Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0C02574g1.80ON47347322180.0
Kwal_33.133861.80ON46945715660.0
Ecym_10841.80ON49546715400.0
KLTH0F02332g1.80ON46946615120.0
KLLA0C02277g1.80ON46544713660.0
TDEL0C062101.80ON47946113071e-177
AFR671W1.80ON48845112461e-168
Suva_5.31.80ON48346512281e-165
NCAS0J018401.80ON44544212101e-163
ZYRO0F16720g1.80ON49248612131e-163
Skud_5.251.80ON48346511971e-161
YEL064C (AVT2)1.80ON48046811951e-160
Smik_5.231.80ON48346511491e-153
NDAI0I001301.80ON44444211341e-152
KNAG0C007801.80ON5134569581e-124
KNAG0B021907.420ON4612661694e-12
KLTH0C06006g7.420ON4452391642e-11
Kwal_27.107027.420ON4674261632e-11
ZYRO0B04026g7.420ON4362431581e-10
CAGL0M06611g2.295ON4851211463e-09
CAGL0H04587g7.420ON4452351401e-08
NCAS0B062102.295ON4811211374e-08
KAFR0L019107.420ON4452551364e-08
TDEL0G022502.295ON4672851348e-08
Kpol_1003.442.295ON4701361348e-08
Suva_2.287.420ON4592661293e-07
NDAI0C037905.252ON7211891279e-07
KLLA0E06931g7.420ON4562491269e-07
CAGL0G03619g7.420ON4602601242e-06
NDAI0B035102.295ON4961111242e-06
TPHA0C034602.295ON4731201232e-06
Smik_11.905.252ON6801941232e-06
SAKL0F13134g7.420ON5102641213e-06
Suva_9.1122.295ON4911021214e-06
Kwal_27.114852.295ON4711501205e-06
KLLA0E08559g2.295ON4601051205e-06
TBLA0C030305.252ON5231861205e-06
SAKL0E07392g2.295ON4721241196e-06
Kpol_1045.207.420ON4662021171e-05
Smik_9.972.295ON4901021171e-05
KAFR0J013202.295ON4791351161e-05
YKL146W (AVT3)5.252ON6921991152e-05
AGL285C7.420ON4402041152e-05
Kpol_505.52.177ON6872071152e-05
Skud_5.2607.420ON4482061133e-05
TPHA0K006707.420ON4642381133e-05
KNAG0A053802.295ON4741211133e-05
ZYRO0A02112g2.295ON4671341124e-05
YIL088C (AVT7)2.295ON4901101124e-05
KLTH0G10604g2.295ON4681251125e-05
TPHA0F017002.177ON4441851115e-05
Skud_11.815.252ON7121971125e-05
YER119C (AVT6)7.420ON4482551116e-05
YBL089W (AVT5)7.420ON4592351107e-05
Suva_5.2407.420ON4484451107e-05
NCAS0F023105.252ON6681761109e-05
TBLA0F01390singletonON4282351081e-04
Skud_9.862.295ON4901101062e-04
Ecym_71337.420ON4572021062e-04
Kwal_23.28395.252ON6141951062e-04
Skud_2.197.420ON4592411053e-04
Smik_5.2647.420ON4482151053e-04
Ecym_82495.252ON6274561053e-04
Smik_2.317.420ON4592701035e-04
NDAI0E040107.420ON4712521027e-04
TDEL0C028207.420ON4542481010.001
ADL205C2.295ON4681051000.001
KNAG0H023305.252ON6431961000.001
KAFR0H036605.252ON646194990.002
KLLA0E13795g5.252ON573161980.002
AER380C2.177ON716131970.003
TDEL0F013202.177ON715211960.005
Kwal_26.84012.177ON720210950.005
ZYRO0A10538g5.252ON608436950.005
KLLA0C13277g2.177ON721209950.006
Kpol_1032.885.252ON575185940.007
Suva_11.795.252ON719199940.008
Ecym_54082.177ON715128920.012
SAKL0G11462g5.252ON616422920.012
CAGL0G06622g2.177ON733206920.013
KLTH0D09042g2.177ON718210910.015
TBLA0F03230singletonON561221900.022
NCAS0G026302.177ON705208870.049
TBLA0F014007.420ON45377860.057
NCAS0E024407.420ON49598850.070
KNAG0C033807.420ON545148840.096
TDEL0E037405.252ON613158830.14
KLTH0G07502g5.252ON601188820.18
CAGL0E06468g5.252ON681192800.30
TPHA0B025305.252ON596170790.40
ACR051C5.252ON678191790.41
TPHA0B029802.177ON749189770.79
Ecym_33352.295ON474105751.4
ZYRO0B09548g2.177ON71875751.5
SAKL0E10362g2.177ON733210741.6
TBLA0C056302.177ON742172741.6
Suva_12.835.220ON603181732.3
KAFR0D020002.177ON714112722.7
TBLA0B072102.295ON49744713.9
Smik_10.2795.220ON602181704.8
NDAI0F026602.177ON7102106810.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0C02574g
         (473 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0C02574g Chr3 complement(236779..238200) [1422 bp, 473 aa] {...   858   0.0  
Kwal_33.13386 s33 complement(195919..197328) [1410 bp, 469 aa] {...   607   0.0  
Ecym_1084 Chr1 complement(168749..170236) [1488 bp, 495 aa] {ON}...   597   0.0  
KLTH0F02332g Chr6 complement(192112..193521) [1410 bp, 469 aa] {...   587   0.0  
KLLA0C02277g Chr3 complement(192607..194004) [1398 bp, 465 aa] {...   530   0.0  
TDEL0C06210 Chr3 (1130473..1131912) [1440 bp, 479 aa] {ON} Anc_1...   508   e-177
AFR671W Chr6 (1670758..1672224) [1467 bp, 488 aa] {ON} Syntenic ...   484   e-168
Suva_5.3 Chr5 complement(5485..6936) [1452 bp, 483 aa] {ON} YEL0...   477   e-165
NCAS0J01840 Chr10 (346195..347532) [1338 bp, 445 aa] {ON} Anc_1....   470   e-163
ZYRO0F16720g Chr6 (1385158..1386636) [1479 bp, 492 aa] {ON} simi...   471   e-163
Skud_5.25 Chr5 complement(28970..30421) [1452 bp, 483 aa] {ON} Y...   465   e-161
YEL064C Chr5 complement(29797..31239) [1443 bp, 480 aa] {ON}  AV...   464   e-160
Smik_5.23 Chr5 complement(32195..33646) [1452 bp, 483 aa] {ON} Y...   447   e-153
NDAI0I00130 Chr9 (12635..13969) [1335 bp, 444 aa] {ON} Anc_1.80 ...   441   e-152
KNAG0C00780 Chr3 complement(137135..138676) [1542 bp, 513 aa] {O...   373   e-124
KNAG0B02190 Chr2 (418852..420237) [1386 bp, 461 aa] {ON} Anc_7.4...    70   4e-12
KLTH0C06006g Chr3 (518793..520130) [1338 bp, 445 aa] {ON} simila...    68   2e-11
Kwal_27.10702 s27 (455802..457205) [1404 bp, 467 aa] {ON} YER119...    67   2e-11
ZYRO0B04026g Chr2 complement(339245..340555) [1311 bp, 436 aa] {...    65   1e-10
CAGL0M06611g Chr13 complement(681693..683150) [1458 bp, 485 aa] ...    61   3e-09
CAGL0H04587g Chr8 (431944..433281) [1338 bp, 445 aa] {ON} simila...    59   1e-08
NCAS0B06210 Chr2 (1171270..1172715) [1446 bp, 481 aa] {ON} Anc_2...    57   4e-08
KAFR0L01910 Chr12 complement(362409..363746) [1338 bp, 445 aa] {...    57   4e-08
TDEL0G02250 Chr7 complement(441289..442692) [1404 bp, 467 aa] {O...    56   8e-08
Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa] ...    56   8e-08
Suva_2.28 Chr2 (46134..47513) [1380 bp, 459 aa] {ON} YBL089W (REAL)    54   3e-07
NDAI0C03790 Chr3 complement(863178..865343) [2166 bp, 721 aa] {O...    54   9e-07
KLLA0E06931g Chr5 (628083..629453) [1371 bp, 456 aa] {ON} simila...    53   9e-07
CAGL0G03619g Chr7 complement(349789..351171) [1383 bp, 460 aa] {...    52   2e-06
NDAI0B03510 Chr2 (882507..883997) [1491 bp, 496 aa] {ON} Anc_2.295     52   2e-06
