLMQVFGEDSKDKFAKNSFFKKFADFINEYKRAQEQNL 1836

Query: 1708 KMXXXXXXXXXXKKMVEEQHKRARLEAEKGGVDDGSEAEGV-TAVSRGERDVMDKLLEKL 1766
            K+          KK +EEQ KR     +K   DD S  +G         RDVMDKLLE+L
Sbjct: 1837 KVEEEERIYENHKKRIEEQQKRLEDSKKKSHSDDTSNTDGTEEEEDEDRRDVMDKLLEQL 1896

Query: 1767 KNAGPGKSDPSSXXXXXXXXXXXXDGKRSSANILDNFEVDEAAPVNQSLVYSP---ETTL 1823
            KN GP K+DP+S            + K +++ IL  FE  E      S+VYSP   + T 
Sbjct: 1897 KNVGPVKTDPTSARKRAMVRKKLQNEKETASQILKEFETGE-----DSIVYSPTDSKITP 1951

Query: 1824 KAANAAHAESPTP-KASRQGSVAGSGATATPLLESPSKQASAGPED-----VADRARNLL 1877
            K  +  + +SPTP + S    +  +    T    +  K  +    D     + DRA++LL
Sbjct: 1952 KKVSNEYLQSPTPGEKSSLADMTSTPNPTTITTTTDGKVTNDSSNDDLDQEIVDRAKSLL 2011

Query: 1878 KELRGPESEKRK-PLLEDHREKMRARRRRVNEGASSENKLVFVGG 1921
             ELRG ++  RK  +LE+ +EK+RARRR  ++  S  NKL FV  
Sbjct: 2012 FELRGSQTPTRKNSVLEERKEKLRARRRNTSDLTS--NKLKFVSS 2054

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/903 (41%), Positives = 531/903 (58%), Gaps = 91/903 (10%)

Query: 270  SSPILGG--GGFYESGNQNSSTATLSQDPLHLSPDYYVRKIISDKISTKQLKDLWVSLRT 327
            +SPI+         S N N+  + LS D  +  P+ Y+++I++D++S  ++ DLWV+LRT
Sbjct: 389  ASPIISKPKTKLKNSNNINNKASALSPDRTNRLPNDYIKEILNDRLSVDEMNDLWVTLRT 448

Query: 328  EQLDWVVGFLDAQGQVAIANVLLRFFHK-ESPDALLNDEALDKEFAFFKCLKTLLNLKEG 386
            EQL WV  FL+ QG +A+AN L++  ++  +    L+   +DKE+ FFKC + L  L +G
Sbjct: 449  EQLTWVNTFLEDQGHIAMANSLMKSIYRINTMQNSLSTYLIDKEYNFFKCFRVLSMLSQG 508

Query: 387  ANEAVRTKLVVSAITDGLLSLRISTRRIASEMLVFITQWDIPYGLNQVIGELDQESHVSS 446
              E ++ KL+   +  GL S R++TR+IA+E+ V + Q     GLN ++   D+   ++ 
Sbjct: 509  LTEFIKHKLMTDTLVQGLFSTRLATRKIATEIFVLMLQKINDDGLNILLTTFDKTFSINE 568

Query: 447  NVHLQARLLSANKRDSLLAQDHELDLTRDHASKKFEQWLFVVEYTLDGRGKMGSLVGASE 506
            N+++   L   N  D      H L+ T     K    WL+ VE TLDGRGKMGSLVGAS+
Sbjct: 569  NLNMVYLL--KNVPDKY----HYLNSTNTTQIKVLVSWLYAVESTLDGRGKMGSLVGASQ 622

Query: 507  DFKSAGGENAILEYGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLELLNYD 566
            DFK  GGENAILEY   T++L+N+LCN    +NQR LLR++ ++ G  RIM KL+ L+Y+
Sbjct: 623  DFKITGGENAILEYCQWTMVLINRLCNASTIINQRVLLRTKLENIGSIRIMNKLKKLDYE 682

Query: 567  KIDEQLRIFEDRTADDYNTIMASKSINHNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQ 626
            KI EQL  +E++  DD NT++  +    +VD++NP+SLL +L E  K T  E+ L S++Q
Sbjct: 683  KITEQLEDYENKKLDDLNTLLE-QDTKSSVDLDNPISLLSHLLEVCKDTEGEQSLTSIIQ 741

Query: 627  HLFIASSKVQDEGDDPTEASKQLKLIDSLVSNVTMSSIDTESSFNGAIQRLYDSMQTDEV 686
            HL+++SSK+ D+ DDPT+ SKQLKL+DSL+++ T+S++D ES  N AIQ LYDSM TD+V
Sbjct: 742  HLYLSSSKLFDDKDDPTKLSKQLKLMDSLMTDATLSTVDNESKMNMAIQHLYDSMVTDDV 801

Query: 687  ARRAIMEARELTRKFEEVKAERDYLGEKLSKAEGGLVGQLQNELSQRDRILEKNQRVTEQ 746
            ARRAI+E+R LT+K EEV+AERD+L  +LS+AE GLVG+L+NEL+QRD IL KNQRVT+Q
Sbjct: 802  ARRAILESRNLTKKLEEVQAERDFLSNRLSEAENGLVGKLENELAQRDSILAKNQRVTQQ 861

Query: 747  LQADXXXXXXXXXXXXXXXXXXXXXXXTILNSRPQGS-----SAVQEEEAGTASSSAPGV 801
            L+ +                       TILNSRP+       S++   +          +
Sbjct: 862  LRTELDELKKKHLMEKHDHEVELRKMLTILNSRPETELDNTMSSISRTKRNKHEIEKLEL 921

Query: 802  LHADRKLAIQKALQDRLQQTKKDLTKESKRLGTTLGTTLEPNRRLKLLRSRMEDIENEAR 861
            L   RK  I+KALQD LQ+TKKDL+ +SKR     G T++PN+RL+ LR +MEDIENEAR
Sbjct: 922  LK--RKKVIEKALQDGLQKTKKDLSLDSKR----FGITVQPNKRLQALRLQMEDIENEAR 975

Query: 862  ELEMTNFADIQRQTVEEQTXXXXXXXX---------XXXXXDRAPK-AKKQVKEDQVRKL 911
            +LEMTNF D  R   + Q                       DR+ + AKKQ      +KL
Sbjct: 976  QLEMTNFTDPVRTPKKGQEKRDSHNKHPSLKPGIPIAKKNKDRSEEMAKKQ------QKL 1029

Query: 912  RELRQRLASVQKESNDVSKFNVEERINELFNDKKLSALDRLKELETKYKGFGIDFQADPE 971
             ELR+ LA +Q+E+ND+S+FNVEE +NELFN KK+ A++RLKELET Y+ FG+DF  +  
Sbjct: 1030 AELRKALADIQQETNDISRFNVEEHVNELFNAKKIQAMERLKELETMYQNFGVDFNMEEF 1089

Query: 972  LSAMLSDAPPENHHAK----DGQAHPSLDPKHLSRKIEEMSKIVDELTAFKKEIENGPPX 1027
            L          N   K    D  A+ +LDP     K++E+ K   +L     ++ N    
Sbjct: 1090 LEK-------NNTSTKELDPDSPAYETLDPNLFIDKMDELDKFSMKLDQLTSDLNNTMSA 1142

Query: 1028 XXXX--------------------XXDEELEQ-------DDRASIHSGNAST---GSFLE 1057
                                      DEE E        +D +S  S  ++T    SFLE
Sbjct: 1143 KQNSLSTTNSNQISTPSSTSSSDFESDEENENTALSNNVNDNSSTFSHQSTTSGGSSFLE 1202

Query: 1058 TLSQKYGTGQNA-GPTASSRAMVGRESNYPGRGYHR--RSFMERVKKSDAAP-FLSELTQ 1113
            +LSQKYGTGQNA GP +         SN P   ++   R FM R+KK  A P ++ EL Q
Sbjct: 1203 SLSQKYGTGQNASGPMS---------SNTPNVSHYNPERKFMSRMKKQHATPNYIRELNQ 1253

Query: 1114 KVA 1116
            KV+
Sbjct: 1254 KVS 1256

 Score =  129 bits (325), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 92/225 (40%), Positives = 129/225 (57%), Gaps = 31/225 (13%)

Query: 30  NLKKLTGS----GNNANTSNKIEPSDISSP-KIVSTPAVPEFSGK-------PLSKQTTL 77
           NLK+ T S      N+NTSN I      SP + +S+ +  +   +       PL+ + +L
Sbjct: 43  NLKRFTNSHLNHNLNSNTSNDIFSIRSHSPDRSISSASQQQQQQQQQQQQQQPLNMRNSL 102

Query: 78  NTQNLSSYV------DMNTPH-HNRSPSGMSGSP--TKYSYSRRSSQW-----SNGNNIG 123
              N++ YV      + N  H  N S + ++ +P  TKYSYSRR S         GN+  
Sbjct: 103 TNPNMNQYVTSPYTHEYNNSHSRNTSINSVNSNPLSTKYSYSRRGSNQILSPSPTGNSSN 162

Query: 124 NGGRLSRQQTNQSL-----SSASIFSQGSMTNLTKFMGADGKVKLDRPSNPQEIEDLFAE 178
           N       Q   S+     +S+SI SQGS+ NL KFM  DGKV L+ P+NP E+E L+ +
Sbjct: 163 NNTSNINPQQRYSVHSNNPNSSSILSQGSLHNLMKFMTPDGKVNLEMPNNPAEVEALYED 222

Query: 179 LMHKRNFFQSLPAAGQKELMNYDLDKKWLLVKQDLQSELKKLANK 223
           +M+KRN  Q+LPA  Q+ELM+YD+ KKWL+VKQDLQSELKK+ +K
Sbjct: 223 IMYKRNILQNLPADKQRELMSYDVSKKWLIVKQDLQSELKKMRSK 267

>NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON} 
          Length = 2022

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/625 (56%), Positives = 447/625 (71%), Gaps = 29/625 (4%)

Query: 1307 FERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEKAFAAREIKLL 1366
            FE YPRP KKLKQLHWEK+E T NSIW+  KAE++ADDLYE+GVL++LE AFAAREIK L
Sbjct: 1346 FENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELENAFAAREIKSL 1405

Query: 1367 ANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLK 1426
            A+++K+DL K+TFLS DVSQQFGINLHMYA+L V +++ KIL+CD+DFL + SVI+FL +
Sbjct: 1406 ASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSR 1465

Query: 1427 PEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWAS 1486
            PEIV+VS NLARN+APY  +WEG+ +V++AK PEK+P ELQRADQ+YL++MVNLQ YW S
Sbjct: 1466 PEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGS 1525

Query: 1487 RMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAH 1546
            RMRALKVITT+EKEY++LLTKLR +D+AVSS+Q S+NL++VF VILAVGNYMND+SKQA 
Sbjct: 1526 RMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQ 1585

Query: 1547 GFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAA 1606
            GFKLATLQRLTFIKD  N+MTFLNYVEKI+R NY  FN FL ELEPVLDVVKIS+EQL  
Sbjct: 1586 GFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVD 1645

Query: 1607 DCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLM 1666
            DC+EFSQ+IVNVERSIE+GNLSDSSKFHP+DRVL KVLP LP+ARK+ +LL DEVKLT+M
Sbjct: 1646 DCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIM 1705

Query: 1667 EFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKKMVEEQ 1726
            EF  LMQ++GED                 I EYKKAQ  N+++          KKMVEEQ
Sbjct: 1706 EFLRLMQIYGEDSGDKFAKNSFFKKFADFITEYKKAQTQNLRLEEEEKVYERHKKMVEEQ 1765

Query: 1727 HKRARLEAEKGGVDDGSEAEGVTAVSRGE-RDVMDKLLEKLKNAGP-GKSDPSSXXXXXX 1784
             ++A+ EAE   V+ G++         G+ R +MD LLE+LKN  P  K+DPSS      
Sbjct: 1766 QRKAQ-EAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSARKRAL 1824

Query: 1785 XXXXXXDGKRSSANILDNFEVDEAAPVNQSLVYSPE------TTLKAANAA-HAESPTPK 1837
                      S++NIL + + ++      S++YSP+      TT+  AN    +E     
Sbjct: 1825 VRKKLMG--ESTSNILKDIDTED-----DSIIYSPDAKKPMATTVDMANTTLESELDVSS 1877

Query: 1838 ASRQGSVAGSGATATPLLESPSKQASAGPEDVADRARNLLKELRGPES-EKRKPLLEDHR 1896
             +R  S        +P+    S       E++ +RA+ LL +L G  S  KR  LL +H+
Sbjct: 1878 PTRHNS--------SPIKNEISMNVDEEEEEIGNRAQALLIQLTGSHSPTKRHSLLNEHK 1929

Query: 1897 EKMRARRRR-VNEGASSENKLVFVG 1920
            E++RARRRR  NE  S   KL FVG
Sbjct: 1930 ERLRARRRRTTNEFVSG--KLQFVG 1952

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/847 (42%), Positives = 522/847 (61%), Gaps = 63/847 (7%)

Query: 301  PDYYVRKIISDKISTKQLKDLWVSLRTEQLDWVVGFLDAQGQVAIANVLLRFFHKESPDA 360
            P  YV+KIISD ++++++KDLWV+LRTEQLDWV  F++ QG +A+ANVL++  +K +P+ 
Sbjct: 338  PIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMKSIYKTTPNE 397

Query: 361  LLNDEALDKEFAFFKCLKTLLNLKEGANEAVRTKLVVSAITDGLLSLRISTRRIASEMLV 420
             L  + L+KE +FFKC + L  L +G  E  + +L+   I  GL S  +STR++A+E+ V
Sbjct: 398  KLTSQLLEKENSFFKCFRVLSMLSQGLREFTKHELMAQTIARGLFSTTLSTRKMATEIFV 457

Query: 421  FITQWDIPYGLNQVIGELDQESHVSSNVHLQARLLSANKRDSLLAQDHELDLTRDHASKK 480
             +     P     ++  LDQ+  +  N+H+   L    +    L  D  L +TR      
Sbjct: 458  CMLNKKNPERFKVILNVLDQKFKIGQNLHMAHNLKKFGEYFGPLTLDSNLKVTR------ 511

Query: 481  FEQWLFVVEYTLDGRGKMGSLVGASEDFKSAGGENAILEYGYLTLLLVNQLCNTPADVNQ 540
               WLF VE++LDGRGKMGS VGAS+D+K++GGENA LEY   +++ +N LC    ++NQ
Sbjct: 512  --AWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWSMIFINHLCLCSDNINQ 569

Query: 541  RTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTADDYNTIMASKSINHNVDMEN 600
            R LLR++ + CG+ RIM +++ L+Y+K+ EQ+ ++E+   DD N ++   + N N+++ +
Sbjct: 570  RMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDINKLLELSNKNANINLHD 629

Query: 601  PLSLLQNLWESYKGTGAEKYLVSLVQHLFIASSKVQDEGDDPTEASKQLKLIDSLVSNVT 660
            P SL++NLW++ KGT  EK L+SLVQHLF++SS++ ++  D T+ SKQLKL+DSLV+NV+
Sbjct: 630  PTSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIEDKQDATQLSKQLKLMDSLVTNVS 689

Query: 661  MSSIDTESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEVKAERDYLGEKLSKAEG 720
            ++S D ES+ N AIQRLYD+MQTDEVARR+I+E+R LT+K EE +AE D L +KL  AE 
Sbjct: 690  VASTDQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEESQAEIDLLSQKLKNAEH 749

Query: 721  GLVGQLQNELSQRDRILEKNQRVTEQLQADXXXXXXXXXXXXXXXXXXXXXXXTILNSRP 780
            GLVGQLQ+EL QRDR+  KNQR+TEQLQA+                       TILN+R 
Sbjct: 750  GLVGQLQDELRQRDRMFAKNQRITEQLQAELEDLKKKHLLEKHEQEVELRKMLTILNARS 809

Query: 781  QGSSAVQEEEAGTASSSAPGVLHADRKLAIQKALQDRLQQTKKDLTKESKRLGTTLGTTL 840
                   E+++       PG   + +K  IQK LQ+ L +TKKD T +SK    + G T+
Sbjct: 810  DKGEI--EKKSSKKHKRIPGSFESSKKQNIQKVLQEGLNRTKKDFTMDSK----SFGMTV 863