TPHA0C03460 Chr3 complement(757629..759050) [1422 bp, 473 aa] {O...    52   2e-06
Smik_11.90 Chr11 (157718..159760) [2043 bp, 680 aa] {ON} YKL146W...    52   2e-06
SAKL0F13134g Chr6 complement(1038673..1040205) [1533 bp, 510 aa]...    51   3e-06
Suva_9.112 Chr9 complement(191885..193360) [1476 bp, 491 aa] {ON...    51   4e-06
Kwal_27.11485 s27 (819908..821323) [1416 bp, 471 aa] {ON} YIL088...    51   5e-06
KLLA0E08559g Chr5 complement(766878..768260) [1383 bp, 460 aa] {...    51   5e-06
TBLA0C03030 Chr3 (732818..734389) [1572 bp, 523 aa] {ON} Anc_5.2...    51   5e-06
SAKL0E07392g Chr5 (602503..603921) [1419 bp, 472 aa] {ON} simila...    50   6e-06
Kpol_1045.20 s1045 (42443..43843) [1401 bp, 466 aa] {ON} (42445....    50   1e-05
Smik_9.97 Chr9 complement(176731..178203) [1473 bp, 490 aa] {ON}...    50   1e-05
KAFR0J01320 Chr10 (241859..243298) [1440 bp, 479 aa] {ON} Anc_2....    49   1e-05
YKL146W Chr11 (171783..173861) [2079 bp, 692 aa] {ON}  AVT3Vacuo...    49   2e-05
AGL285C Chr7 complement(175831..177153) [1323 bp, 440 aa] {ON} S...    49   2e-05
Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON} co...    49   2e-05
Skud_5.260 Chr5 (420651..421997) [1347 bp, 448 aa] {ON} YER119C ...    48   3e-05
TPHA0K00670 Chr11 (132771..134165) [1395 bp, 464 aa] {ON} Anc_7....    48   3e-05
KNAG0A05380 Chr1 (791957..793381) [1425 bp, 474 aa] {ON} Anc_2.2...    48   3e-05
ZYRO0A02112g Chr1 complement(171184..172587) [1404 bp, 467 aa] {...    48   4e-05
YIL088C Chr9 complement(197931..199403) [1473 bp, 490 aa] {ON}  ...    48   4e-05
KLTH0G10604g Chr7 complement(895162..896568) [1407 bp, 468 aa] {...    48   5e-05
TPHA0F01700 Chr6 complement(387868..389202) [1335 bp, 444 aa] {O...    47   5e-05
Skud_11.81 Chr11 (157889..160027) [2139 bp, 712 aa] {ON} YKL146W...    48   5e-05
YER119C Chr5 complement(399496..400842) [1347 bp, 448 aa] {ON}  ...    47   6e-05
YBL089W Chr2 (49574..50953) [1380 bp, 459 aa] {ON}  AVT5Putative...    47   7e-05
Suva_5.240 Chr5 complement(375238..376584) [1347 bp, 448 aa] {ON...    47   7e-05
NCAS0F02310 Chr6 complement(458165..460171) [2007 bp, 668 aa] {O...    47   9e-05
TBLA0F01390 Chr6 complement(342433..343719) [1287 bp, 428 aa] {O...    46   1e-04
Skud_9.86 Chr9 complement(173889..175361) [1473 bp, 490 aa] {ON}...    45   2e-04
Ecym_7133 Chr7 (264196..265569) [1374 bp, 457 aa] {ON} similar t...    45   2e-04
Kwal_23.2839 s23 (38499..40343) [1845 bp, 614 aa] {ON} YKL146W -...    45   2e-04
Skud_2.19 Chr2 (33154..34533) [1380 bp, 459 aa] {ON} YBL089W (REAL)    45   3e-04
Smik_5.264 Chr5 complement(408587..409933) [1347 bp, 448 aa] {ON...    45   3e-04
Ecym_8249 Chr8 (510061..511944) [1884 bp, 627 aa] {ON} similar t...    45   3e-04
Smik_2.31 Chr2 (43199..44578) [1380 bp, 459 aa] {ON} YBL089W (REAL)    44   5e-04
NDAI0E04010 Chr5 (888700..890115) [1416 bp, 471 aa] {ON} Anc_7.420     44   7e-04
TDEL0C02820 Chr3 complement(500004..501368) [1365 bp, 454 aa] {O...    44   0.001
ADL205C Chr4 complement(341897..343303) [1407 bp, 468 aa] {ON} S...    43   0.001
KNAG0H02330 Chr8 (425024..426955) [1932 bp, 643 aa] {ON} Anc_5.2...    43   0.001
KAFR0H03660 Chr8 (698211..700151) [1941 bp, 646 aa] {ON} Anc_5.2...    43   0.002
KLLA0E13795g Chr5 complement(1216938..1218659) [1722 bp, 573 aa]...    42   0.002
AER380C Chr5 complement(1349610..1351760) [2151 bp, 716 aa] {ON}...    42   0.003
TDEL0F01320 Chr6 (235988..238135) [2148 bp, 715 aa] {ON} Anc_2.1...    42   0.005
Kwal_26.8401 s26 complement(767440..769602) [2163 bp, 720 aa] {O...    41   0.005
ZYRO0A10538g Chr1 (852296..854122) [1827 bp, 608 aa] {ON} simila...    41   0.005
KLLA0C13277g Chr3 (1135255..1137420) [2166 bp, 721 aa] {ON} simi...    41   0.006
Kpol_1032.88 s1032 complement(188477..190204) [1728 bp, 575 aa] ...    41   0.007
Suva_11.79 Chr11 (157798..159957) [2160 bp, 719 aa] {ON} YKL146W...    41   0.008
Ecym_5408 Chr5 complement(838376..840523) [2148 bp, 715 aa] {ON}...    40   0.012
SAKL0G11462g Chr7 (980180..982030) [1851 bp, 616 aa] {ON} simila...    40   0.012
CAGL0G06622g Chr7 complement(631859..634060) [2202 bp, 733 aa] {...    40   0.013
KLTH0D09042g Chr4 complement(746802..748958) [2157 bp, 718 aa] {...    40   0.015
TBLA0F03230 Chr6 (785400..787085) [1686 bp, 561 aa] {ON}               39   0.022
NCAS0G02630 Chr7 (473803..475920) [2118 bp, 705 aa] {ON} Anc_2.177     38   0.049
TBLA0F01400 Chr6 complement(345013..346374) [1362 bp, 453 aa] {O...    38   0.057
NCAS0E02440 Chr5 (477113..478600) [1488 bp, 495 aa] {ON} Anc_7.420     37   0.070
KNAG0C03380 Chr3 (665325..666962) [1638 bp, 545 aa] {ON} Anc_7.4...    37   0.096
TDEL0E03740 Chr5 (707081..708922) [1842 bp, 613 aa] {ON} Anc_5.2...    37   0.14 
KLTH0G07502g Chr7 (608628..610433) [1806 bp, 601 aa] {ON} simila...    36   0.18 
CAGL0E06468g Chr5 (647086..649131) [2046 bp, 681 aa] {ON} simila...    35   0.30 
TPHA0B02530 Chr2 (580212..582002) [1791 bp, 596 aa] {ON} Anc_5.2...    35   0.40 
ACR051C Chr3 complement(448844..450880) [2037 bp, 678 aa] {ON} S...    35   0.41 
TPHA0B02980 Chr2 (679253..681502) [2250 bp, 749 aa] {ON} Anc_2.1...    34   0.79 
Ecym_3335 Chr3 complement(639655..641079) [1425 bp, 474 aa] {ON}...    33   1.4  
ZYRO0B09548g Chr2 complement(742965..745121) [2157 bp, 718 aa] {...    33   1.5  
SAKL0E10362g Chr5 complement(860653..862854) [2202 bp, 733 aa] {...    33   1.6  
TBLA0C05630 Chr3 (1364052..1366280) [2229 bp, 742 aa] {ON} Anc_2...    33   1.6  
Suva_12.83 Chr12 (119404..121215) [1812 bp, 603 aa] {ON} YJR001W...    33   2.3  
KAFR0D02000 Chr4 (407474..409618) [2145 bp, 714 aa] {ON} Anc_2.1...    32   2.7  
TBLA0B07210 Chr2 (1705801..1707294) [1494 bp, 497 aa] {ON} Anc_2...    32   3.9  
Smik_10.279 Chr10 (433747..435555) [1809 bp, 602 aa] {ON} YJR001...    32   4.8  
NDAI0F02660 Chr6 complement(649723..651855) [2133 bp, 710 aa] {O...    31   10.0 

>SAKL0C02574g Chr3 complement(236779..238200) [1422 bp, 473 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 473

 Score =  858 bits (2218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/473 (92%), Positives = 436/473 (92%)

Query: 1   MPPSISQPYAPVADLQFELSSFDQHMQPAHASGSAADEDDETKFVDTGADVEDPLVSGIV 60
           MPPSISQPYAPVADLQFELSSFDQHMQPAHASGSAADEDDETKFVDTGADVEDPLVSGIV
Sbjct: 1   MPPSISQPYAPVADLQFELSSFDQHMQPAHASGSAADEDDETKFVDTGADVEDPLVSGIV 60

Query: 61  TENQTKSNIYMAFMNMANSILGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVV 120
           TENQTKSNIYMAFMNMANSILGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVV
Sbjct: 61  TENQTKSNIYMAFMNMANSILGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVV 120

Query: 121 NLKLTGKTTYQDSVEFAMGRRGKLLILAANGLFAXXXXXXXXXXXXDTIPHVLRAFFPAH 180
           NLKLTGKTTYQDSVEFAMGRRGKLLILAANGLFA            DTIPHVLRAFFPAH
Sbjct: 121 NLKLTGKTTYQDSVEFAMGRRGKLLILAANGLFAFGGCIGFCIIIGDTIPHVLRAFFPAH 180