Query: 841  EPNRRLKLLRSRMEDIENEARELEMTNFADIQRQTVEEQTXXXXXXXXXXXXXDRAPKAK 900
            +PN+RLK LR +MEDIENEARELEMTNFA+ +++ +E                 +  K +
Sbjct: 864  QPNKRLKALRMQMEDIENEARELEMTNFAEFEKKKLE------PAPKIKKLKQKKQNKNE 917

Query: 901  KQVKEDQVRKLRELRQRLASVQKESNDVSKFNVEERINELFNDKKLSALDRLKELETKYK 960
            K+ ++D+++KL ELRQ LA++Q ESND+SKFNVEER+NELFN+K+ +AL RLKELETKYK
Sbjct: 918  KKEEDDKIKKLNELRQTLANIQNESNDISKFNVEERVNELFNEKRSTALQRLKELETKYK 977

Query: 961  GFGIDFQADPELSAMLSDAPPENHHAKDGQAHPSLDPKHLSRKIEEMSKIVDELTAFKKE 1020
             FGI+F  D ++S   +     ++       + SLDP     K++E+++I ++L   + +
Sbjct: 978  DFGINFNID-DISEKTTGI---DNSGDKSTEYSSLDPNAYQIKLDELNRITEQLLDAQAK 1033

Query: 1021 IE----------------------NGPPXXXXXXXDEE----LEQDDR---ASIHSGNAS 1051
            +                       +          DEE    ++  DR    S  S +++
Sbjct: 1034 LNEKNLKDSSNKSTFSESSSSSSSSSSSSSSSSSSDEEEIDDIKSRDRQSEISAQSTSSA 1093

Query: 1052 TGSFLETLSQKYGTGQNAGPTASSRAMVGRESNYPGRGYHRRSFMERVKKSDAAP-FLSE 1110
             GSFLE LSQKY  GQN  P++  R    + S Y         F+ RV+K++  P FL E
Sbjct: 1094 AGSFLEALSQKYAMGQN-NPSSPQRDRPVKASQY--------DFINRVRKNNITPQFLEE 1144

Query: 1111 LTQKVAP 1117
            L+ KV P
Sbjct: 1145 LSGKVVP 1151

 Score =  151 bits (381), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 105/207 (50%), Positives = 130/207 (62%), Gaps = 14/207 (6%)

Query: 27  LFSNLKKL----TGSGNNAN--TSNKIEPSDI---SSPKIVSTPAVPEFSGKPLSKQTTL 77
           LF NLK+     TGS NN +  TSN  EPS +   S P+  ++        KPL K TTL
Sbjct: 28  LFQNLKRFATNSTGSSNNTSPRTSNSSEPSQVKRESIPQGSTSSLHSSNEIKPLIKNTTL 87

Query: 78  NTQNLSSYVD-MNTPHHNRSPSGMSGSPTKYSYSRRSSQWSNGNNIGNGGRLSRQQTNQS 136
           NTQNLS Y++  N P H+RS S  S S   YS  R SSQ    N    G +L RQ TNQS
Sbjct: 88  NTQNLSQYINSKNIPDHSRSQSIQSSSKYSYSSRRASSQ---TNPSVTGYKLDRQYTNQS 144

Query: 137 LSSASIFSQGSMTNLTKFMGADGKVKLDRPSNPQEIEDLFAELMHKRNFFQSLPAAGQKE 196
            S+ S+ SQGS +NL+KFM  DGK+ L+ P++P EIE L+ E+M KRN  QSLP   Q E
Sbjct: 145 -SAVSVLSQGSYSNLSKFMTHDGKLNLEMPTDPSEIEYLYQEIMIKRNILQSLPGTKQDE 203

Query: 197 LMNYDLDKKWLLVKQDLQSELKKLANK 223
           LM+YD+ KKWL+VKQDLQ+E KK  +K
Sbjct: 204 LMSYDIGKKWLIVKQDLQNEWKKFKSK 230

>Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 1930 aa]
            {ON} (137817..142124,142127..143611) [5793 nt, 1931 aa]
          Length = 1930

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/683 (51%), Positives = 456/683 (66%), Gaps = 57/683 (8%)

Query: 1308 ERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEKAFAAREIKLLA 1367
            +R PRP+KKLKQLHW+K++ T +SIW    AE++ADDLYE+GVL  LEKAFAAREIK + 
Sbjct: 1269 DRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDLYEKGVLRNLEKAFAAREIKSIG 1328

Query: 1368 NRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLKP 1427
             R+KEDL+K++FLS D+SQQFGINLHMY +L+V E++ K+L+CD++ + + SVI+FL K 
Sbjct: 1329 TRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIEFLAKS 1388

Query: 1428 EIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQL-YLEM------MVNL 1480
            EIVEVS NLARN+APY+T+WEGV S+   K         QR  Q+ Y E+      MVNL
Sbjct: 1389 EIVEVSVNLARNYAPYTTDWEGVKSLKMQK--------FQRRIQMTYRELIKFIYNMVNL 1440

Query: 1481 QGYWASRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMND 1540
            Q YWASRMRALKVIT+YE+EY++L+TKLR +DKAV ++Q S+NL++VF VILAVGNYMND
Sbjct: 1441 QSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMND 1500

Query: 1541 SSKQAHGFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKIS 1600
            +SKQA GFKL+TLQRLTFIKD  NSMTFLNYVEKI+R+NY  FN F+ +LEPVLDVVK+S
Sbjct: 1501 TSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLS 1560

Query: 1601 VEQLAADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDE 1660
            VEQL +DC EFSQ+IVNVERS+E+GNLSDSSKFHP D+VL KVLPVLPEA K+S LL+DE
Sbjct: 1561 VEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDE 1620

Query: 1661 VKLTLMEFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXK 1720
            VKLT+MEF+ LM+ +GED                 I EYKKAQ+ N+K           K
Sbjct: 1621 VKLTIMEFEALMKKYGEDAGDKFAKNSFFKKFADFITEYKKAQSQNLKQEEEERAYEKHK 1680

Query: 1721 KMVEEQHKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLKNAGPGKSDPSSXX 1780
            +M+EEQ  +  LE E+    +G   E  +      R +MDKLLEKLKNAGPGK+DPSS  
Sbjct: 1681 RMIEEQQHKQDLEEERSREVEGEPGEEQS----DRRAMMDKLLEKLKNAGPGKADPSSAR 1736

Query: 1781 XXXXXXXXXXDGKRSSANILDNFEVDEAAPVNQSLVYSPET-TLKAANAAHAESPTPKAS 1839
                        K  +A+IL + +  +      S+VYSP T T +  N  H  SPTP   
Sbjct: 1737 KRALVRKKLLTDKEVTAHILQDIDTGD-----DSIVYSPNTPTQEGPNDIHLASPTPSGK 1791

Query: 1840 RQGSVAGSGATATPLLESPSKQASAG----PEDVADRARNLLKELRGPESEKRKPLLEDH 1895
                +A           SP+K+++A      E ++DRA+ LL ELRG E+ KR   LE+ 
Sbjct: 1792 SDLVLASV---------SPTKESTADGIAEDEFISDRAKALLLELRGSENMKRNSQLEEQ 1842

Query: 1896 REKMRAR--RRRVNEGASSENKLVFVG--GASEAPTDSHKGLPNDTTADIPATPVSADDE 1951
            +EK++AR  RRR    + S NKL F      S +P++S KG   + T        +A++E
Sbjct: 1843 KEKLKARRSRRRTQTESISSNKLFFTDEESHSTSPSES-KGTEYEMT--------TANEE 1893

Query: 1952 PGS------GRAGDHDQALNAQE 1968
            P           G H++A N +E
Sbjct: 1894 PEEILNARITEEGPHEEAPNQEE 1916

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/872 (43%), Positives = 532/872 (61%), Gaps = 57/872 (6%)

Query: 265  GHNSTSSPILGGGGFYESGNQNSSTATLSQDPLHLSPDYYVRKIISDKISTKQLKDLWVS 324
            G +ST+S        Y+S   N S ++++ D ++  P +YV+KII+D+++++++ DLWV+
Sbjct: 296  GSSSTASGT--NSMIYQSSENNKSVSSIATDRINRPPIHYVKKIIADRLTSEEMNDLWVT 353

Query: 325  LRTEQLDWVVGFLDAQGQVAIANVLLRFFHKESPDALLNDEALDKEFAFFKCLKTLLNLK 384
            LRTEQLDWV  FL+ QG +A+ANVL+   +K +P + L  E  +KE +FFKC + L  L 
Sbjct: 354  LRTEQLDWVDAFLEHQGHIAMANVLMNTIYKCAPGSELTPELQEKEHSFFKCFRVLSMLS 413

Query: 385  EGANEAVRTKLVVSAITDGLLSLRISTRRIASEMLVFITQWDIPYGLNQVIGELDQESHV 444
            +G  E  + KL+   I +GL S R++TR++A+E+LV + +         V+  LD+    
Sbjct: 414  QGLYEFAKHKLMSDTIANGLFSSRLATRKMATEVLVCMIEKRNNMRFEVVLASLDRYFRQ 473

Query: 445  SSN---VHLQARLLSANKRDSLLAQDHELDLTRDHASKKFEQWLFVVEYTLDGRGKMGSL 501
              N   VHL   L     +            T +   K  + WL  ++ TL+GRGKMGSL
Sbjct: 474  EENLNMVHLSKTLPGEYPQS-----------TPNTKYKIIQAWLIALDETLNGRGKMGSL 522

Query: 502  VGASEDFKSAGGENAILEYGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLE 561
            VGAS+D++SAG ENAILEY   T++ +N LC+  + +NQR LLR++ ++ G  RIM KL+
Sbjct: 523  VGASDDYRSAG-ENAILEYCLWTMVFINHLCSNSSLLNQRILLRTKLENLGALRIMTKLK 581

Query: 562  LLNYDKIDEQLRIFEDRTADDYNTIMASKSINHNVDMENPLSLLQNLWESYKGTGAEKYL 621
             L+Y+K+ EQ+ ++++   DD+NT++ ++S N  V+M+NP SL++NLWES KG+  EK L
Sbjct: 582  RLDYEKLTEQIELYDNNKLDDFNTVLETESKNSKVNMQNPNSLIENLWESCKGSDNEKLL 641

Query: 622  VSLVQHLFIASSKVQDEGDDPTEASKQLKLIDSLVSNVTMSSIDTESSFNGAIQRLYDSM 681
            +SL+QHL+++SSK+  E +DPT+ SKQLKLIDSL++NV  S  D ES  N AIQRLYDSM
Sbjct: 642  LSLIQHLYLSSSKLMGEKEDPTKLSKQLKLIDSLLTNVNGSMFDEESHMNLAIQRLYDSM 701

Query: 682  QTDEVARRAIMEARELTRKFEEVKAERDYLGEKLSKAEGGLVGQLQNELSQRDRILEKNQ 741
            QTDEVARRAI+E+R LT+K EE  AERDYL  KLS AE GLVGQL+++L QRD ILEKNQ
Sbjct: 702  QTDEVARRAILESRTLTKKLEEAHAERDYLSNKLSNAENGLVGQLESDLKQRDNILEKNQ 761

Query: 742  RVTEQLQADXXXXXXXXXXXXXXXXXXXXXXXTILNSRPQGSSAVQEEEAGTASSSAPGV 801
            RV +QL+++                       TILNSR            GT +     V
Sbjct: 762  RVMKQLESELEDLKKKHLLEKHEHEVELRKMLTILNSR-----------NGTQNPDVDDV 810

Query: 802  ---LHADRKLAIQKALQDRLQQTKKDLTKESKRLGTTLGTTLEPNRRLKLLRSRMEDIEN 858
               L  ++KL IQKAL+  L +TKKDL+ +SKR     G T++PN+RLK+LR +MEDIEN
Sbjct: 811  TITLDPNKKLDIQKALELELNKTKKDLSNDSKR----FGITVQPNKRLKMLRMQMEDIEN 866

Query: 859  EARELEMTNFADIQRQTVEEQTXXXXXXXXXXXXXDRAPKAKKQVKEDQVRKLRELRQRL 918
            EAR+LEMTNFAD +R  +++                   +  K+  E + +KL +LR+ L
Sbjct: 867  EARQLEMTNFADHKRTNLKKPVIVKKEKKLRKKKKINTEEFDKE-NEMKTKKLMQLRKAL 925

Query: 919  ASVQKESNDVSKFNVEERINELFNDKKLSALDRLKELETKYKGFGIDFQADPELSAMLSD 978
            A++Q E+ND+SKFNVE R+NE+F DKKL AL RLK+LE KYK F I F    EL  +   
Sbjct: 926  AAIQSETNDISKFNVEGRVNEMFQDKKLKALQRLKQLEAKYKDFEIPFD---ELQDLDDR 982

Query: 979  APPENHHAKDGQAHPSLDPKHLSRKIEEMSKIVDELTAFKKEIENGPPXXXXXXXDEELE 1038
                     D Q H +LDP +L +KI E+ +I DEL     + +             E +
Sbjct: 983  E------LDDEQQHSTLDPTYLQKKINELDEISDELYLMNYDSDANNGNTSDSSSSSEAD 1036

Query: 1039 QDDRASIHS-------GNASTGSFLETLSQKYGTGQNAGPTASSRAMVGRESNYPGRGYH 1091
             D   S+ S       G +  GSFLE+LSQKYGTGQNA   +S  ++         +G  
Sbjct: 1037 GDGTDSMRSVSNAPSKGISEAGSFLESLSQKYGTGQNA--ISSPTSITSPNERIASQG-- 1092

Query: 1092 RRSFMERVKKSD-AAPFLSELTQKVAPKTPID 1122
             +SFM R+K+   AAPFL ELTQKV   + ID
Sbjct: 1093 EKSFMNRLKRQTMAAPFLEELTQKVNDTSSID 1124

 Score =  173 bits (438), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 132/195 (67%), Gaps = 28/195 (14%)

Query: 50  SDISSPKIVSTPAVP-EFSG---KPLSKQTTLNTQNLSSYV-----DMNTPH-------- 92
           +DISSPK    P VP +F+    +PL+K++TLNTQNLS YV     D + P+        
Sbjct: 43  ADISSPK---KPIVPKQFTSTELRPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTNNTS 99

Query: 93  HNRSPSGMSGSPTKYSYSRRSSQWSNGNNIGNGGRLSRQQTNQSLSSASIFSQGSMTNLT 152
           H R+ S  S S TKYSYSRRSS  +         +LSRQQT QSL S+S+ SQGS TNL 
Sbjct: 100 HTRAHS--SQSATKYSYSRRSSTATGP------IKLSRQQTTQSLGSSSVLSQGSYTNLL 151

Query: 153 KFMGADGKVKLDRPSNPQEIEDLFAELMHKRNFFQSLPAAGQKELMNYDLDKKWLLVKQD 212
           K++ +DGK+ L+ P +P E+E LF +LM+KRN FQ+LP   QKELM+YD+ KKW LVKQD
Sbjct: 152 KYIDSDGKINLEMPRDPHEVEALFEDLMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQD 211

Query: 213 LQSELKKLANKKNTH 227
           LQ+E+KKL +K +++
Sbjct: 212 LQNEIKKLMSKSSSY 226

>NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717
          Length = 1314

 Score =  298 bits (762), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 164/466 (35%), Positives = 265/466 (56%), Gaps = 28/466 (6%)

Query: 1311 PRPK----KKLKQLHWEKIEDTGNSIWKDAKA-EKYADDLYERGVLAQLEKAFAAREIKL 1365
            P PK    KK+KQ+HWEKIED  N+ W + +  E+   +L   G+  Q+E  F  + + +
Sbjct: 810  PVPKLSETKKIKQIHWEKIEDIENTFWDNEQEREETVTELRHMGIFKQIEDIFKMKNVSV 869

Query: 1366 LANRRK---EDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVID 1422
            +  ++K        ++FLSRD++QQFGINLH++  LS  E+V K+LRCD D L + SV++
Sbjct: 870  IMKKKKVVSSSTELISFLSRDLAQQFGINLHIFVQLSEDELVSKVLRCDDDILENVSVLE 929

Query: 1423 FLLKPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQG 1482
            F  K E+  ++ +L R+  PYST++    SV     P K+P ELQRAD+++L++  NL+ 
Sbjct: 930  FFCKEEMTHINPSLVRHLTPYSTDYMNPESV-----PTKNPDELQRADKIFLKLSFNLRS 984

Query: 1483 YWASRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSS 1542
            YW  R + L ++ TYEK+Y DLL KL+ ID A+  I HS+  +++  +I+ +GN+MN  +
Sbjct: 985  YWNERSQCLLLLCTYEKDYYDLLYKLQKIDDALQRIYHSERFKNLLYIIVEIGNFMN--T 1042

Query: 1543 KQAHGFKLATLQRLTFIK-DEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISV 1601
            +   G +L+ L +L FIK +  N+++FL+Y+E++IR +YA+   F+ +L  V ++ KIS+
Sbjct: 1043 RPVSGIRLSALNKLAFIKSNNDNNVSFLHYIERVIRIHYADVYGFIDDLHKVEELGKISM 1102

Query: 1602 EQLAADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEV 1661
            +Q+A  C EF   I  +  +I  G LSD  K HP D++L KV   +  AR + +LL D  
Sbjct: 1103 DQVALQCEEFCSKIDKMVFNITKGKLSDPLKLHPDDQILKKVKYKINRARTKGELLGDHF 1162

Query: 1662 KLTLMEFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKK 1721
            KL+  +F+ +M+ +GED                    +KK    N++           KK
Sbjct: 1163 KLSNNDFEKVMRYYGEDPTDVESKSVFFQTFVEFSTLFKKCAKENMEREEAERVYAQRKK 1222

Query: 1722 MVEEQHKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLK 1767
            ++E   ++         VD G++         GE   +D LL +L+
Sbjct: 1223 IMEASTRK------DSDVDSGTDNID------GENTAVDSLLAQLR 1256

 Score = 47.8 bits (112), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 88/402 (21%), Positives = 172/402 (42%), Gaps = 93/402 (23%)

Query: 368 DKEFAFFKCLKTLLNLKEGANEAVRTKLV---------VSAITDGLLSLRISTRRIASEM 418
           D  + F +C KT++N     N  +R  ++          S ++    SLR   R  AS++
Sbjct: 226 DDLYVFLRCFKTMMN-----NADIRISMLDYPELLSYLCSLVSSESTSLR--CRLQASDI 278

Query: 419 LVFITQWDIPYGLNQVIGELDQESHVSSNVHLQARLLSANKRDSLLAQDHELDLTRDHAS 478
           L+ +T  D   G   V  +L    H++  +   ++LLS+ +  +    D        +AS
Sbjct: 279 LLLLTYIDNHSGYEVVWKQL--RPHIAEWLTNSSKLLSSPEEATTEVNDV-------NAS 329

Query: 479 KKFEQWLFVVEYTLDGRGKMGSLVGASEDFKSAGGENAILEYGYLTLLLVNQLCNTPADV 538
             F               KM  L+                +Y    L L+N +       
Sbjct: 330 LFF--------------PKMDMLIS---------------DYFSSMLFLINSIVQGFQSF 360

Query: 539 NQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTADDYNTIMASKSINHNVDM 598
             +  + +  K   +  ++  LE ++ + I EQ+++F+D   +    I+   S    V +
Sbjct: 361 TTKKNILAELKRSEVYTLLYLLEDIDCNVIQEQVKLFKDTEEN----ILEVTSRESGVHI 416

Query: 599 ENPL-SLLQNLWESYKGTGAEKYLVSLVQHLFIASSKVQDEGDDPTEASKQLKLIDSLVS 657
           ++P  S+LQ L      T  E  + SL+  +  + +K        +E+SK L+ ++S + 
Sbjct: 417 DSPYGSILQQLTNLTSNTQLEPQINSLLDLILKSVNK-----KTYSESSKLLQFMESFLQ 471

Query: 658 NVTMSSIDT---------ESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEVKAER 708
                S+D          E+ F  ++  L DS+Q+DE+A+RA++E        +E +++ 
Sbjct: 472 ----YSLDNSNHNHYEHPETLFQESVNNLMDSLQSDEIAKRAMLE-------LDEKQSQM 520

Query: 709 DYLGEKLSKAEGGLVGQLQNELSQ-RDRILEKNQRVTEQLQA 749
           + L  +L+K        L+NE +  +  IL++ ++VT+ L++
Sbjct: 521 NILSNQLTK--------LRNEKTMDKSDILDQLKQVTDLLES 554

>CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] {ON}
            similar to uniprot|P40450 Saccharomyces cerevisiae
            YIL159w BNR1
          Length = 1294

 Score =  292 bits (748), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 161/465 (34%), Positives = 270/465 (58%), Gaps = 33/465 (7%)

Query: 1311 PRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEKAF----AAREIKLL 1366
            P+   +LKQ+HWEK++D G ++W+D       D L + GV +Q+EK F      ++ K+L
Sbjct: 816  PKSTIRLKQIHWEKVDDVGGTLWEDVSGIP-LDHLKDEGVFSQIEKYFKILEPVKKTKVL 874

Query: 1367 ANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLK 1426
            A    +   K++FL+RD++QQFGINLHMY+ LSV+E V K+L+C+ D + + SV+ F  K
Sbjct: 875  AENENKP-TKISFLTRDIAQQFGINLHMYSQLSVEEFVTKVLKCEDDLIQNVSVLGFFTK 933

Query: 1427 PEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWAS 1486
             ++ ++ + L R FAPYST +    S      PEKDP EL+RAD +YLE+  NL+ YW++
Sbjct: 934  EDLTQIPSGLERKFAPYSTNYLTDDS------PEKDPRELERADHIYLELFYNLRSYWSA 987

Query: 1487 RMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAH 1546
            R   L V+TTYE++Y DL+ KL  ID+A+  +  S  ++ +  +I  +GNYMN  S    
Sbjct: 988  RSHCLLVLTTYERDYFDLMYKLEKIDEAIQRLYDSTRIKKLLLIIREIGNYMNKGS--VT 1045

Query: 1547 GFKLATLQRLTFIK--DEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQL 1604
            G KL +L +L+F+K   EKN ++FL++VE+++RE++ +  +F +++  V D+ K+++E +
Sbjct: 1046 GIKLNSLPKLSFVKSSSEKN-ISFLHFVERVVRESFPDVYTFTEDIAKVEDLGKVTLEHV 1104

Query: 1605 AADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLT 1664
              +C EF++ + +V  S+  G LSD +K HP D +  K+   +  A+ +S+LL ++ +LT
Sbjct: 1105 ELECEEFAEKVGSVVYSLTQGKLSDPTKLHPKDAIFTKMRYKINRAKSKSELLINQHELT 1164

Query: 1665 LMEFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKKMVE 1724
                + LM+ +GE+                    +KK    NI+           K ++E
Sbjct: 1165 KRSLNRLMKYYGEEPMDKESKNNFFNYFVEFAMVFKKCAKENIEREEVTRLYEQRKHLLE 1224

Query: 1725 EQHKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLKNA 1769
            +++K+     E+   DD             E + +D L+ KL++A
Sbjct: 1225 QRNKKIE---EQEHSDD-------------EINAVDDLITKLRDA 1253

>SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1335

 Score =  291 bits (744), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 160/457 (35%), Positives = 267/457 (58%), Gaps = 24/457 (5%)

Query: 1316 KLKQLHWEKIEDTGNSIWKDAKAEKYADD-LYERGVLAQLEKAFAAREI---KLLANRRK 1371
            KL+Q+HW+ IED   + W + +  K     L E GV  ++E+ F  ++    K    +  
Sbjct: 859  KLRQIHWDNIEDIRETFWSEEEERKEKSKELQELGVFEEIEELFRIKQPVPKKPNVAKTS 918

Query: 1372 EDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLKPEIVE 1431
            ++L KV+FLSRD++QQFGINLHM++  +V E+V K+L C+ + + + SV++F  K ++  
Sbjct: 919  QNLKKVSFLSRDLAQQFGINLHMFSNYTVHELVLKVLHCENEVVKNQSVLEFFNKEDLTN 978

Query: 1432 VSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWASRMRAL 1491
            +S ++ +NF PYST      +V   + P KD  EL+RAD+++LE+  NL+ YW +RMR L
Sbjct: 979  ISQSVKKNFEPYST------NVLTGEGPTKDVSELERADRIFLELCYNLRSYWRARMRCL 1032

Query: 1492 KVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAHGFKLA 1551
             ++ TYEK+Y D+L KL+ ID A  +I++S  L+ +  +I+ +GNYMN+  +QA G KL+
Sbjct: 1033 LILLTYEKDYYDILYKLQKIDDATRAIRNSKRLKELLFIIVEIGNYMNN--RQARGIKLS 1090

Query: 1552 TLQRLTFIK-DEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAADCRE 1610
            +L +L F+K    N+M+FL+Y+E+I+R  Y +    + +L  +  + K++V+Q+  DCRE
Sbjct: 1091 SLGKLAFVKASTNNNMSFLHYIERILRTKYMDLYGVIDDLSKISHLGKLTVDQVELDCRE 1150

Query: 1611 FSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLMEFDG 1670
            F++ I N+ERS + G+LS +  FHP D ++ K    +P A+++  LL D+ KLT+ + + 
Sbjct: 1151 FNERIDNMERSFKTGDLSKTQNFHPEDLIVSKTKHKIPIAKRKRSLLMDQCKLTMHDLEK 1210

Query: 1671 LMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKKMVEEQHKRA 1730
            LM   GE+                 +  +KKA   NI+           KK++E + +R+
Sbjct: 1211 LMTYCGEEPKDHNAKNTFFQNFIDFVSLFKKAARENIEKEEVERIYEQRKKLLEIK-ERS 1269

Query: 1731 RLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLK 1767
                E    D+ +E            D +D L+ KL+
Sbjct: 1270 CGNMESQNSDESAE----------NNDTVDVLIHKLR 1296

 Score = 64.7 bits (156), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/274 (21%), Positives = 128/274 (46%), Gaps = 23/274 (8%)

Query: 481 FEQWLFVVEYTLDGRGKMGSLVGASEDFKSAGGENAILEYGYLTLLLVNQLCNTPADVNQ 540
           + QW   +E  +       S++           +  + +Y   TL L+N +        +
Sbjct: 284 YSQWFSSIETAISSPK---SMLTQDTSVILPKPQQQLTDYCLSTLFLINSIIQVTTSYRE 340

Query: 541 RTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTADDYNTIMASKSINHNVDMEN 600
           + LL  +FK CG+ R+  K +      +D+++R +++   ++     +S  +   +D+  
Sbjct: 341 KELLIKKFKECGIHRMFYKTKDFGSGLLDDEIRKYKE--VEEEVITRSSPELPTFLDISY 398

Query: 601 PLSLLQNLWESYKGTGAEKYLVSLVQHLF-IASSKVQDEGDDPTEASKQLKLIDSLVSNV 659
             S+L+ L    + T  E  L  L++ +  I+ ++        +E+ K  KL  S++  +
Sbjct: 399 G-SILKTLILETRSTPLEHPLYQLLEGVLQISVTRTS------SESIKLFKLFHSILCYL 451

Query: 660 TMSSIDT------ESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEVKAERDYLGE 713
              + D+      ES+   ++ ++ DS+Q+DE+ARRA+ E   L    +++ AE + L E
Sbjct: 452 KDHTFDSDSGEGPESALKTSLNQMMDSLQSDEIARRAMKELNSLQETVDQLTAEVESLKE 511

Query: 714 KLSKAEGGLVGQLQ---NELSQRDRILEK-NQRV 743
           +    +G ++ QL+     L  +D  L++ N+R+
Sbjct: 512 ERKVTKGEVIMQLEEARESLRDKDETLKQLNERI 545

>Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} similar to
            Ashbya gossypii AGL364C
          Length = 1306

 Score =  285 bits (730), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 151/372 (40%), Positives = 231/372 (62%), Gaps = 15/372 (4%)

Query: 1314 KKKLKQLHWEKIEDTGNSIWKDAKAE-KYADDLYERGVLAQLEKAF----AAREI-KLLA 1367
            K KLKQ+HW+KI+D   ++W D K     + +L   GV  ++E+ F    AA ++   + 
Sbjct: 813  KVKLKQIHWDKIDDISKTVWSDDKERVSVSSELANFGVFKEIEELFKIVPAAPKVGNTMF 872

Query: 1368 NRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLKP 1427
              +     KVT LS D++QQFGINL++++  SV+E+V K+L CD + + + SVI+F  K 
Sbjct: 873  TAQNTRNGKVTLLSNDLAQQFGINLYIFSNYSVEELVEKVLLCDTEVMKNQSVIEFFSKD 932

Query: 1428 EIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWASR 1487
            +I  +  ++ R FAPY T +           PEKD   L RAD++YLE+  NL+ YWA R
Sbjct: 933  DINHIPQSIQRMFAPYETNYLT------GDKPEKDSRSLDRADRIYLELFYNLRSYWAPR 986

Query: 1488 MRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAHG 1547
             + L  + TYEK+Y D+L KL+ ID   ++I+ S  L+ +  +I+ VGNYMN+  KQA G
Sbjct: 987  AKYLLALLTYEKDYYDILYKLQRIDDGTTAIKTSKRLKPLLFIIIEVGNYMNN--KQALG 1044

Query: 1548 FKLATLQRLTFIKDEK-NSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAA 1606
             +L++L +L F K  K N+++F++ +E I+R NY + + F+ +LE +LDV  I V+ +  
Sbjct: 1045 IQLSSLNKLAFTKTSKDNNLSFIHVIESIVRLNYPDLHGFVNDLEKILDVSNIIVQHVQQ 1104

Query: 1607 DCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLM 1666
            + +EF + I  +ERS+ VG LSDSSKFHP D+ L+     +  A K++DLL  +  LT+ 
Sbjct: 1105 EAQEFYEKISTLERSLRVGVLSDSSKFHPKDKFLINTESNISHAMKKADLLKQQCTLTMG 1164

Query: 1667 EFDGLMQMFGED 1678
            EFD LM  +GED
Sbjct: 1165 EFDKLMVFWGED 1176

>Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] {ON}
            (35789..38224,38226..40265) [4476 nt, 1492 aa]
          Length = 1491

 Score =  280 bits (715), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 159/473 (33%), Positives = 261/473 (55%), Gaps = 29/473 (6%)

Query: 1311 PRPK--KKLKQLHWEKIEDTGNSIWK-DAKAEKYADDLYERGVLAQLEKAFAAREI---K 1364
            P+P+  K LKQ+HW+K+E+  N+IWK + +  +   +L    +  Q+E +F  +E+   K
Sbjct: 993  PKPQHVKNLKQIHWDKVENIDNTIWKYNLENREILKELEYGSIFNQVEDSFKIKEVVIKK 1052

Query: 1365 LLANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFL 1424
                + KE  N  +FLSRD++QQFGINLHMY+  + KE +  +L C  + + + SV++F 
Sbjct: 1053 SKTEKNKEKSNLKSFLSRDLAQQFGINLHMYSNYTEKEFLDLVLSCSDEVIKNISVLEFF 1112

Query: 1425 LKPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYW 1484
             K +++ +  +++RN+APYS ++         + P KD  EL+RAD+L+LE+  NL+ YW
Sbjct: 1113 CKEDLINIPGSISRNYAPYSRDYLS------GEEPVKDSSELERADKLFLELCYNLRYYW 1166

Query: 1485 ASRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQ 1544
            A R + L ++ TYE++Y DL+ KL+ ID A+  + +S   R    ++L +GNYMN   K 
Sbjct: 1167 ADRSQCLLLLYTYERDYYDLVFKLQKIDDAIQRLLNSQRFRDFLYIVLEIGNYMN--KKT 1224

Query: 1545 AHGFKLATLQRLTFIKDE-KNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQ 1603
              G K+++L +L FIK    N+++FL+++EK+IR  Y E   F+ +L  V D+ K+++E 
Sbjct: 1225 VEGVKISSLSKLAFIKSSSNNNISFLHFIEKLIRTRYPEVYGFIDDLTKVEDLGKVTLEH 1284