Query: 181 TALFHRNAIIFFVTLFVSYPLSLNRDXXXXXXXXXXXXXXXXXXXXXXXXXGPMLDAAYK 240
           TALFHRNAIIFFVTLFVSYPLSLNRD                         GPMLDAAYK
Sbjct: 181 TALFHRNAIIFFVTLFVSYPLSLNRDISKLSKASMLALASMLLIVVIVIVKGPMLDAAYK 240

Query: 241 GSLTASKLFITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVV 300
           GSLTASKLFITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVV
Sbjct: 241 GSLTASKLFITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVV 300

Query: 301 CFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDL 360
           CFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDL
Sbjct: 301 CFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDL 360

Query: 361 AHFHSGEATAPAELSTKKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILP 420
           AHFHSGEATAPAELSTKKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILP
Sbjct: 361 AHFHSGEATAPAELSTKKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILP 420

Query: 421 PLTNLLLTGRAKTLRQKLPYYGCIVFGFAVMVISSTQTILAAINGGEQKHCET 473
           PLTNLLLTGRAKTLRQKLPYYGCIVFGFAVMVISSTQTILAAINGGEQKHCET
Sbjct: 421 PLTNLLLTGRAKTLRQKLPYYGCIVFGFAVMVISSTQTILAAINGGEQKHCET 473

>Kwal_33.13386 s33 complement(195919..197328) [1410 bp, 469 aa] {ON}
           YEL064C - Hypothetical ORF [contig 118] FULL
          Length = 469

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/457 (63%), Positives = 342/457 (74%), Gaps = 14/457 (3%)

Query: 16  QFELSSFDQHMQPAHASGSAADEDDETKFVDTGADVEDPLVSGIVTENQTKSNIYMAFMN 75
            F+LSSFD++ Q          ED+ T              +  + EN++KSNI+MAFMN
Sbjct: 26  SFQLSSFDRNSQRNSERLIDGSEDEST--------------TAFLRENRSKSNIFMAFMN 71

Query: 76  MANSILGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQDSVE 135
           MANSILGAG+IGQPFAI NCGL GG+ A++LL++LVDWTIRLIVVN+K+TGKTTYQDSVE
Sbjct: 72  MANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDSVE 131

Query: 136 FAMGRRGKLLILAANGLFAXXXXXXXXXXXXDTIPHVLRAFFPAHTALFHRNAIIFFVTL 195
           FAMGR+GKLLIL +NGLFA            DTIPHVLRAFFP H  LFHRN II  VT 
Sbjct: 132 FAMGRKGKLLILLSNGLFAFGGCVGFCIIIGDTIPHVLRAFFPGHENLFHRNIIIILVTC 191

Query: 196 FVSYPLSLNRDXXXXXXXXXXXXXXXXXXXXXXXXXGPMLDAAYKGSLTASKLFITPRIF 255
           F+S+PLSLNR+                         GPM+D AYKGS   ++LF TPRIF
Sbjct: 192 FISFPLSLNRNISKLSKASMLALVSMVFIVVIVLVKGPMIDDAYKGSFNTTELFFTPRIF 251

Query: 256 QGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDK 315
           QGISVISFALVCHHNTSFIYFSLK PSLKRF++LTH SC V+M+ CF+MGY+GFLVFKD+
Sbjct: 252 QGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKDR 311

Query: 316 TKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSGEATAPAELS 375
           TKGNILNNFP  DNV+NVARFCFGFNMLTTFPLEIFVLRDV+RD   F+S +     ELS
Sbjct: 312 TKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFNSKDTNQSQELS 371

Query: 376 TKKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTLR 435
            K HV +T+ LV  TM +SLTTCNLGALFEL GATTAS+MAYILPP  NLLL G+  T+R
Sbjct: 372 LKLHVILTTILVMTTMLISLTTCNLGALFELTGATTASLMAYILPPSVNLLLIGKRSTVR 431

Query: 436 QKLPYYGCIVFGFAVMVISSTQTILAAINGGEQKHCE 472
           +KLP+Y CI+FGF +MV+SS+QTI+A I GG+QKHCE
Sbjct: 432 EKLPHYACIIFGFTIMVVSSSQTIIAYIRGGDQKHCE 468

>Ecym_1084 Chr1 complement(168749..170236) [1488 bp, 495 aa] {ON}
           similar to Ashbya gossypii AFR671W
          Length = 495

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/467 (62%), Positives = 350/467 (74%), Gaps = 2/467 (0%)

Query: 6   SQPYAPVADLQFELSSFDQHMQPAHASGSAADEDDETKFVDTGADVEDPLVSGIVTENQT 65
           S P    +DLQFELS+F  +      SG+  +++ +   V+     EDP VS +   N+ 
Sbjct: 30  SSPIPVSSDLQFELSTFHDYELLPTTSGARNNKNVQNN-VELNLQFEDPNVSQLTNPNRG 88

Query: 66  KSNIYMAFMNMANSILGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLT 125
           KSN+YMAFMNMANSILGAG+IGQPFAI NCGL GGV  IVLLT++VDWTIRLIV+NLKLT
Sbjct: 89  KSNMYMAFMNMANSILGAGVIGQPFAIKNCGLIGGVCLIVLLTIIVDWTIRLIVINLKLT 148

Query: 126 GKTTYQDSVEFAMGRRGKLLILAANGLFAXXXXXXXXXXXXDTIPHVLRAFFPAHTALFH 185
           GKTTYQDSVEFAMG +GKLLIL  NGLFA            D+IPHVL+AFFP+H+ LF 
Sbjct: 149 GKTTYQDSVEFAMGTKGKLLILFVNGLFAFGGCVGFCIIIGDSIPHVLKAFFPSHSELFR 208

Query: 186 RNAIIFFVTLFVSYPLSLNRDXXXXXXXXXXXXXXXXXXXXXXXXXGPMLDAAYKGSLTA 245
           RN +I  VTLF+SYPLSLNR+                          P ++  YKG  T 
Sbjct: 209 RNVVISVVTLFISYPLSLNRNISKLSKASMLALVSLLLIVALVIIRAPKVEDEYKGQFTW 268