Query: 1604 LAADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKL 1663
            +  +C EF   + +V  S+  G LS S K HP D +L KV   +  A+ +S+LL D+  L
Sbjct: 1285 IGTECDEFCAKVNSVVYSVTNGKLSKSEKLHPNDSILKKVKYKVSRAKTKSELLKDQYNL 1344

Query: 1664 TLMEFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKKMV 1723
            T  +   L+  +GED                 +  +KK    NI+           K M+
Sbjct: 1345 TKHDVTKLLVYYGEDPKDKDSNDSFFSNILEFLSVFKKCAKENIEREESERVYEQRKNML 1404

Query: 1724 EEQHKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLKNAGPGKSDP 1776
            E Q K+     E  G+++  +        +   D +D LL KL+    GK +P
Sbjct: 1405 ESQSKK-----EGDGINEEDD--------KSTSDAVDLLLSKLRGV-EGKPEP 1443

 Score = 53.5 bits (127), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 120/276 (43%), Gaps = 28/276 (10%)

Query: 478 SKKFEQWL-FVVEYTLDGRGKMGSLVGASEDFKSAGGENAILEYGYLTLLLVNQLCNTPA 536
           S  F QWL  +  Y  +    + +    +   K  G +  I EY    L L+N +     
Sbjct: 315 SPHFNQWLKGMTAYLTNPEDLIENKNSENHYIKLIGFDKLIEEYLTTCLFLINSILQVVP 374

Query: 537 DVNQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTADDYNTIMASKSINHNV 596
           +  ++  L    K  G+  I   L+ L    I EQ+ I+     D   +I  + S+  +V
Sbjct: 375 NFERKYKLIENLKEFGIHHIFHLLKDLASTVIKEQISIYSKIEQDIILSISNNNSMFIDV 434

Query: 597 DMENPLSLLQNLWESYKGTGAEKYLVSLVQHLF-IASSKVQDEGDDPTEASKQLKLIDSL 655
              N + LL  L +S K T  E+ +  L+  L  I +S+ Q E          +KL  S 
Sbjct: 435 SYGNEIQLL--LSQSQK-TPLEQPIGELLNFLNKILTSRTQSES---------MKLFKSF 482

Query: 656 VSNVTM----------SSIDTESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEVK 705
            S +            + +  ES+   +I  L D +Q+DE+ARRA+ E + L +  + ++
Sbjct: 483 GSTLGYLLDHFYKDNDTLLSPESTVQNSINELMDRLQSDEIARRAMNEMKSLEQIIDNLQ 542

Query: 706 AERDYLGEKLSKAEGGLVGQLQNELSQRDRILEKNQ 741
           +E   L E+    +G L+ QL++   Q    +EKN+
Sbjct: 543 SEISSLKEERQLDKGELIAQLKSAHIQ----IEKNE 574

>TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1292

 Score =  277 bits (708), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 157/469 (33%), Positives = 258/469 (55%), Gaps = 31/469 (6%)

Query: 1312 RPKKKLKQLHWEKIEDTGNSIWKDA-KAEKYADDLYERGVLAQLEKAFAARE--IKLLAN 1368
            +PK+ LKQ+HWEK+ D   ++W D  + ++   +L   G+ +Q+E++F  +E  IK   N
Sbjct: 798  KPKEALKQIHWEKLNDIEETLWADQNQKDETMKELKRGGIFSQIEESFKVKERTIKQTKN 857

Query: 1369 R-RKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLKP 1427
            + ++E     +FL RDV+QQFGINLHM++  S ++ V K+L+CD + + +++ ++F  + 
Sbjct: 858  KDKREKTPTKSFLPRDVAQQFGINLHMFSQYSPEQFVLKVLQCDNEIIQNSTALEFFTRE 917

Query: 1428 EIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWASR 1487
            ++V V+ +L R F PYST++           P KDP EL R D+++LE+  NLQ YW  R
Sbjct: 918  DLVNVTQSLRRAFDPYSTDYLSEDG------PSKDPAELDRPDRIFLELCYNLQYYWYER 971

Query: 1488 MRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAHG 1547
               L  +TTYE++Y D + +L+ ID  +  ++H    +S+  +I+ +GNYMN   + A G
Sbjct: 972  SFCLFTLTTYERDYYDFIYRLQKIDDVIQKLRHGTRFKSILYIIVEIGNYMN--KRPAEG 1029

Query: 1548 FKLATLQRLTFIKD--EKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLA 1605
             KL++L +L F+K   +KN+ +FL+++E+IIR  Y +   F  +L  V D+ KIS++ L 
Sbjct: 1030 IKLSSLNKLAFVKSSVDKNT-SFLHFLERIIRVKYPDLYGFTDDLSKVEDIGKISLDHLE 1088

Query: 1606 ADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTL 1665
             +C EF   I  V  +++ G LSD S+ HP D ++ K+   +  A+ +SDLL D+ KL  
Sbjct: 1089 QECNEFRSKIDEVVHTLKEGKLSDHSRLHPKDLIVEKITYKIRRAKVKSDLLQDQFKLIN 1148

Query: 1666 MEFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKKMVEE 1725
            ++   LM  FGED                    +KK    NI+           K M+E 
Sbjct: 1149 IDLKKLMSHFGEDFNDSEAKNSFFQHFIEFSVNFKKCAKENIEREDSQRVYEQRKNMLES 1208

Query: 1726 QHKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLKNA--GPG 1772
            + + A         +  S+ +G       + D +D LL KL+     PG
Sbjct: 1209 RQRTAS--------NHNSDLQG------EDEDAVDVLLAKLRGTEEKPG 1243

 Score = 58.9 bits (141), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 77/362 (21%), Positives = 140/362 (38%), Gaps = 73/362 (20%)

Query: 352 FFHKESPDALLNDEAL---DKEFAFFKCLKTLLNLKEG----ANEAVRTKLVVSAITDGL 404
           F  +++   L  + +L   D  + + +C KTL+N K+G     N+          + D +
Sbjct: 197 FLERDNVKGLFQNSSLIGPDDFYVYLRCFKTLMNHKQGRLQILNKPPLLMFFCKLLNDDV 256

Query: 405 LSLRISTRRIASEMLVFITQWDIPYGLNQVIGELDQESHVSSNVHLQARLLSANKRDSLL 464
              R+  + +++EML+ +T  D  YG  +V+                             
Sbjct: 257 T--RLKCKVVSAEMLLMLTYVDEDYGYEKVL----------------------------- 285

Query: 465 AQDHELDLTRDHASKKFEQWLFVVEYTLD---GRGKMGSLVGASEDFKSAGGENAILEYG 521
                      H S  F+ W   +  TL       +  S +G          E    ++ 
Sbjct: 286 ----------HHLSPCFQGWFNYMAKTLSRDPSEFRDASFLGG------LKPEKCRADFM 329

Query: 522 YLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTAD 581
             +LL+VN +       +Q+  L    K CG+      ++ L  D  D+Q+ I+ +   +
Sbjct: 330 TTSLLVVNSILQALPTKDQKVSLMQTLKECGIHHCFHLIKQLQVDDTDKQIAIYLELETE 389

Query: 582 DYNTIMASKSINHNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQHLFIASSKVQDEGDD 641
                 A+  I+ +V    P   L  L    KGT  E+ L     HLF + +K+      
Sbjct: 390 LIEATSAADQIDDSV--YQP--ALHYLLSRTKGTLIEQDLA----HLFESLNKIL--ATR 439

Query: 642 PTEASKQL-----KLIDSLVSNVTMS-SIDTESSFNGAIQRLYDSMQTDEVARRAIMEAR 695
            T  S +L      ++D L+ N   + S +  S    +I +  D+++++E+ RRA+ E  
Sbjct: 440 TTSESIKLFRSLGSILDYLIDNFCQAVSTEPASLVQESINKFLDNLESEEIGRRAMKEMT 499

Query: 696 EL 697
           EL
Sbjct: 500 EL 501

>KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1283

 Score =  275 bits (702), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 149/481 (30%), Positives = 274/481 (56%), Gaps = 35/481 (7%)

Query: 1307 FERYPRPK-KKLKQLHWEKIEDTGNSIWKDAKAEK-YADDLYERGVLAQLEKAFAAREIK 1364
            F   P+P+ K LKQ+HW+KIED  +++W +        +DL E+GV  ++   F  + ++
Sbjct: 792  FVSKPKPEVKPLKQIHWDKIEDISDTLWNEPTTRSDLKEDLNEKGVFNEIVNLFEQKAVR 851

Query: 1365 L------LANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSA 1418
            +       A+++ E   KV+ LSRD++QQFGINLHM+++ SV++++ K+LRCD D + + 
Sbjct: 852  MKKKSNVTASKKNE---KVSLLSRDLAQQFGINLHMFSSYSVEDLLIKVLRCDDDIIKNH 908

Query: 1419 SVIDFLLKPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMV 1478
            SV++F  K +   +  ++ R+F PY+++W+        K P++D  +L+RAD++YLEM  
Sbjct: 909  SVLEFFNKDDFETIPQSIIRSFEPYASDWKT------GKAPKEDVSKLERADRIYLEMFY 962

Query: 1479 NLQGYWASRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYM 1538
            N++ YW  R  +L +  TYEK+Y D+L +L+ ID   S I++S+ L+  F +++ +GN+M
Sbjct: 963  NMRYYWKIRSSSLLIALTYEKDYYDILYQLQKIDDGTSMIKNSNRLKQFFYIVVEIGNFM 1022

Query: 1539 NDSSKQAHGFKLATLQRLTFIK-DEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVV 1597
            N+  K+  G KL++L +L+ +K +   +++FL+ +E+IIRE Y +   F ++L  + D+ 
Sbjct: 1023 NN--KKTQGIKLSSLNKLSMVKTNSDKNLSFLHVIERIIREKYPDIYDFTRDLNRLSDLG 1080

Query: 1598 KISVEQLAADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLL 1657
            KI++E + ++  E+ + I+ ++ S E G LS + K HP D+   K+   LP A ++++LL
Sbjct: 1081 KINIESIESEIHEYYEKIMRMKESFERGKLSHTEKHHPDDKFRKKISAKLPSAVRKAELL 1140

Query: 1658 SDEVKLTLMEFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXX 1717
             ++ KLT+ +F+  M+  GED                 +  + K    N +         
Sbjct: 1141 HNQCKLTMNDFNSTMKYCGEDPTNSEAKNTFFRNFSEFLTLFNKISQENKEREAMNRVHE 1200

Query: 1718 XXKKMVEEQHKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLKNAGPGKSDPS 1777
              ++++  Q      + EK   D+ +             D +D L++KL++  P ++ P 
Sbjct: 1201 QRQQLL--QKASTETQVEKSADDEAA-------------DTIDILIKKLRSVDPQQTIPG 1245

Query: 1778 S 1778
            S
Sbjct: 1246 S 1246

 Score = 48.1 bits (113), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 81/438 (18%), Positives = 180/438 (41%), Gaps = 102/438 (23%)

Query: 331 DWVVGFLDAQGQVAIANVLLRFFHKESPDALLNDEALDKEFAFFKCLKTLLNLKEGANEA 390
           D++  F++A G V+I N  +    K+S            ++ +  C K LLN     +  
Sbjct: 180 DFISLFVNANG-VSILNGFIDLLDKKS------------QYVYLCCYKALLNDTSARSVI 226

Query: 391 VRTKLVVSAITD--GLLSLRISTRRIASEMLVFITQWDIPYGLNQVIGELDQESHVSSNV 448
            +    ++ +    G L+  +  R +++++++ +T                         
Sbjct: 227 FQNNDWITYVFCLLGTLTTDLRVRLLSTQIVILLT------------------------- 261

Query: 449 HLQARLLSANKRDSLLAQDHELDLTRDHASKKFEQWLFVVEYTLDGRGKMGSLVGASEDF 508
                  S    DSLL     LDL        +E W+  VE TL             ED+
Sbjct: 262 ------YSTEWSDSLL---ESLDLC-------YESWIQAVEMTLRN----------PEDY 295

Query: 509 KSAGG------ENAILEYGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLEL 562
                      +  +++Y   TLLLV  +       + +     R+K  G+ R+ + ++ 
Sbjct: 296 AFNNSLILPKPKELLVDYSISTLLLVQSIQQLLPSNDLKLACFKRWKRAGIHRVFRLMKD 355

Query: 563 LNYDKIDEQLRIF---EDRTADDY--NTIMASKSINHNVDMENPLSLLQNLWESYKGTGA 617
           L+   +++ + ++   E +  D    N  ++  S    +         ++L E  K T  
Sbjct: 356 LDSSALNQDIDLYIELELKVQDKQFKNEFLSEISYGPQI---------KSLIEYTKDTPL 406

Query: 618 EKYLVSLVQHLFIASSKVQDEGDDPTEASKQLKLIDSLVSNVTMSSID-------TESSF 670
           E  + ++++ +    ++   EG     + K   + +S+++ +   ++D       TE  F
Sbjct: 407 ETPICNIIETILELVNERTTEG-----SIKLFYVFNSILTYLCEHTLDGSFDETNTEQVF 461

Query: 671 NGAIQRLYDSMQTDEVARRAIMEARELTRKFEEVKAERDYLGEKLSKAEGGLVGQLQNEL 730
             ++  + D++Q+ ++A+RA+ME  E  ++F+ ++ + D L +    ++G L+ +L+N  
Sbjct: 462 MTSLDHIMDNLQSHQIAKRAMMELDEKKKEFDGIQLQLDTLLQDKQVSKGDLLQKLEN-- 519

Query: 731 SQRDRILEKNQRVTEQLQ 748
             ++ +L+  +   E+LQ
Sbjct: 520 --KEELLKSREIRIEELQ 535

>AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1655

 Score =  275 bits (704), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 142/378 (37%), Positives = 232/378 (61%), Gaps = 21/378 (5%)

Query: 1311 PRPKKKLKQLHWEKIEDTGNSIWKDAKAE-KYADDLYERGVLAQLEKAFAAREIKL---- 1365
            P  + KLKQ+HW+KIE+   ++W D +     + +L   G+  ++E+ F   EIK     
Sbjct: 1160 PSTRIKLKQIHWDKIENIKETVWCDEQQRVSKSSELESLGIFKEIEELF---EIKPASTN 1216

Query: 1366 LANRRKEDL----NKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVI 1421
            LAN     L    ++++ LSR+++Q+FGINLH+++  +V+E+V K+L CD + + +  V+
Sbjct: 1217 LANATASLLKAKSSRISLLSRELAQEFGINLHVFSLYTVEELVDKVLSCDSEVMKNQGVL 1276

Query: 1422 DFLLKPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQ 1481
            +F  K E   V  ++ R F PY T +         + PEKDP EL+RAD++YLE+  NL+
Sbjct: 1277 EFFCKEEANNVPQSIQRLFGPYETNYL------TGERPEKDPAELERADRIYLELFYNLR 1330

Query: 1482 GYWASRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDS 1541
             YWA+R   L VI+T+E++Y D+L KL+ ID A  +IQ S+ L+ +F +I+ +GNYMN  
Sbjct: 1331 SYWAARSNYLLVISTFERDYFDILYKLQRIDDATKAIQSSNKLKELFFIIVEIGNYMNQ- 1389

Query: 1542 SKQAHGFKLATLQRLTFIKDEK-NSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKIS 1600
             K   G +L++L +L F K  K N+++F++ +E+I+R  Y   + F++ +  +  V  I 
Sbjct: 1390 -KPVQGIQLSSLNKLAFTKTIKDNNLSFIHVLERIVRTRYPSVHDFVEGINSITGVANII 1448

Query: 1601 VEQLAADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDE 1660
            V+ +  +  EF   I N++RS+  G LSD SKFHP DR L +    L +A+K++ LL D+
Sbjct: 1449 VQHVQQEAHEFCDRIANLDRSLASGKLSDPSKFHPKDRFLQRTDTKLAQAKKKARLLRDQ 1508

Query: 1661 VKLTLMEFDGLMQMFGED 1678
              LT+ +F+ LM  +GE+
Sbjct: 1509 CSLTISDFEKLMLYWGEN 1526

 Score = 42.4 bits (98), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 97/241 (40%), Gaps = 32/241 (13%)