Query: 246 SKLFITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMG 305
            + FITPR+FQGIS+ISFALVCHHNTSFI+FSLKNPSLKRF  LTH+SC++SM+VC + G
Sbjct: 269 EEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIISMLVCLIAG 328

Query: 306 YSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHS 365
           Y GFL FKDKTKGNILNNFPS+DN IN ARFCFGFNMLTTFPLEIFVLRDVVRDL +F S
Sbjct: 329 YVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDVVRDLLYFQS 388

Query: 366 GEATAPAELSTKKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNL 425
            ++ +   L+TK+H  VTS LVF++M++SLTTCNLGAL EL+G+TTAS+ AYILPP T L
Sbjct: 389 ADSESII-LTTKEHFIVTSVLVFISMSISLTTCNLGALLELVGSTTASLTAYILPPATTL 447

Query: 426 LLTGRAKTLRQKLPYYGCIVFGFAVMVISSTQTILAAINGGEQKHCE 472
            LTG+ KTL+++ PYY CI+FGF++M++SSTQTIL+AI G E KHCE
Sbjct: 448 ALTGKTKTLKERTPYYACIMFGFSIMIVSSTQTILSAIYGTEIKHCE 494

>KLTH0F02332g Chr6 complement(192112..193521) [1410 bp, 469 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 469

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/466 (63%), Positives = 341/466 (73%), Gaps = 19/466 (4%)

Query: 10  APVADLQFELSSFDQ--HMQPAHASGSAADEDDETKFVDTGADVEDPLVSGIVTENQTKS 67
            P+ D  FELSSFD+   ++P   S                 D ED   S  + E ++KS
Sbjct: 21  GPLGD-NFELSSFDRSTEVRPERLS----------------VDSEDRFTSTFLHEQRSKS 63

Query: 68  NIYMAFMNMANSILGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGK 127
           NI MAFMNMANSILGAGIIGQPFA+ NCGL GGV AIVLL+LLVDWTIRLIVVNL+++GK
Sbjct: 64  NILMAFMNMANSILGAGIIGQPFAVKNCGLLGGVLAIVLLSLLVDWTIRLIVVNLRISGK 123

Query: 128 TTYQDSVEFAMGRRGKLLILAANGLFAXXXXXXXXXXXXDTIPHVLRAFFPAHTALFHRN 187
           TTYQDSVE AMGR+GKLLIL +NGLFA            DTIPHVLRAFF  H  LFHRN
Sbjct: 124 TTYQDSVELAMGRKGKLLILLSNGLFAFGGCIGFCIIIGDTIPHVLRAFFSGHDNLFHRN 183

Query: 188 AIIFFVTLFVSYPLSLNRDXXXXXXXXXXXXXXXXXXXXXXXXXGPMLDAAYKGSLTASK 247
            +I  VT  +S+PLSLNRD                         GP  D+AYKGS  +S 
Sbjct: 184 IVIVVVTCLISFPLSLNRDISKLSKASMLALASMVVIVVIVVIKGPGTDSAYKGSFNSSN 243

Query: 248 LFITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYS 307
           L ITPRIFQG+SVISFALVCHHNTSFIYFSLK PSLKRF++LTH SC ++M+ CF+MG++
Sbjct: 244 LLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFT 303

Query: 308 GFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSGE 367
           GFLVFKDKTKGNILNNFP +DN +NVARFCFGFNMLTTFPLEIFVLRDV++DL  F+S  
Sbjct: 304 GFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMFFNSEP 363

Query: 368 ATAPAELSTKKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLL 427
            + P  LS K HV +++ALVF TM +SLTTCNLGALFELIGATTAS+MAYILPP  NL L
Sbjct: 364 KSQPRVLSLKLHVIISTALVFGTMAISLTTCNLGALFELIGATTASLMAYILPPWVNLKL 423

Query: 428 TGRAKTLRQKLPYYGCIVFGFAVMVISSTQTILAAINGGEQKHCET 473
            G     R ++P+Y CI FGFA+M+ISSTQTI++ INGG+QKHCET
Sbjct: 424 VGGNLKWRDRIPHYVCIGFGFAIMLISSTQTIISYINGGDQKHCET 469

>KLLA0C02277g Chr3 complement(192607..194004) [1398 bp, 465 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 465

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/447 (59%), Positives = 324/447 (72%), Gaps = 10/447 (2%)

Query: 16  QFELSSFDQHMQPAHASGSAADEDDETKFVDTGADVEDPLVSGIVTENQTKSNIYMAFMN 75
           + EL+SFD     A  + SA D++          + EDPL   I   N+ KSN YMAFMN
Sbjct: 27  ELELTSFDD---TAKTADSAVDQNI------FNVNEEDPLTDDIYLSNEAKSNRYMAFMN 77

Query: 76  MANSILGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQDSVE 135
           MANSILG+G+IGQPFA+ NCG+ GG+ A +L+++LVDWTIRLIV+NLKLTGK+TYQ SVE
Sbjct: 78  MANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTGKSTYQASVE 137

Query: 136 FAMGRRGKLLILAANGLFAXXXXXXXXXXXXDTIPHVLRAFFPAHTALFHRNAIIFFVTL 195
            AMG+ G LLIL +NGLFA            D+IPHVL AFFP+HT LFHRN II  VTL
Sbjct: 138 TAMGQWGGLLILVSNGLFAFGGCVGFCIIIGDSIPHVLSAFFPSHTDLFHRNVIITLVTL 197

Query: 196 FVSYPLSLNRDXXXXXXXXXXXXXXXXXXXXXXXXXGPMLDAAYKGSLTASKLFITPRIF 255
           F+S+PLSLNRD                          P++   YKG+    +LFITPRIF
Sbjct: 198 FISFPLSLNRDISKLSKTSMLALLGLIAIVIIIVVKAPLVSGEYKGTFHLHQLFITPRIF 257