Query: 479 KKFEQWLFVVEYTLDGRGKMGSLVGASEDFKSAGGENAILEYGYLTLLLVNQLCNTPADV 538
           + + +WL  VE T+    +          F++   +  +++Y   T+ L+N L       
Sbjct: 278 QHYSRWLAAVETTITDEAQW-----RRSPFRAQSPQQFMIDYCVSTMFLINALIQGMPSY 332

Query: 539 NQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTADDYNTIMASKSINHNVDM 598
             +       +  G+ RI  ++ + + +K D ++ + E      Y T      IN     
Sbjct: 333 QAKGKTIRLLRDAGIHRIFHRI-VSSGEKFDSEILLDE---ISKYQT--RETEINAKFVP 386

Query: 599 ENPLSLLQNLWESYKGTGAE-KYLVSLVQHLFIASSK--VQDE------GDDPTEASKQL 649
           E P S        Y    A+ K +VSL Q   + SS   V D            EA+K L
Sbjct: 387 ETPPS-------RYVSFAAQIKTIVSLTQGTSLESSMALVLDSIRQIITSRTSAEAAKLL 439

Query: 650 KLIDSLVSNVTMSSID-----TESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEV 704
           +L  S+   +   S D     TES    A+ +L D +Q+ +V +RA+ E      + E++
Sbjct: 440 QLFHSIFKYLIAHSYDREELGTESVLRAALNKLMDDLQSTQVNQRAVQELEAAHAQIEDL 499

Query: 705 K 705
           K
Sbjct: 500 K 500

>NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717
          Length = 1349

 Score =  274 bits (700), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 154/450 (34%), Positives = 255/450 (56%), Gaps = 14/450 (3%)

Query: 1314 KKKLKQLHWEKIEDTGNSIWKDAKAEK-YADDLYERGVLAQLEKAFAAREIKLLANRR-- 1370
            KKKLKQ+HW+KIE+  N++W  A   +    +L   G+  +++  F+ +++ +   R   
Sbjct: 856  KKKLKQIHWDKIENVKNTLWDHADGRQDTILELEHAGIFEKVQGMFSVQDLVVKPKRAVN 915

Query: 1371 -KEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLKPEI 1429
             +E    ++FLSRD SQQ  INLH++A L+ KEV+ K+L CD D + + SV++F  K E+
Sbjct: 916  VRESNKLLSFLSRDFSQQLAINLHIFAQLTEKEVLQKVLACDNDTIQNVSVLEFFCKDEM 975

Query: 1430 VEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWASRMR 1489
            V + +   R+F PYS ++     ++ ++ P K+P EL+RAD+L+L +  NL+ YWA R +
Sbjct: 976  VNIGSARIRHFTPYSADY-----LNASEQPAKNPDELERADKLFLYLPFNLRRYWAERSQ 1030

Query: 1490 ALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAHGFK 1549
             L VI+TYE+EY D+L  L+ ID A+ +I+HS+  ++   +I+ +GNYMN  +K   G +
Sbjct: 1031 CLLVISTYEREYYDMLYNLQKIDDALQNIRHSEKFKTFLYIIIELGNYMN--TKAVEGIR 1088

Query: 1550 LATLQRLTFIKDEKN-SMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAADC 1608
            L +L +L FIK   N + +FL++VEK++R +Y +   F+ +L  V D+ KI+++Q+   C
Sbjct: 1089 LNSLTKLAFIKSNDNKNFSFLHFVEKMLRIHYPDVYGFINDLNKVEDLGKITIDQVQLQC 1148

Query: 1609 REFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLMEF 1668
             E+   I  +  S+  G LSD ++ HP D++L KV   +  A+ +S+LL  + KLT  +F
Sbjct: 1149 EEYCTKIERIAHSVTKGKLSDPTQLHPDDQILRKVKYKVTRAKTKSELLQAQFKLTNNDF 1208

Query: 1669 DGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKKMVEEQHK 1728
               M  +GED                    ++K    NI+           KK+ E ++K
Sbjct: 1209 RKSMLYYGEDPDDTDNKINFFNQFVEFSSLFRKCARENIEKEEADRAYEQRKKIAELRNK 1268

Query: 1729 RARLEAEKGGVDDGSEAEGVTAVSRGERDV 1758
            +   E      D   E + V ++    RDV
Sbjct: 1269 KN--ERNDTVHDTSEEIDSVHSLLAQLRDV 1296

 Score = 46.6 bits (109), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 106/235 (45%), Gaps = 13/235 (5%)

Query: 517 ILEYGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFE 576
           + +Y    L L+N L      +  +  +    + C L +I+   E L+   I EQ++  +
Sbjct: 343 LCDYFCSNLFLINSLIQGFPTIPLKATILEEMRKCDLHQIIYLSEKLDSTSIQEQIKEIK 402

Query: 577 DRTADDYNTIMASKSIN-HNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQHLFIA-SSK 634
            +    Y+    S  +N   V     + LL       K T  E  L  L+  L  A +SK
Sbjct: 403 TQEETIYSRGYGSNHMNLPEVSYAPDIELL---ITKSKDTPVEDSLGKLLATLSKALNSK 459

Query: 635 VQDEGDDPTEASKQL--KLIDSLVSNVTMSSIDTESSFNGAIQRLYDSMQTDEVARRAIM 692
              E     +++  L   L+D+  +N    S+ +E+ F  A+ +L DS+ ++E+ +RA+ 
Sbjct: 460 TYSETIKIYKSTNSLVTYLMDNFQNN--QKSVASETLFQEAVTKLMDSLHSNEITKRAMS 517

Query: 693 EARELTRKFEEVKAERDYLGEKLSKAEGGLVGQLQNELSQRDRILEKNQRVTEQL 747
           E +EL +  + +  E D L E  +  +G ++     EL Q + ++E   R  E+L
Sbjct: 518 ELKELEKTVQSLNEEIDRLREINNMDKGDVL----EELKQANELIESRDRENEEL 568

>AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1260

 Score =  273 bits (697), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 147/404 (36%), Positives = 236/404 (58%), Gaps = 23/404 (5%)

Query: 1316 KLKQLHWEKIEDTGNSIWKDAKAE-KYADDLYERGVLAQLEKAFAAREIKLLANRRKEDL 1374
            KLKQ+HW+KI++   ++W +       +  L   GV  ++E  F      + A  +    
Sbjct: 771  KLKQIHWDKIDNIKETVWNEHNERISTSTKLETFGVFKEIEDLFKV----VPATPKTASS 826

Query: 1375 N---------KVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLL 1425
            N         K+  LS D++Q FGINLH+++  S +E++  +L C  + L +  VI+F  
Sbjct: 827  NSPTQTTRNGKIRLLSNDLAQLFGINLHIFSHYSTEELIDMVLLCHAEILQNQRVIEFFS 886

Query: 1426 KPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWA 1485
            K +I  +  +  R FAPY T +         KTP+KDP  L+RAD++YLE+  NL+ YWA
Sbjct: 887  KDDINHIPQSTQRMFAPYETNYLT------GKTPDKDPAVLERADRIYLELFYNLRSYWA 940

Query: 1486 SRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQA 1545
            +R + L V+ TYE++Y D+L KL+ ID A  +I+ S  L+ +F +I+ +GNYMN+  KQA
Sbjct: 941  ARSKYLLVLLTYERDYYDILYKLQRIDDATKAIRSSKKLKQLFFIIIEIGNYMNN--KQA 998

Query: 1546 HGFKLATLQRLTFIKDEK-NSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQL 1604
             G +L+++ +L F K  K N+++F++ +E+IIR  Y E ++F ++LE V D+  I V+ +
Sbjct: 999  LGIQLSSINKLAFTKTSKDNNLSFIHVIERIIRTRYPELHNFAEDLEKVQDMANIIVQHV 1058

Query: 1605 AADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLT 1664
              + +EF + I N+ERS+ VG LSDSS+FHP D+ L K    +  ARK+++LL D+  LT
Sbjct: 1059 QQEAQEFRERISNLERSLTVGALSDSSRFHPKDQFLSKTASSIQHARKKAELLIDQSTLT 1118

Query: 1665 LMEFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIK 1708
            + +F+ L+  +GED                 +  +KKA   NI+
Sbjct: 1119 MGDFEKLVSYWGEDTKDIQSRNTFFQKFLDFVALFKKASKENIE 1162

 Score = 35.0 bits (79), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 86/206 (41%), Gaps = 19/206 (9%)

Query: 517 ILEYGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKL----ELLNYDKIDEQL 572
           I++Y   T+ L+N +    A  + +  +       G+  I + +    + L+ + + +Q+
Sbjct: 311 IIDYCVSTMFLINSIVQGQATYSDKRKILVLLNDAGIHTIFRIILRSGDRLSSEILLDQV 370

Query: 573 RIFEDRTADDYNTIMASKSINHNVDMENPLSLLQNLWESYK-GTGAEKYLVSLVQHLFIA 631
             +  R A+  +       I      E  +  + +L +  + G    + + S++Q +   
Sbjct: 371 SKYRSREAEINSKCATEGQIEPEKTFETQIKTIISLTQGTELGCSMAQLVDSVMQIITFR 430

Query: 632 SSKVQDEGDDPTEASKQLKLI----DSLVSNVTMSSI-DTESSFNGAIQRLYDSMQTDEV 686
           +S          EA K L L+    D L+ N     +   E +   +I RL D +Q  +V
Sbjct: 431 TS---------AEALKLLNLLQATFDHLLENYHKEQMPSVEEALRSSISRLMDDLQAQQV 481

Query: 687 ARRAIMEARELTRKFEEVKAERDYLG 712
            RRA+ E  E+ +K  E+K     LG
Sbjct: 482 NRRAVQEMEEMKQKMIEMKETMRRLG 507

>Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to
            Ashbya gossypii AFR301C - AGL364C
          Length = 1454

 Score =  274 bits (700), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 152/470 (32%), Positives = 259/470 (55%), Gaps = 31/470 (6%)

Query: 1313 PKKKLKQLHWEKIEDTGNSIWKD-AKAEKYADDLYERGVLAQLEKAFAAREI-----KLL 1366
            PK KLKQ+HW+KI+D   ++W D ++    + +L   G+  ++++ F             
Sbjct: 958  PKLKLKQIHWDKIDDIKETVWCDQSQRVSKSTELASFGIFQEIDELFQLNPTSPAIANAT 1017

Query: 1367 ANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLK 1426
            AN  K    KV+ LSR+++Q+FGINLH+++  +V+E+  K+L CD + L + SVI+F  K
Sbjct: 1018 ANLLKAKSTKVSLLSRELAQEFGINLHIFSHYTVEELTSKVLNCDNEVLKNQSVIEFFCK 1077

Query: 1427 PEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWAS 1486
             EI  +  ++ + FAPYS  +         + P++DP EL RAD++YLE+  NL+ YW +
Sbjct: 1078 EEINNIPKSVQQLFAPYSANY------ITGEQPDRDPNELDRADRIYLELFYNLRSYWGA 1131

Query: 1487 RMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAH 1546
            R + L VI T++K+Y D+L KL  ID A  ++Q+S  L+ +F +I+ +GNYMN   +   
Sbjct: 1132 RSKYLLVILTFDKDYFDILHKLERIDDATKALQNSAKLKELFFIIVEIGNYMNQ--RPVA 1189

Query: 1547 GFKLATLQRLTFIKDEK-NSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLA 1605
            G +L++L +L F K    N+M+F++ +E+I+R  Y   + F++ L+ +L+V  I V+ + 
Sbjct: 1190 GIQLSSLNKLAFTKTSTDNNMSFIHVIERIVRRKYPSIHDFVEGLDKILEVQNIIVQHVQ 1249

Query: 1606 ADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTL 1665
             +  EF   I ++ER   +G LSD S+FHP D+ ++K    +  A+K++DLL D+  LT+
Sbjct: 1250 QEAHEFCDRIAHLERLTTIGILSDPSRFHPEDKFMLKTESKILLAKKKADLLKDQCTLTM 1309

Query: 1666 MEFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKKMVEE 1725
             +F+ LM  +GE+                 I  ++KA   N +           ++ +E+
Sbjct: 1310 SDFEKLMVYWGENPNNTNSKNSFFKKFIDFITLFRKAGKENSEREEMTRIYEKRRRALEQ 1369

Query: 1726 QHKRARLEAEK------GGVDDGSEAEGVTAVSRGERDVMDKLLEKLKNA 1769
                 R             +DDG++ E          D +D L++KL+N 
Sbjct: 1370 SASSQRQRRRASRLSTAASMDDGTQQE----------DAVDTLIKKLRNV 1409

 Score = 50.4 bits (119), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 105/235 (44%), Gaps = 24/235 (10%)

Query: 481 FEQWLFVVEYTLDGRGKMGSLVGASEDFKSAGGENAILEYGYLTLLLVNQLCNTPADVNQ 540
           + QWL  VE T+    +    V +++       +  +++Y   T+ L+N L         
Sbjct: 286 YTQWLEAVETTIKDETQWHDDVPSNQK-----PQQLMIDYCVSTMFLINSLIQGIPTYRG 340

Query: 541 RTLLRSRFKSCGLSRIMQKL----ELLNYDKIDEQLRIFEDRTADDYNTIMASKSINHNV 596
           ++ L    K  G+ RI  ++    E  + + + +++  ++ R  +  +  +     + NV
Sbjct: 341 KSRLIRLLKDAGIHRIFHRIVSSGEKFDSEILLDEISKYQSREGEINSKFVIDTPTHLNV 400

Query: 597 DMENPLSLLQNLWESYKGTGAEKYLVSLVQHLF-IASSKVQDEGDDPTEASKQLKLIDSL 655
             ++ +  +  L +   GT  E Y+  ++  +  I +S+         EA+K L+L  S+
Sbjct: 401 SFKSQIKTIVTLTQ---GTSLESYMTLVLDSIRQIVTSRTS------AEATKLLQLFQSI 451

Query: 656 VSNVTMSS-----IDTESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEVK 705
              +   S     + TE +   ++ +L D +Q+ +V +RA+ E  E+  K EE+K
Sbjct: 452 FKYLIEHSYEDEELGTEIALQASLNKLMDDLQSKQVNQRAVQELEEMKVKMEEMK 506

>Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W
            (BNR1) - involved in actin filament organization [contig
            159] FULL
          Length = 1389

 Score =  269 bits (687), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 161/477 (33%), Positives = 268/477 (56%), Gaps = 30/477 (6%)

Query: 1307 FERYPRPKKKLKQLHWEKIEDTGNSIWKDAKA-EKYADDLYERGVLAQLEKAF---AARE 1362
             ER  +  ++LKQ+HW+KIED   +IW + +     A  L E G+L ++   F    +  
Sbjct: 911  MERKEQDSQRLKQIHWDKIEDVKETIWNEEEGRHNVALHLEESGILDEISDLFKITPSAP 970

Query: 1363 IKLLANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVID 1422
             K    R  E+   +  L RD++QQFGINLHM++ LSV++ V K+L CD+  + + SV++
Sbjct: 971  TKANTGRLNEE-GPLAILPRDLAQQFGINLHMFSNLSVEDFVLKVLHCDRQIITNQSVLE 1029

Query: 1423 FLLKPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQG 1482
            F  + ++V + ++L+  F PYS+++         K P KD  +L+RAD+++L +  NL+ 
Sbjct: 1030 FFARDDLVNIPHSLSLKFEPYSSDFRL------GKGPLKDSSKLERADRIFLALCYNLRS 1083

Query: 1483 YWASRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSS 1542
            YW  R   L  + TYEK+Y D++ KL+ +D A++ I+ S  L+    +I+ +GNYMN   
Sbjct: 1084 YWRQRSICLLTLLTYEKDYFDIMYKLQRVDDAITMIKSSHKLKDALMMIVEIGNYMN--R 1141

Query: 1543 KQAHGFKLATLQRLTFIKDEKN-SMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISV 1601
            KQA G KL++LQ+L F+K  K+ +++FL+ VE+ +R        F+ EL  VLD+  + V
Sbjct: 1142 KQAPGIKLSSLQKLAFVKSSKDKNVSFLHVVERFLRVKCKATYGFVDELSKVLDLGNLVV 1201

Query: 1602 EQLAADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEV 1661
             Q+  D +E+ + I  V++S++ G LSDS  FHP DR+L+KV P +  A +++ LL ++ 
Sbjct: 1202 GQVEQDFQEYLKRIDAVKQSLDCGRLSDSESFHPEDRLLIKVGPKMAGAARKATLLQNQF 1261

Query: 1662 KLTLMEFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKK 1721
            KLT+   + LM+++GED                 I ++KKA   NI+           K+
Sbjct: 1262 KLTMRALENLMRLYGEDHKSVDCRNDFFHHFIQFIIQFKKAAKENIENEEVERIYNHRKE 1321

Query: 1722 MVEEQHKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLKNAGPGKSDPSS 1778
            +++++ K +         D  SE E        E D +D L+++L++    KS  SS
Sbjct: 1322 LLQQKTKAS------SKNDASSEEE--------EDDAVDILIQRLRDV--NKSSKSS 1362

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 63/289 (21%), Positives = 122/289 (42%), Gaps = 43/289 (14%)

Query: 471 DLTRDHASKKFEQWLFVVEYTLDGRGKMGSLVGASEDFKSAGGENAILEYGYLTLLLVNQ 530
           D+  +  + ++ QW   VE+ L    +  S    S    +A  +  + +Y   +L L+N 
Sbjct: 303 DVVIERLNYQYSQWFQFVEHLLTHGDQDCS---NSLMLPAARPQQMLRDYCLTSLFLINS 359

Query: 531 LCNTPADVNQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTADDYNTIMASK 590
           +    + V ++     R K   + R+ Q +  L + +ID ++        D Y      K
Sbjct: 360 ILQITSSVAEKLAYFKRLKELNIHRLFQLMHQLEHHEIDGEI--------DKY------K 405

Query: 591 SINHNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQH------------LFIASSKVQDE 638
           S+   V  +      Q L  SY      K+L +++              LF   SK    
Sbjct: 406 SLEEEVIQKTNPEFPQLLNVSYG-----KFLTNIIHQTHQNPLEHCMHQLFETLSKTL-V 459

Query: 639 GDDPTEASKQLKLIDSLVSNVTMSS-----IDTESSFNGAIQRLYDSMQTDEVARRAIME 693
               ++  K L L  S++  +   S     I+ +S  N ++  L D +Q+DE+A+RA+ E
Sbjct: 460 ARTMSDNLKVLTLFHSVIDYLKEYSYGEENINIDSVVNISLNHLVDGLQSDEIAKRAMSE 519

Query: 694 ARELTRKFEEVKAERDYLGEKLSKAEGGLVGQL---QNELSQRDRILEK 739
                ++ E +++E   L +     +GG++ +L   Q  L++++  +EK
Sbjct: 520 LELAQKEIENLESEIRALRKDKEITKGGVLSELRQTQQALAEKETAIEK 568

>ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1424

 Score =  268 bits (684), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 135/373 (36%), Positives = 223/373 (59%), Gaps = 14/373 (3%)

Query: 1312 RPKKKLKQLHWEKIEDTGNSIWKD-AKAEKYADDLYERGVLAQLEKAFAAREIKLLANRR 1370
            +PK+ LKQ+HWEKI+D   ++W+D  + E+   +L   G+  +++  F  +   +   + 
Sbjct: 848  KPKQSLKQIHWEKIDDVEKTVWEDNEQREETVKELEISGIFEKVQTTFQLKNSTVKKVKN 907

Query: 1371 KEDLNKVT----FLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLK 1426
                 K T    FLSRD++QQFGINLHMY+   V+E V K+LRCD D L + SV++F   
Sbjct: 908  DNSTKKTTQLKSFLSRDLAQQFGINLHMYSQYPVEEFVLKVLRCDNDILQNVSVLEFFNN 967

Query: 1427 PEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWAS 1486
             E+  +  +L+R+FAPYS +++      E K+P  DP EL+R D+++LE+  NL+ YW  
Sbjct: 968  EELTNIPASLSRSFAPYSADFQ------ENKSPTVDPNELERPDRIFLELCYNLRSYWRE 1021

Query: 1487 RMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAH 1546
            R + L +  TYE++Y DL+ KL++ID A+  I+++  L+ +  +I+ +GNYMN   K   
Sbjct: 1022 RSKCLLIFATYERDYYDLVYKLQNIDDAIQKIKNAFRLKQLLYIIMEIGNYMN--KKNVS 1079

Query: 1547 GFKLATLQRLTFIKDE-KNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLA 1605
            G +L +L +L+F+K    N+++FL+++EK++R  Y +   F  +L     +  IS + + 
Sbjct: 1080 GIRLNSLSKLSFVKSSVDNNLSFLHFIEKVVRVKYPDIYHFTDDLNKAEALGYISFDHIQ 1139

Query: 1606 ADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTL 1665
            ++C E+   + +V R    G LS  S  HP D ++ KV   +  A+ +S LL D+ KL  
Sbjct: 1140 SECEEYCSKVNSVVRMTTEGILSQQSNLHPKDEIMRKVKYKINRAKTKSQLLWDQYKLIS 1199

Query: 1666 MEFDGLMQMFGED 1678
             + D LM+ FGE+
Sbjct: 1200 ADLDKLMKYFGEN 1212

 Score = 53.9 bits (128), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 91/387 (23%), Positives = 164/387 (42%), Gaps = 60/387 (15%)

Query: 336 FLDAQGQVAIANVLLRFFHKESPDALLNDEALDKEFAFFKCLKTLLNLKEGANEAVRTKL 395
           FLD     A+A+      H+  P+          +F + +C KT++N  EG    +    
Sbjct: 247 FLDENHITALADCC----HRIQPN---------NQFVYLRCFKTIMNYAEGRQFILNCSH 293

Query: 396 VV----SAITDGLLSLRISTRRIASEMLVFITQWDIPYGLNQVIGELDQESHVSSNVHLQ 451
           +V    S + D    L+I  R ++ E+L+ +T  D   G  +V+  L     + S +  Q
Sbjct: 294 LVDYFCSLLNDKYTYLKI--RTLSCELLLLLTYVDDQLGYEKVLNHLS--PRLKSWLQ-Q 348

Query: 452 ARLLSANKRDSLLAQDHELDLTRDHASKKFEQWLFVVEYTLDGRGKMGSLVGASEDFKSA 511
             +  ++K D +L  D E   T+D++        F +++T                    
Sbjct: 349 VNISLSSKTDPILNSDMEKLYTQDNS--------FFLQFT-------------------- 380

Query: 512 GGENAILEYGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKL-ELLNYDKIDE 570
             E   +++   TL L+N +     D  ++  L  R K  G+ R    + + L  + IDE
Sbjct: 381 NTEQLRIDFASTTLFLINSILQALTDKQRKLQLVKRLKENGIHRCFYLMKDNLKNEIIDE 440

Query: 571 QLRIFEDRTADDYNTIMASKSINHNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQHLF- 629
           Q+ I+ + T        A K    ++   N L   +++  + K T  E+   +L+Q +  
Sbjct: 441 QIEIYIN-TEHVLIAQFADKPSLADLFYGNAL---ESIVANTKNTSLEQPFGTLIQSISE 496

Query: 630 IASSKVQDEGDDPTEASKQLKLIDSLVSNVTMS-SIDTESSFNGAIQRLYDSMQTDEVAR 688
           +  SK   E     +A   + +   L SN+  +   D ES F  +I  L D++++DE+A+
Sbjct: 497 MLKSKTTSESVKVLKAL--IIMFQFLESNLYNNMEFDPESVFQDSINTLVDNLESDEIAK 554

Query: 689 RAIMEARELTRKFEEVKAERDYLGEKL 715
           RA+ E   L      ++ E+  L EKL
Sbjct: 555 RAMGEINFLQDAVRSLQEEKGQL-EKL 580

>Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  266 bits (679), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 155/484 (32%), Positives = 261/484 (53%), Gaps = 44/484 (9%)

Query: 1311 PRP-KKKLKQLHWEKIEDTGNSIWKDA-KAEKYADDLYERGVLAQLEKAFAAREIKLLAN 1368
            P P +K+LKQ+HW+K+ED  +++W+D  + ++    L   G+ +Q+E  F  +    +AN
Sbjct: 870  PVPTEKRLKQIHWDKVEDIKDTLWEDGLQRQETIRGLQTDGIFSQIEDIFKMKSPTKIAN 929

Query: 1369 RRK---------------EDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKD 1413
            +                  +L K++FLSRD++QQFGINLHM++ LS  E V K+L+CD D
Sbjct: 930  KTSAISSTVLSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMKVLKCDND 989

Query: 1414 FLGSASVIDFLLKPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLY 1473
             + + +++ F  K E+V +  +L   + PYS    G           K   +LQRAD+++
Sbjct: 990  IVQNVNILKFFCKEELVNIPKSLLNKYEPYSRGENG-----------KAASDLQRADRIF 1038

Query: 1474 LEMMVNLQGYWASRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILA 1533
            LE+ +NL+ YW  R ++L  ++TYE++Y DL+ KL++ID  +S +  SD  +++  +I  
Sbjct: 1039 LELCINLRFYWNVRSKSLLTLSTYERDYYDLIFKLQNIDDGISHLNRSDKFKNLMFIITE 1098

Query: 1534 VGNYMNDSSKQAHGFKLATLQRLTFIKDEKN-SMTFLNYVEKIIRENYAEFNSFLQELEP 1592
            +GN+MN   +   G KL +L +L F++   + +M+FL+++EKIIR  Y +   F+ +L+ 
Sbjct: 1099 IGNHMN--KRIVKGIKLKSLTKLVFVRSSTDQTMSFLHFIEKIIRIKYPDIYGFVDDLKK 1156

Query: 1593 VLDVVKISVEQLAADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARK 1652
            V D+ KIS+E +  +C EF   I N+    + G LS+     P D+++ KV   +  AR 
Sbjct: 1157 VEDLGKISLEHIEIECHEFHNKIENLVTQFQTGKLSNEENLDPRDQIVKKVKFKINRARI 1216

Query: 1653 RSDLLSDEVKLTLMEFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXX 1712
            +S+LL D+ KLTL++ + LM+ +GED                 +  +KK    NI+    
Sbjct: 1217 KSELLMDQCKLTLIDLNKLMRYYGEDPNDKESKNEFFQPFIEFLTMFKKCAKENIEKEEM 1276

Query: 1713 XXXXXXXKKMVEEQHKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLKNAGPG 1772
                   K ++E +    +    K   +D +E E V        D +D L+ KL+     
Sbjct: 1277 ERVYEQRKNLLEMRTNGNK----KCDGNDENEGEEVNT------DAVDLLISKLREV--- 1323

Query: 1773 KSDP 1776
            K DP
Sbjct: 1324 KKDP 1327

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 123/270 (45%), Gaps = 50/270 (18%)

Query: 518 LEYGYLTLLLVNQLCNTPADVNQRTLL--RSRFKSCGLSRIMQKLEL-LNYDK----IDE 570
           ++Y    LLL+N +       N +T L   +  K   +  I+  LEL  N D     I E
Sbjct: 333 IDYSTTFLLLINSIL---QGFNNKTALDILNFLKKNNIHSIIAILELSYNNDPSSVVIME 389

Query: 571 QLRIFEDR----------TADDYNTIMASKSINHNVDMENPLSLLQNLWESYKGTGAEKY 620
           Q++ F+ +          T +D N +  +K+I  N + E P+ L + L    K +  E  
Sbjct: 390 QIKQFKAKETSIFDSMIQTRNDMNPLHPAKNIT-NPEGE-PVCLEKCLLLKAKDSPVETP 447

Query: 621 LVSLVQHLFIASSKVQDEGDDPTEASKQLKLIDSLVSNV-------TMSSID-------- 665
           +  ++  L+    K+ D     +E+ K LKL++SL+  +       T  S D        
Sbjct: 448 INEIIHSLW----KILDSQRPYSESIKLLKLMNSLLFYLIDSFQVPTNPSFDENIESAEN 503

Query: 666 TESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEV--------KAERDYLGEKLSK 717
            +S F  ++ +L DS+Q+DE+ARRA+ E  +L +K   +           +D+L +KL +
Sbjct: 504 ADSVFQDSVNKLLDSLQSDEIARRAVTEIDDLNKKISHLNEKLDLVENCSKDHLIKKLDE 563

Query: 718 AEGGLVGQLQNELSQRDRILEKNQRVTEQL 747
           +E  L+     E+      L+ N++  +Q+
Sbjct: 564 SE-ALISLKTKEIENLKVQLKTNKKKLDQI 592

>Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  263 bits (671), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 154/483 (31%), Positives = 257/483 (53%), Gaps = 43/483 (8%)

Query: 1311 PRPKKKLKQLHWEKIEDTGNSIWKDA-KAEKYADDLYERGVLAQLEKAFAAREIKLLANR 1369
            P P+++LKQ+HW+++ED  +++W+DA + ++   +L   GV +Q+E  F  R    +A++
Sbjct: 871  PSPERRLKQIHWDRVEDVKDTLWEDAFQRQETIRELQTDGVFSQIEDIFKMRSPAKIASK 930

Query: 1370 RK---------------EDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDF 1414
                              +L KV+FLSRD++QQFGINLHM++ LS  E V K+L CD D 
Sbjct: 931  NNAGSSTALSSNNGKSLNELKKVSFLSRDLAQQFGINLHMFSQLSDMEFVMKVLNCDNDI 990

Query: 1415 LGSASVIDFLLKPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYL 1474
            + + +++ F  K E+  +  +L   + PYS   EG           K   +LQRAD+++L
Sbjct: 991  IQNVNILKFFCKEELTNIPKSLLNKYEPYSQGKEG-----------KAVSDLQRADRIFL 1039

Query: 1475 EMMVNLQGYWASRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAV 1534
            E+ +NL+ YW  R + L  ++TYE++Y DLL KL+ ID  +S +  S   +++  +I  +
Sbjct: 1040 ELCINLRSYWNVRSKNLLTLSTYERDYYDLLFKLQKIDDGISHLNLSPKFKNLMFIITEI 1099

Query: 1535 GNYMNDSSKQAHGFKLATLQRLTFIKDEKN-SMTFLNYVEKIIRENYAEFNSFLQELEPV 1593
            GN+MN   K   G KL +L +L F++   + +M+FL+++EKIIR  Y +   F+ +L+ +
Sbjct: 1100 GNHMN--KKIVKGIKLKSLTKLAFVRSSVDQNMSFLHFIEKIIRIKYPDLYGFVDDLKKI 1157

Query: 1594 LDVVKISVEQLAADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKR 1653
             D+ KIS+E +  +C EF   I N+    + G LS      P D+++ KV   +  A+ +
Sbjct: 1158 EDLGKISLEHIELECHEFYNRIENLVTQFQTGKLSKEENLDPRDQIVKKVKFKINRAKIK 1217

Query: 1654 SDLLSDEVKLTLMEFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXX 1713
            S+LL  + KLTL++ + LM+ +GED                 +  +KK    NI+     
Sbjct: 1218 SELLMGQCKLTLIDLNKLMKYYGEDPSDKESKNDFFQPFIEFLAMFKKCAKENIEKEEME 1277

Query: 1714 XXXXXXKKMVEEQHKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLKNAGPGK 1773
                  K ++E +    +    K   +D +E E V        D +D L+ KL+     K
Sbjct: 1278 RVYEQRKSLLEMRTNNNK----KSNGNDENEGEEVNT------DAVDLLISKLREV---K 1324

Query: 1774 SDP 1776
             DP
Sbjct: 1325 KDP 1327

 Score = 50.1 bits (118), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 121/268 (45%), Gaps = 46/268 (17%)

Query: 518 LEYGYLTLLLVNQLCNTPADVNQRTLLR--SRFKSCGLSRIMQKLELLNYDK-----IDE 570
           ++Y    LLL+N +       N +T L+  S  K   +  IM  LE    D      I E
Sbjct: 334 IDYSMTFLLLINSIL---QGFNNKTALKIFSFLKKSNIHGIMATLESSYKDDSNNIVIME 390