Query: 256 QGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDK 315
           QGISVISFALVCHHNTSFI+FSL+NPSLKRFN+LTH+S ++S +VC    YSGFL FKDK
Sbjct: 258 QGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKDK 317

Query: 316 TKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSGEATAPAELS 375
           T GNILNNFPSDDNVIN AR   GFNMLTTFPLEIFVLRDV+RD+ +++  +   P +L+
Sbjct: 318 TVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIYYNKDDP-EPVKLT 376

Query: 376 TKKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTLR 435
           TK H  +TS LV + M ++L+T NLGAL E+IGAT+AS+MAYILPPLTNL++TG+ K+L+
Sbjct: 377 TKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKKKSLK 436

Query: 436 QKLPYYGCIVFGFAVMVISSTQTILAA 462
           +KLPY GCIVFG  +M +S+ QTIL A
Sbjct: 437 EKLPYCGCIVFGVILMFVSTAQTILEA 463

>TDEL0C06210 Chr3 (1130473..1131912) [1440 bp, 479 aa] {ON} Anc_1.80
           YEL064C
          Length = 479

 Score =  508 bits (1307), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 247/461 (53%), Positives = 322/461 (69%), Gaps = 4/461 (0%)

Query: 14  DLQFELSSFDQHMQPAHASGSAADEDDETKFVDTGADVEDPLVSGIVTENQTKSNIYMAF 73
           +L+FEL  FD   +P  +  +  ++ +E K   + + +++ +V  ++ +N  KS +  AF
Sbjct: 20  ELEFELVDFDA--KPGASDETEENDSNEAKASSSNSAIDESMVINLLRDNDKKSTMRWAF 77

Query: 74  MNMANSILGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQDS 133
           MNMANSILGAG++GQPFAI NCG+ GG+ A ++L LLVDWT+RLIV+NL L GK TYQD+
Sbjct: 78  MNMANSILGAGVVGQPFAIRNCGIIGGILAYIILVLLVDWTLRLIVINLTLAGKKTYQDT 137

Query: 134 VEFAMGRRGKLLILAANGLFAXXXXXXXXXXXXDTIPHVLRAFFPAHTALFHRNAIIFFV 193
           VEFA+GR+G++L+L +NGLFA            DTIPH L++ F +    F RN +I  V
Sbjct: 138 VEFALGRKGRILVLLSNGLFAFGGCIGFCIIIGDTIPHFLQSIFHSSNFFFRRNVVITIV 197

Query: 194 TLFVSYPLSLNRDXXXXXXXXXXXXXXXXXXXXXXXXXGPMLDAAYKG-SLTASKLFITP 252
           TLF+SYPLSL R+                         GP +D + KG   + + +FI+ 
Sbjct: 198 TLFISYPLSLQRNIAALSKASFLALISMVVIVFSVVVQGPRVDMSLKGDKWSLTDIFISS 257

Query: 253 RIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVF 312
            IF+GISVISFALVCHHNTSFI+FS+KN SL++F +LTH+S  +SM+ C +MGYSG+ VF
Sbjct: 258 AIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCMLMGYSGYSVF 317

Query: 313 KDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSGE-ATAP 371
           +DKTKGNILNNFP DD VIN+AR CFGFNMLTTFPLEIFVLRDV+    +    E  T  
Sbjct: 318 RDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRDVIAAFLYGKKEEDETEA 377

Query: 372 AELSTKKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRA 431
             LST+K   +T+  V  TM++SLTTCNLGALFELIGATTAS MAYILPP TNL+L+  A
Sbjct: 378 PPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELIGATTASTMAYILPPYTNLVLSKEA 437

Query: 432 KTLRQKLPYYGCIVFGFAVMVISSTQTILAAINGGEQKHCE 472
            T RQK+P+Y CI FGF VM++SSTQTI+  + G +Q+HCE
Sbjct: 438 NTFRQKVPHYLCIFFGFMVMIVSSTQTIIEVVKGSDQRHCE 478

>AFR671W Chr6 (1670758..1672224) [1467 bp, 488 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL064C (AVT2)
          Length = 488

 Score =  484 bits (1246), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 244/451 (54%), Positives = 306/451 (67%), Gaps = 6/451 (1%)

Query: 27  QPAHASGSAADEDD---ETKFVDTGADVE-DPLVSGIVTENQTKSNIYMAFMNMANSI-L 81
            P+ ++G   +  D   ++  + +G D+E D ++  IV E++ K             + L
Sbjct: 38  DPSSSNGDRIELIDYPTKSSTLSSGFDLEEDSVLGAIVQESKGKVQYVYGLHEHGEQVSL 97

Query: 82  GAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQDSVEFAMGRR 141
                G    + NCGL GG+   +LLT++VDWTIRLI++NLKLTGKTTYQD+VEFAMGR 
Sbjct: 98  ELVWSGSRLRLKNCGLLGGLVLTMLLTVIVDWTIRLIIINLKLTGKTTYQDTVEFAMGRP 157

Query: 142 GKLLILAANGLFAXXXXXXXXXXXXDTIPHVLRAFFPAHTALFHRNAIIFFVTLFVSYPL 201
           GK  +L ANG+FA            D+IPHVLRAFFP +   F+RN II  VT+FVSYPL
Sbjct: 158 GKYAVLFANGMFAFGGCVGFCIIIGDSIPHVLRAFFPNYIEYFNRNMIITIVTIFVSYPL 217

Query: 202 SLNRDXXXXXXXXXXXXXXXXXXXXXXXXXGPMLDAAYKGSLTASKLFITPRIFQGISVI 261
           SLNR+                         GP +   Y+GS    +LF+ PR+FQGISVI
Sbjct: 218 SLNRNISKLSKASMLALVSLLLIVVIIVVRGPTVGNDYRGSFDLEELFVKPRLFQGISVI 277

Query: 262 SFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNIL 321
           SFALVC HNTSFIYFSL+ PSL+RFN LTH+SC +SMVVC + GYSGFL FK KTKGNIL
Sbjct: 278 SFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNIL 337

Query: 322 NNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSGEATAPAELSTKKHVA 381
           NNFPS DN IN ARFCFGFNMLTTFPLEIFVLRDV+RDL    + +   P  LSTK+H  
Sbjct: 338 NNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLISTETPKG-EPLRLSTKRHFI 396

Query: 382 VTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTLRQKLPYY 441
           +T+ALV  TM +SLTTCNLGAL EL+G+TTAS+ AYILPP+TNL+LTG  +  ++KLP+Y
Sbjct: 397 ITTALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGERRAAKEKLPHY 456

Query: 442 GCIVFGFAVMVISSTQTILAAINGGEQKHCE 472
            CI+FGF++MVISSTQ I+ AI+  +   C+
Sbjct: 457 ACILFGFSIMVISSTQAIITAIHSDKSSQCD 487

>Suva_5.3 Chr5 complement(5485..6936) [1452 bp, 483 aa] {ON} YEL064C
           (REAL)
          Length = 483

 Score =  477 bits (1228), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 245/465 (52%), Positives = 312/465 (67%), Gaps = 8/465 (1%)

Query: 16  QFELSSFD-QHMQPAHASGSAADEDDETKFVDTGADVEDPLVSGIVTENQTKSNIYMAFM 74
           +FEL++F    +    +   +  +D         +D +D LV+ ++ EN  KS++ MAFM
Sbjct: 18  EFELTNFPLSGITDNDSDDGSQGKDFPNTIYPIISDTDDQLVNNVLRENDKKSSMRMAFM 77

Query: 75  NMANSILGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQDSV 134
           N+ANSILGAGII QPFAI N G+ GG+ + + L  +VDWT+RLIV+NL L GK TYQ +V
Sbjct: 78  NLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLAGKRTYQGTV 137

Query: 135 EFAMGRRGKLLILAANGLFAXXXXXXXXXXXXDTIPHVLRAFFPAHTALFH----RNAII 190
           E+ MG++GKLLIL  NGLFA            DTIPHVLRA F  +    H    RN II
Sbjct: 138 EYVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAVFSQNDGEVHFWLRRNVII 197

Query: 191 FFVTLFVSYPLSLNRDXXXXXXXXXXXXXXXXXXXXXXXXXGPMLDAAYKG-SLTASKLF 249
             VT+F+S+PLSL R+                         GPML   ++G +L  S +F
Sbjct: 198 IMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPMLPYDWRGHTLKLSDIF 257

Query: 250 ITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGF 309
           I   IF+ +SVISFALVCHHNTSFI+FS++N S+ +F KLTH+S ++S++ C +MGYSGF
Sbjct: 258 IKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISIVISVICCGLMGYSGF 317

Query: 310 LVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHS--GE 367
             FK+KTKGN+LN+FP  D  INVAR CFGFNMLTTFP+EIFVLRDVV +L H       
Sbjct: 318 AAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVVGNLLHECHLIKN 377

Query: 368 ATAPAELSTKKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLL 427
                +LS K+H  +TS LVF+TM +SLTTCNLGALFELIGATTAS MAYILPP TNLLL
Sbjct: 378 YDEHTQLSNKQHTIITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNLLL 437

Query: 428 TGRAKTLRQKLPYYGCIVFGFAVMVISSTQTILAAINGGEQKHCE 472
           T + K  + KLPYY CI FGF +M++SSTQTIL A+NG + +HC+
Sbjct: 438 TSKKKNWKAKLPYYFCICFGFMIMIVSSTQTILDAVNGPDGQHCQ 482

>NCAS0J01840 Chr10 (346195..347532) [1338 bp, 445 aa] {ON} Anc_1.80
           YEL064C
          Length = 445

 Score =  470 bits (1210), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 240/442 (54%), Positives = 296/442 (66%), Gaps = 14/442 (3%)

Query: 39  DDETKFVDTGADVEDPLVSGIVTENQTKSNIYMAFMNMANSILGAGIIGQPFAINNCGLA 98
           D+E++  DT  ++   L+     EN+ KSN+YMAFMNMANSILGAGII QP A+ N G+ 
Sbjct: 9   DEESQLPDTSEELAKELIE----ENEKKSNVYMAFMNMANSILGAGIITQPLAVKNAGIL 64

Query: 99  GGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQDSVEFAMGRRGKLLILAANGLFAXXXX 158
           G +   +LL  +VDWT+RL+V+N+ L+ K TYQD+VE  MG++GK LIL  NGLFA    
Sbjct: 65  GSIICYILLGFIVDWTLRLLVINITLSSKQTYQDTVEHVMGKKGKFLILGCNGLFALGGC 124

Query: 159 XXXXXXXXDTIPHVLRAFFPAHTALFHRNAIIFFVTLFVSYPLSLNRDXXXXXXXXXXXX 218
                   DTIPHVLR FF +      RN +IF  TLF+SYPLSL R+            
Sbjct: 125 IGFSIIIGDTIPHVLRIFFNSEK--ITRNMVIFLTTLFISYPLSLLRNIAALSKASFLAL 182

Query: 219 XXXXXXXXXXXXXGPMLDAAYKGS-LTASKLFITPRIFQGISVISFALVCHHNTSFIYFS 277
                        GP L +  KG  L+ S LF +P +F+ +S+ISFALVCHHNTSFI+ S
Sbjct: 183 VSMVVIVFTVVIRGPALPSELKGEPLSHSSLFFSPSLFKSLSIISFALVCHHNTSFIFHS 242

Query: 278 LKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFC 337
           ++N SL +F KLTH+S  +S+  C +MGYSGF +F DKTKGNILNNFP+ DN+IN+AR C
Sbjct: 243 IRNKSLTKFTKLTHISVFISVAFCMLMGYSGFFIFTDKTKGNILNNFPAKDNIINIARIC 302

Query: 338 FGFNMLTTFPLEIFVLRDVVRDL---AHFHSGEATAP--AELSTKKHVAVTSALVFLTMT 392
           FGFNMLTTFPLEIFVLRDVV  +    H    E   P    LS K H  +T+ LVFL+M 
Sbjct: 303 FGFNMLTTFPLEIFVLRDVVAVILLECHLVPSEENNPLLPYLSRKWHFCITTGLVFLSMG 362