Query: 571 QLRIFEDRTADDYNT-IMASKSINHNVDMEN-------PLSLLQNLWESYKGTGAEKYLV 622
           Q++ F+ + +  +++ I  S+ +     M+N       P+ +   L    K +  E  + 
Sbjct: 391 QIKQFKTKESSIFDSMIQTSRDMKATPSMKNVTEEEGAPVCIENCLLLKVKDSPIETPIN 450

Query: 623 SLVQHLFIASSKVQDEGDDPTEASKQLKLIDSLVSNVT-------MSSID--------TE 667
            ++Q L+    K+ D     +E+ K LKLI+SL+  +         SS D         +
Sbjct: 451 EIIQSLW----KILDSKKPYSESIKLLKLINSLLFYLIDSFQAPICSSFDENLDLAQNVD 506

Query: 668 SSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEVKAE--------RDYLGEKLSKAE 719
           S F  ++ +L DS+Q++E+ARRA+ E  +L  K  ++  +        +D+L  KL ++E
Sbjct: 507 SVFQDSVNKLLDSLQSNEIARRAVTEIDDLNNKILDLNEKLNLVENYSKDHLIAKLDESE 566

Query: 720 GGLVGQLQNELSQRDRILEKNQRVTEQL 747
             LV     E+      L+ N++  +Q+
Sbjct: 567 -ALVSLKTKEIESLKLQLKANKKKLDQI 593

>YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,
            nucleates the formation of linear actin filaments,
            involved in cell processes such as budding and mitotic
            spindle orientation which require the formation of
            polarized actin cables, functionally redundant with BNI1
          Length = 1375

 Score =  262 bits (669), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 149/483 (30%), Positives = 263/483 (54%), Gaps = 43/483 (8%)

Query: 1311 PRPKKKLKQLHWEKIEDTGNSIWKDA-KAEKYADDLYERGVLAQLEKAFAAREIKLLANR 1369
            P  +K+LKQ+HW+K+ED  +++W+D  + ++   +L   G+ +Q+E  F  +    +AN+
Sbjct: 872  PPTEKRLKQIHWDKVEDIKDTLWEDTFQRQETIKELQTDGIFSQIEDIFKMKSPTKIANK 931

Query: 1370 RK---------------EDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDF 1414
            R                 +L K++FLSRD++QQFGINLHM++ LS  E V K+L CD D 
Sbjct: 932  RNAESSIALSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMKVLNCDNDI 991

Query: 1415 LGSASVIDFLLKPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYL 1474
            + + +++ F  K E+V +  ++   + PYS   +G           K   +LQRAD+++L
Sbjct: 992  VQNVNILKFFCKEELVNIPKSMLNKYEPYSQGKDG-----------KAVSDLQRADRIFL 1040

Query: 1475 EMMVNLQGYWASRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAV 1534
            E+ +NL+ YW +R ++L  ++TYE++Y DL+ KL+ ID A+S +  S   +S+  +I  +
Sbjct: 1041 ELCINLRFYWNARSKSLLTLSTYERDYYDLIFKLQKIDDAISHLNRSPKFKSLMFIITEI 1100

Query: 1535 GNYMNDSSKQAHGFKLATLQRLTFIKDEKN-SMTFLNYVEKIIRENYAEFNSFLQELEPV 1593
            GN+MN   +   G KL +L +L F++   + +++FL+++EK+IR  Y +   F+ +L+ +
Sbjct: 1101 GNHMN--KRIVKGIKLKSLTKLAFVRSSIDQNVSFLHFIEKVIRIKYPDIYGFVDDLKNI 1158

Query: 1594 LDVVKISVEQLAADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKR 1653
             D+ KIS+E + ++C EF + I ++    +VG LS      P D+++ KV   +  A+ +
Sbjct: 1159 EDLGKISLEHVESECHEFHKKIEDLVTQFQVGKLSKEENLDPRDQIIKKVKFKINRAKTK 1218

Query: 1654 SDLLSDEVKLTLMEFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXX 1713
            S+LL  + KLTL++ + LM+ +GED                 +  +KK    NI+     
Sbjct: 1219 SELLIGQCKLTLIDLNKLMKYYGEDPKDKESKNEFFQPFIEFLAMFKKCAKENIEKEEME 1278

Query: 1714 XXXXXXKKMVEEQHKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLKNAGPGK 1773
                  K +++ +    +    K    D ++ E V       RD +D L+ KL+     K
Sbjct: 1279 RVYEQRKSLLDMRTSSNK----KSNGSDENDGEKVN------RDAVDLLISKLREV---K 1325

Query: 1774 SDP 1776
             DP
Sbjct: 1326 KDP 1328

 Score = 47.0 bits (110), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 108/243 (44%), Gaps = 49/243 (20%)

Query: 518 LEYGYLTLLLVNQLCNTPADVNQRTLLR--SRFKSCGLSRIMQKLELLNYDK-----IDE 570
           ++Y    LLL+N +       N +T L   +  K   +   +  LEL   D      I E
Sbjct: 333 IDYSTTFLLLINSILQ---GFNNKTALEILNFLKKNNIHNTITFLELAYKDDPNSVVIME 389

Query: 571 QLRIFEDR----------TADDYNTIMASKSINHNVDMENPLSLLQNLWESYKGTGAEKY 620
           Q++ F+ +          T +D N++  +K I   ++ E PL L   L    K +  E  
Sbjct: 390 QIKQFKSKESAIFDSMIKTTNDTNSLHPTKDIAR-IESE-PLCLENCLLLKAKDSPVEAP 447

Query: 621 LVSLVQHLFIASSKVQDEGDDPTEASKQLKLIDSLVSNVTMS-SIDTESSFN-------- 671
           +  ++Q L+    K+ D     +E+ K LKLI+SL+  +  S  + T  SF+        
Sbjct: 448 INEIIQSLW----KILDSQKPYSESIKLLKLINSLLFYLIDSFQVSTNPSFDETLESAEN 503

Query: 672 ------GAIQRLYDSMQTDEVARRAIMEARELTRKFEEVKA--------ERDYLGEKLSK 717
                  ++ +L DS+Q+DE+ARRA+ E  +L  K   +          ++D+L  KL +
Sbjct: 504 VDYVFQDSVNKLLDSLQSDEIARRAVTEIDDLNAKISHLNEKLNLVENHDKDHLIAKLDE 563

Query: 718 AEG 720
           +E 
Sbjct: 564 SES 566

>KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1367

 Score =  259 bits (663), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 150/473 (31%), Positives = 256/473 (54%), Gaps = 11/473 (2%)

Query: 1312 RPKKKLKQLHWEKIEDTGNSIWKDAKAEK-YADDLYERGVLAQLEKAFAAREI-----KL 1365
            +P KKLKQ+HW+K+ED  ++IW + +  +     L   GVL ++E  F  +E      K 
Sbjct: 867  KPVKKLKQIHWDKVEDIEDTIWHNEEIRRDTLKHLQHDGVLKEIESTFKIKEAGPIAKKS 926

Query: 1366 LANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLL 1425
             A         V+FLSRD++Q FGINLHM++ LSV E V K+L CD D + +  V++F  
Sbjct: 927  CATEGSASKKSVSFLSRDLAQAFGINLHMFSNLSVDEFVKKVLGCDNDIIKNVPVLEFFN 986

Query: 1426 KPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWA 1485
            + E+  +S++  R +APY  ++          T E  P  L+R D+++L++   L+ YW+
Sbjct: 987  REELGAISSSTLRKYAPYCVQYFPEPDASNHTTFEPLP-PLERGDEIFLKLCYVLRDYWS 1045

Query: 1486 SRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQA 1545
             R   L V+ TYEK+Y D++ KL+ ++ A+  ++ S  L++   +I+ +GNYMN  +K A
Sbjct: 1046 VRSHCLLVVCTYEKDYYDIVYKLQKLEDAMRRLKESTALQNFLYIIIEIGNYMN--TKAA 1103

Query: 1546 HGFKLATLQRLTFIKDEKN-SMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQL 1604
             G K+++L +L FIK   N +++FL+Y+E++IR  Y +   F+ +L+ V D+ K++++QL
Sbjct: 1104 SGVKISSLNKLVFIKSSDNKNLSFLHYIERLIRTKYPDIYRFVHDLKTVEDLGKLTLDQL 1163

Query: 1605 AADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLT 1664
              +C E+   I  +  +++ G LSD +K +P D VL K+      A  ++ LL  ++KL+
Sbjct: 1164 ELECSEYIGKIRKMGHAVKKGPLSDPAKLYPGDMVLKKIRFKAQRANSKAQLLESQMKLS 1223

Query: 1665 LMEFDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKKMVE 1724
              + + LM+ +GED                 +Q +KK    NI+           +K++E
Sbjct: 1224 SNDMNQLMKYYGEDPKDATTKNHFFTSFAEFLQLFKKCSRENIEREEMDRVYEQRRKLLE 1283

Query: 1725 E-QHKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLKNAGPGKSDP 1776
            + Q  R++         D +        +  E D +DKLL+KL+        P
Sbjct: 1284 DKQSSRSKSGKGNSAAADAAGGNEDDDENEDEEDAVDKLLDKLREVAKPVGKP 1336

 Score = 35.8 bits (81), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 87/199 (43%), Gaps = 14/199 (7%)

Query: 518 LEYGYLT--LLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIF 575
           L Y +L+  L L+N +      +N +  +    K  G+      L+ ++   +  Q++I+
Sbjct: 321 LVYDHLSTCLCLLNSILEASVALNVKYNILKSLKDAGIHNFFYSLDAIDSPLVFNQVKIY 380

Query: 576 EDRTADDYNTIMASKSINHNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQHLF-IASSK 634
           +++       I A+K+     ++    +L+  L E   GT  E  +  L Q L  I  ++
Sbjct: 381 KEKEEQALTKINATKNGPFLPNLVYGTTLML-LIEKSTGTPLEVSMGQLFQCLLDILENR 439

Query: 635 VQDEGDDPTEASKQL------KLIDSLVSNVTMSSIDTES---SFNGAIQRLYDSMQTDE 685
              E      A   L      K  DS   N T+  I  +S    FN + + L DS+Q+DE
Sbjct: 440 AYSESLRLFNAIIVLLTFFINKFTDS-TRNATLPRITDDSLKPMFNESFENLMDSLQSDE 498

Query: 686 VARRAIMEARELTRKFEEV 704
           VA RA+ +  E  +K  ++
Sbjct: 499 VAARAMDQLEESEKKVSQL 517

>KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1389

 Score =  257 bits (656), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 142/397 (35%), Positives = 238/397 (59%), Gaps = 16/397 (4%)

Query: 1316 KLKQLHWEKIEDTGNSIW-KDAKAEKYADDLYERGVLAQLEKAFAAREIKLLANRRKEDL 1374
            KLKQ+HW+K+ED   +IW ++ + +  A  L   G L ++ + F  R  + L  + K + 
Sbjct: 920  KLKQIHWDKLEDVSETIWSQEGERQDAARHLESSGFLDEIAELF--RVNQSLPIKAKSET 977

Query: 1375 ----NKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLKPEIV 1430
                +KV+ L RD++QQFGINLHM++ LSV E V+K+L CD+D + + SV++F  + ++ 
Sbjct: 978  SSGKDKVSILPRDLAQQFGINLHMFSNLSVDEFVNKVLHCDRDVVNNQSVLEFFAREDLS 1037

Query: 1431 EVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWASRMRA 1490
             +  ++A    PY+T+ +     +EA  P  D  +L+RAD+++LE+  NL+ YW  R   
Sbjct: 1038 IIPRSIASKLEPYATDHQP----NEA--PLLDREKLERADRIFLELCYNLRSYWRPRSLC 1091

Query: 1491 LKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAHGFKL 1550
            L  ++TYEK+Y DL+ KL+ +D A++ I++S  L+    +I+ +GNYMN   KQA G +L
Sbjct: 1092 LLTLSTYEKDYFDLIYKLQRVDDAINIIKNSAKLKDTLMMIIEIGNYMN--RKQAGGIRL 1149

Query: 1551 ATLQRLTFIKDEKN-SMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAADCR 1609
            ++LQ+LTF+K  K+ +M+ L+ VE+ +R        F+++L  VLD+  + V Q+  D  
Sbjct: 1150 SSLQKLTFVKSSKDKNMSLLHAVERFLRVKCRSAYGFVEDLSRVLDLGNLMVGQIEQDFH 1209

Query: 1610 EFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLMEFD 1669
            E++Q I  V++S+E G LS    FHP DR+L+KV P +  A +++ LL ++  LT+   +
Sbjct: 1210 EYTQRISGVKQSLEQGRLSKPENFHPEDRLLIKVGPKIAGATRKASLLRNQFVLTMRALE 1269

Query: 1670 GLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHN 1706
             LM+++GED                 + ++KK    N
Sbjct: 1270 NLMKLYGEDPSNIDSKNEFFQHFINFVSQFKKVAKEN 1306

 Score = 34.7 bits (78), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 38/62 (61%)

Query: 666 TESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEVKAERDYLGEKLSKAEGGLVGQ 725
            ES  + ++ +L D++Q+DE+A RA+ E +      +++ +E   L ++ S ++G ++ +
Sbjct: 492 VESVISVSLNQLVDNLQSDEIAERAMSELKTAQNSIDQLNSEIQILQKERSVSKGSILSE 551

Query: 726 LQ 727
           L+
Sbjct: 552 LE 553

 Score = 34.3 bits (77), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 50/110 (45%), Gaps = 15/110 (13%)

Query: 331 DWVVGFLDAQGQVAIANVLLRFFHKESPDALLNDEALDKEFAFFKCLKTLLNLKEGANEA 390
           D+  GFL + G   +A+VL  F  ++              +   +C KTL N +EG    
Sbjct: 213 DFSRGFLRSDGVARLADVLASFKREDM-------------YVCLRCFKTLANTEEGRLSV 259

Query: 391 VRTKLVVSAITDGLLSLRISTR--RIASEMLVFITQWDIPYGLNQVIGEL 438
           V    VVS    GL+  ++  R   +++E+L+  T  + P G N V+  L
Sbjct: 260 VSEDRVVSYFCTGLIIEQVHLRVHLLSAELLLLCTYIESPGGSNTVLHHL 309

>TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717
            YIL159W
          Length = 1642

 Score =  250 bits (639), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 142/459 (30%), Positives = 251/459 (54%), Gaps = 24/459 (5%)

Query: 1315 KKLKQLHWEKIEDTGNSIWKDAKAEK-YADDLYERGVLAQLEKAFAAREIKLLAN----R 1369
            KKLKQ+HW ++ +   +IWKD   ++    +L   GV  +++ +F  +++    N    +
Sbjct: 1141 KKLKQIHWIRVNEVAETIWKDNDRDRGIFMELECVGVFDRVKSSFKLKDVIKKKNTDEAK 1200

Query: 1370 RKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLKPEI 1429
             K+     +FLSRD++QQFGINLH++A+  V E++ K+LRCD D   + ++++F  K E 
Sbjct: 1201 TKDKQQLKSFLSRDLAQQFGINLHLFASCEVSELLEKVLRCDNDINKNITILEFFNKEEF 1260

Query: 1430 VEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWASRMR 1489
              +S ++ARN+APY  +++   + +EA    KD  EL+RAD+++LE+  NL+ YWA R +
Sbjct: 1261 THISGSVARNYAPYGVDYQ---TNNEAT---KDASELERADRIFLELFYNLRAYWAERSQ 1314

Query: 1490 ALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAHGFK 1549
             L ++ TYEK+Y DL+ KL+ ID AV  + +S   +    ++L +GN+MN   K A G  
Sbjct: 1315 CLLLLHTYEKDYFDLMFKLQRIDDAVQKLMNSTRFKKFLYIVLEIGNFMN--KKPAEGIL 1372

Query: 1550 LATLQRLTFIK-DEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAADC 1608
            +++L +L FIK  E N+++FL+++EK IR  + E   F+ +L  V ++  +S++ +  +C
Sbjct: 1373 ISSLTKLVFIKSSENNNLSFLHFIEKTIRTQFPEVYGFIDDLSKVAELGNVSLDHITMEC 1432

Query: 1609 REFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLMEF 1668
            +EF  ++     ++  G LS     HP D++L KV   + +A+ +S+ L D+  LT    
Sbjct: 1433 KEFCTHVNTTVYAVTKGKLSHPEDLHPRDQILKKVKYKISKAKTKSNFLRDQQILTNHSI 1492

Query: 1669 DGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKKMVEEQHK 1728
              +++ +GED                    +KK    NI            K M++ + +
Sbjct: 1493 VKVLKYYGEDPNDRDSKDDFFKNIAEFATLFKKCAKENIYNEEAERLYEQRKYMLDNKLQ 1552

Query: 1729 RARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLK 1767
            +     +   ++  +E +          D +DKLL KL+
Sbjct: 1553 KNNSSGDDSDLEKNTEND----------DAVDKLLLKLR 1581

 Score = 47.0 bits (110), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 107/240 (44%), Gaps = 37/240 (15%)

Query: 519 EYGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLELLNYDK----------- 567
           EY  ++L L+N +     ++ ++  + +  K  G+ +I   +++L  D+           
Sbjct: 386 EYSTVSLFLLNSIMEVLPNIERKYKIINGLKEFGIHQIFYLMKILCTDEEQEIEIISNSN 445

Query: 568 ------IDEQLRIFEDRTADDYNTIMASKSINHNVDMENPLSL---LQNLWESYKGTGAE 618
                 + EQ+ ++     D    IM   SI+H+  M   +S    LQ L    + T  E
Sbjct: 446 TFSKTVLSEQINLYSKIEQD---VIM---SISHHKPMFVDISFGNELQLLVSQVQKTPLE 499

Query: 619 KYLVSLVQHLF-IASSKVQDEGDDPTEASKQL--KLIDSLVSNVTMSSIDTESSFN---- 671
           K +  L+  L  + +S+ Q E     +  + +   LI+SL SN  +  +D +  F+    
Sbjct: 500 KPIGDLLTTLIKLITSRTQSESLKVMKTFESMLAYLINSLFSNSNIHMLDRDDDFDISPE 559

Query: 672 ----GAIQRLYDSMQTDEVARRAIMEARELTRKFEEVKAERDYLGEKLSKAEGGLVGQLQ 727
                +I  L D + +DE+A+RA+ E   L     ++K+E + L E+     G L+ +LQ
Sbjct: 560 LVVQSSINDLMDRLHSDEIAKRAMDEMTGLEHNLIKLKSELESLKEERHADTGELIKELQ 619

>KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5.717
            YIL159W
          Length = 1324

 Score =  248 bits (632), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 133/400 (33%), Positives = 219/400 (54%), Gaps = 27/400 (6%)

Query: 1316 KLKQLHWEKIEDTGNSIWKD-AKAEKYADDLYERGVLAQLEKAFAAREIKLLANRRKEDL 1374
            +LKQ+HWEK+ED  +++W D A+ E+ A +L   G+  Q+   F  + IK+    +K D 
Sbjct: 852  RLKQIHWEKVEDIESTLWHDSARREETAKELKLDGIFDQVMDTFQVKNIKM----KKRDT 907

Query: 1375 NKV------TFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLKPE 1428
                     T L R+++QQFGINLHM+++L   E V K+L C+ D + + SV++F  K E
Sbjct: 908  TTASKKQNGTLLPRNLAQQFGINLHMFSSLGTDEFVEKVLECNSDIVSNVSVLEFFNKEE 967

Query: 1429 IVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWASRM 1488
            +  +  +L + F PY+   E +          K   EL+RAD+++ E+   L  YW  R 
Sbjct: 968  LTSIPTSLIQKFTPYA---ENI----------KSKFELERADRIFFELCFQLHSYWRERS 1014

Query: 1489 RALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAHGF 1548
              L ++ TYEK+Y DL+ KL+ +D  +  +  S   R    +I+ +GNYMN   K  +G 
Sbjct: 1015 NCLLILNTYEKDYYDLMYKLKKVDDGIQRLLSSSKFRDFLYIIIEIGNYMN--KKTVNGI 1072

Query: 1549 KLATLQRLTFIKDE-KNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAAD 1607
            ++ +L +L F+K    N+++FL+++EKIIR  Y +  SF+ EL  + D+ K+S++QL  D
Sbjct: 1073 RIGSLNKLVFVKSSLDNNVSFLHFIEKIIRVKYPDIYSFINELRIIQDLGKLSIDQLEYD 1132

Query: 1608 CREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLME 1667
             +EF   I  +   +E G LS + +  P D++L K    +  A+ +S+L+  ++KL   +
Sbjct: 1133 SQEFCSKINKMSNDLEKGKLSKADRIDPRDQLLKKTKYKVLRAKSKSELMRHQLKLLGHD 1192

Query: 1668 FDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNI 1707
            +  +M+ FGED                 IQ +KK    NI
Sbjct: 1193 YAKIMRYFGEDASDRDSKNAFFTNIFEFIQVFKKCSKENI 1232

 Score = 40.8 bits (94), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 105/226 (46%), Gaps = 27/226 (11%)

Query: 517 ILEYGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFE 576
           I EY    + L+N +       N++  +  + K   L ++  +L  L+   I EQ+  ++
Sbjct: 323 ITEYLSSCMFLINSIIEGFPLQNEKYSVLEKLKDVELPKLFFELSALDSKVIQEQIYRYK 382

Query: 577 DRTADDYNTIMASKSINHNVDMENPLSL--------LQNLWESYKGTGAEKYLVSLVQHL 628
               +D N  +  K IN     ENPLS+        L  L E  K T  E+ + +L+  +
Sbjct: 383 ---KNDENIRL--KIIN-----ENPLSIPDISYGATLMLLIEKSKSTPLEEPIGALLDSV 432

Query: 629 F-IASSKVQDEGDDPTEASKQL--KLIDSLVSNVTMSSIDTESSF----NGAIQRLYDSM 681
             I  ++   E      +   L   L+D L S  T+SS +  +S       +I+RL D++
Sbjct: 433 LKILDTRTYSESIKLFASVSSLLTYLVDKLDS--TISSAENANSLKPVLQDSIERLIDNL 490

Query: 682 QTDEVARRAIMEARELTRKFEEVKAERDYLGEKLSKAEGGLVGQLQ 727
           ++DEVARRA+ E RE     +++  E   L  + + ++  ++ QL+
Sbjct: 491 ESDEVARRAMKELRESETVIKDLNTEIHNLKREKNSSKEDILEQLE 536

>TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1451

 Score =  248 bits (633), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 150/460 (32%), Positives = 254/460 (55%), Gaps = 26/460 (5%)

Query: 1313 PKKKLKQLHWEKIEDTGNSIWKDAKAE-KYADDLYERGVLAQLEKAFAAREIKL-LANRR 1370
            P K +KQ+HWEK+  TG S+W+D         +L   G+ +++E  F +++  +   N +
Sbjct: 966  PTKNMKQIHWEKVSRTGASLWEDDDQRLSIIKELEHTGIFSEVEDIFYSKDAVIKRRNPK 1025

Query: 1371 KEDLNKV-TFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLKPEI 1429
             +  NKV T L R+++QQFGINLHM++ +S +++  K+L+CD     + SVI+F    ++
Sbjct: 1026 DQTQNKVLTLLPRELAQQFGINLHMFSQISPQDLFEKVLQCDISINQNLSVIEFFNNEDL 1085

Query: 1430 VEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWASRMR 1489
              + +N+ R F PYS +++   S      P KD  EL R D ++L +  NL+ YW  R +
Sbjct: 1086 TNIPSNICRTFEPYSIDYKTPGS-----KPTKDISELSRVDHIFLLLCYNLRSYWKERSQ 1140

Query: 1490 ALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAHGFK 1549
             L ++ TYEK+Y DL+ KL  +D+A+++I++S  L+SV  +I+A+GN+MN   K   G +
Sbjct: 1141 CLLMLLTYEKDYYDLMFKLERLDEAINAIKNSQRLKSVLYIIVAIGNFMN--KKGVDGIR 1198

Query: 1550 LATLQRLTFIKDEKNS-MTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAADC 1608
            L++L +LT+IK    S  +FL+++E++IR  Y E   F  +L  V ++  ++++ L  + 
Sbjct: 1199 LSSLNKLTYIKSNSESKASFLHFIERLIRVRYPELYYFTSDLRKVENLGNVTLDHLQLEY 1258

Query: 1609 REFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKV-LPVLPEARKRSDLLSDEVKLTLME 1667
             + S  I  V RSI+ G LS+    HP D +L KV   V+  A KR+ +L D+  LT ++
Sbjct: 1259 DDLSSKINTVHRSIQKGQLSNKKNLHPQDNILDKVKYKVIRAANKRT-ILQDKFTLTNID 1317

Query: 1668 FDGLMQMFGEDXXXXXXXXXXXXXXXXXIQEYKKAQAHNIKMXXXXXXXXXXKKMVEEQH 1727
             + L+  FGED                 +  ++K    NI+              V EQ 
Sbjct: 1318 LEKLLVYFGEDPDDMNNKITFFKSISEFLTLFRKCAKENIEKEEADR--------VYEQ- 1368

Query: 1728 KRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLLEKLK 1767
            +R  L+++     D S  E    +   ++D +D+LL+KL+
Sbjct: 1369 RRQLLDSKIQAQWDSSMDE----IEEDQQDAVDQLLKKLR 1404

 Score = 33.9 bits (76), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 42/194 (21%), Positives = 90/194 (46%), Gaps = 14/194 (7%)

Query: 525 LLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTADDYN 584
           L L+  +  T  ++  +  +  R K C +  ++  ++ LN D++  ++  ++      Y 
Sbjct: 466 LFLLQSIIQTKVNIVNKFDMIIRLKECKIHDLLALMKNLNNDELITEIEKYQKMENIIYQ 525

Query: 585 TIMASKSINHNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQHLF-IASSKVQDEGDDPT 643
                 ++  N+      S LQ L    + T  E  ++ ++  L  I  S+   E  +  
Sbjct: 526 EKSPKDALLKNISYG---SQLQQLITQTRDTQLETPIMMILDSLLKIIQSRTTKESGEII 582

Query: 644 EASKQL--KLIDSLVSN--------VTMSSIDTESSFNGAIQRLYDSMQTDEVARRAIME 693
           + SK +   L+DS+ +N         ++S+ DT S  N ++    DS+ +D+VARRA+ E
Sbjct: 583 KTSKVILDNLLDSIFNNKLTSGSSSTSLSTSDTASIMNNSVTEFLDSLYSDDVARRAMDE 642

Query: 694 ARELTRKFEEVKAE 707
            ++L ++   ++ +
Sbjct: 643 MKQLQKELATLREQ 656

>Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (REAL)
          Length = 1375

 Score =  245 bits (625), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 124/378 (32%), Positives = 227/378 (60%), Gaps = 26/378 (6%)

Query: 1314 KKKLKQLHWEKIEDTGNSIWKDA-KAEKYADDLYERGVLAQLEKAFAAREIKLLANRRKE 1372
            K +LKQ+HW+K+E+  +++W+D  + ++   +L   G+ +Q+E  F  ++   +A+++  
Sbjct: 879  KNRLKQIHWDKVEEIKDTLWEDTTQRQETLKELQTDGIFSQIEDIFKMKDPVKIASKKNG 938

Query: 1373 DL-----------NKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVI 1421
            +            + V+FLSRD++QQFGINLHM++ +S  E V K+L CD + + + +++
Sbjct: 939  NSSTSISSNNGKSSNVSFLSRDLAQQFGINLHMFSQVSDMEFVKKVLNCDNNIIMNVNIL 998

Query: 1422 DFLLKPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQ 1481
             F  K E+V +  ++   + PYS + +G  SV           +LQRAD+++LE+ +NL+
Sbjct: 999  KFFCKEELVSIPKSMLSKYEPYS-QGKGGKSV----------SDLQRADRIFLELCINLR 1047

Query: 1482 GYWASRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDS 1541
             YW +R ++L  ++TYE++Y DL+ KL+ ID  +  +  S   +S+  +I  +GN+MN  
Sbjct: 1048 SYWNARSKSLLTLSTYERDYYDLIFKLQKIDDGILQLNRSVKFKSLMFIITEIGNHMN-- 1105

Query: 1542 SKQAHGFKLATLQRLTFIKDEKN-SMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKIS 1600
             K   G KL +L +L F++   + +++FL+++EK+IR  Y +   F+ +L+ + D+ K+S
Sbjct: 1106 KKMVKGIKLKSLTKLAFVRSSADQNLSFLHFIEKVIRTKYPDIYGFVDDLKRIEDLGKVS 1165

Query: 1601 VEQLAADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDE 1660
            +E +  +CREF   +       + G LS+     P D+++ KV   +  A+ +SDLL D+
Sbjct: 1166 LEHVELECREFQNKVEYAVTQFQTGKLSNEENLDPRDQIVKKVKFKINRAKTKSDLLVDQ 1225

Query: 1661 VKLTLMEFDGLMQMFGED 1678
             KLTL++   LM+ +GED
Sbjct: 1226 CKLTLIDLSKLMKYYGED 1243

 Score = 41.2 bits (95), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 75/166 (45%), Gaps = 29/166 (17%)

Query: 601 PLSLLQNLWESYKGTGAEKYLVSLVQHLFIASSKVQDEGDDPTEASKQLKLIDSLVSNVT 660
           P+ L + L    K +  E  +  +V  L+    K+ D     +E+ K L+LI+SL+  + 
Sbjct: 430 PVCLEKCLLLKAKDSPVETPINEIVNALW----KILDSQRPYSESIKLLRLINSLLFYLI 485

Query: 661 MS-------SID-----------TESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFE 702
            S       S D            +S F  +I +L DS+Q+D++ARRA++E  +L  K  
Sbjct: 486 DSFQVPLNASFDEALDQPQNTQNVDSVFQDSIDKLLDSLQSDDIARRAVIEIDDLNCKIS 545

Query: 703 EVKAERDYLGEKLSKAEGGLVGQLQNELSQRDRILEKNQRVTEQLQ 748
                   L E++S  E     QL  +L + + +L    +  E L+
Sbjct: 546 T-------LNERISLVENYSKDQLLTKLDESEILLSLKTKENENLK 584

>CAGL0F04301g Chr6 (426122..430573) [4452 bp, 1483 aa] {ON} similar
           to uniprot|P38198 Saccharomyces cerevisiae YBL034c STU1
          Length = 1483

 Score = 35.0 bits (79), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 47/99 (47%), Gaps = 5/99 (5%)

Query: 902 QVKEDQVRKLRELRQRLASVQKESNDVSKFNVEERINELFNDKKLSA--LDRLKELETKY 959
           Q+  + V  L     +  S+  ++ D   F V +    L + KK  A   D +K L++K 
Sbjct: 218 QITTELVADLWITEVKKPSIPIQTVDFKDFRVRQYFQTLIDKKKSDANTPDSIKSLDSKD 277

Query: 960 KGFGIDFQADPELSAMLSDAPPENH---HAKDGQAHPSL 995
             F   F  + ELSA+++++ P N    +A   +AH S+
Sbjct: 278 TSFNAIFDVESELSALINESIPPNFNDSYANANRAHSSV 316

>ZYRO0G17996g Chr7 (1477518..1481885) [4368 bp, 1455 aa] {ON} weakly
           similar to uniprot|P34216 Saccharomyces cerevisiae
           YBL047C EDE1 Key endocytic protein involved in a network
           of interactions with other endocytic proteins binds
           membranes in a ubiquitin-dependent manner may also bind
           ubiquitinated membrane-associated proteins
          Length = 1455

 Score = 33.9 bits (76), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 33  KLTGSGNNANTSNKIEPSDISSPKIVSTPAVPEFSGKPLSKQTTLNTQNLSSYV 86
           +L  S N A TS+ +  + ++SP   + P     +GKPLS+Q TL  Q LSS V
Sbjct: 283 QLWNSINTATTSSNVPNTTVASPSSGTAPISANSTGKPLSRQNTL--QRLSSGV 334

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 178,018,111
Number of extensions: 7524442
Number of successful extensions: 27465
Number of sequences better than 10.0: 251
Number of HSP's gapped: 28286
Number of HSP's successfully gapped: 323
Length of query: 1988
Length of database: 53,481,399
Length adjustment: 125
Effective length of query: 1863
Effective length of database: 39,148,149
Effective search space: 72933001587
Effective search space used: 72933001587
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 74 (33.1 bits)