Query: 393 VSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTLR--QKLPYYGCIVFGFAV 450
           +SL TCNLGALFELIG+TTAS+MAYILPP  NLLL  +   L    KLP+Y CI FGF V
Sbjct: 363 ISLMTCNLGALFELIGSTTASVMAYILPPYVNLLLRQQRNELSFTTKLPHYFCIFFGFTV 422

Query: 451 MVISSTQTILAAINGGEQKHCE 472
           M+ISST+TIL A+ G EQKHCE
Sbjct: 423 MIISSTETILDAVFGTEQKHCE 444

>ZYRO0F16720g Chr6 (1385158..1386636) [1479 bp, 492 aa] {ON} similar
           to uniprot|P39981 Saccharomyces cerevisiae YEL064C AVT2
           Putative transporter member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 492

 Score =  471 bits (1213), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 245/486 (50%), Positives = 310/486 (63%), Gaps = 18/486 (3%)

Query: 2   PPSISQPYAPVADLQFELSSF----DQHMQPAHAS--------GSAADEDDETKF---VD 46
           P + S      +D +FELS F    +   + +H S              +D T     +D
Sbjct: 9   PLTGSDQLGTRSDPEFELSHFTSQNNSSKKDSHNSLEGEEEEPEDREGTNDTTNLEYGID 68

Query: 47  TGADVEDPLVSGIVTENQTKSNIYMAFMNMANSILGAGIIGQPFAINNCGLAGGVAAIVL 106
              D +D  V+ ++ EN  KS +  AFMNMANSILGAG+IGQP AI N G+ G + A ++
Sbjct: 69  DNYDNDDEFVNDVIRENNKKSTMKWAFMNMANSILGAGVIGQPIAIKNSGIVGAIIAYLV 128

Query: 107 LTLLVDWTIRLIVVNLKLTGKTTYQDSVEFAMGRRGKLLILAANGLFAXXXXXXXXXXXX 166
           L +LVDWT+RLIV+NL L GK TYQD+V FAMG+RG++ +L ANGLFA            
Sbjct: 129 LFVLVDWTLRLIVINLTLAGKKTYQDTVAFAMGKRGRIAVLTANGLFAFGGCIGFCIIIG 188

Query: 167 DTIPHVLRAFFPAHTALFHRNAIIFFVTLFVSYPLSLNRDXXXXXXXXXXXXXXXXXXXX 226
           DT+PHV RAF   ++    R  II  VT+ +SYPL+L R+                    
Sbjct: 189 DTLPHVFRAFIHQNSVFLSRRLIITIVTICISYPLALQRNIAALSKASFLALISMVIIVF 248

Query: 227 XXXXXGPMLDAAYKGSLTASKLFITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRF 286
                GP + A  +  LT   + +TPRIF+GISVISFALVCHHNTSFIYFS+KN SL++F
Sbjct: 249 TVIIRGPEIHAK-RDPLTWEDILVTPRIFRGISVISFALVCHHNTSFIYFSIKNRSLRKF 307

Query: 287 NKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTF 346
           N+LTH+S  +S+V C +MG+SGF  F   TKGN+LNNF +DD  +N+AR CFGFNMLTTF
Sbjct: 308 NRLTHISTSISVVFCMIMGFSGFAAFGQNTKGNVLNNFSADDKAVNIARLCFGFNMLTTF 367

Query: 347 PLEIFVLRDVVRDLAHFHSGEATAPAELSTKKHVAVTSALVFLTMTVSLTTCNLGALFEL 406
           PLEIFVLRDV+      H      P  LS   H  +T+ LVF TM++SL TCNLGA+FEL
Sbjct: 368 PLEIFVLRDVIASFIGGHQPNGD-PNVLSKSNHFIITTILVFGTMSISLLTCNLGAIFEL 426

Query: 407 IGATTASMMAYILPPLTNLLLTGRAKTLRQKLPYYGCIVFGFAVMVISSTQTILAAINGG 466
           IGATTASMMAYILPP  NLLLT   KT RQKLP++ CI FGF++M+ISS QTIL  +NG 
Sbjct: 427 IGATTASMMAYILPPWVNLLLTSD-KTFRQKLPHFACIAFGFSIMLISSIQTILDTMNGT 485

Query: 467 EQKHCE 472
           ++K CE
Sbjct: 486 DEKQCE 491

>Skud_5.25 Chr5 complement(28970..30421) [1452 bp, 483 aa] {ON}
           YEL064C (REAL)
          Length = 483

 Score =  465 bits (1197), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 248/465 (53%), Positives = 312/465 (67%), Gaps = 8/465 (1%)

Query: 16  QFELSSFDQHMQPAHASGSAADEDDETKFV-DTGADVEDPLVSGIVTENQTKSNIYMAFM 74
           +FEL+ F       + S   +   D   FV    +D +DPLV+ ++ EN  KS++ MAFM
Sbjct: 18  EFELTDFPLLGITDNDSDDGSQGKDSPNFVYPITSDTDDPLVNSVLRENDKKSSMRMAFM 77

Query: 75  NMANSILGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQDSV 134
           N+ANSILGAGII QP AI N G+ GG+ A + L  +VDWT+RLIV+NL L GK TYQ +V
Sbjct: 78  NLANSILGAGIITQPVAIKNAGILGGLIAYIALGFIVDWTLRLIVINLTLAGKRTYQGTV 137

Query: 135 EFAMGRRGKLLILAANGLFAXXXXXXXXXXXXDTIPHVLRAFFPAHTALFH----RNAII 190
           E  MG++GKLLIL  NGLFA            DTIPHVLRA F  +    H    RN II
Sbjct: 138 EHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAVFSQNDGEVHFWLRRNVII 197

Query: 191 FFVTLFVSYPLSLNRDXXXXXXXXXXXXXXXXXXXXXXXXXGPMLDAAYKG-SLTASKLF 249
             VT+F+S+PLSL R+                         GPML   +KG SL      
Sbjct: 198 VLVTIFISFPLSLKRNIEGLSKASFLAVISMIIIVLTVVIRGPMLPYDWKGHSLKWPDFL 257

Query: 250 ITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGF 309
           +   IF+ +SVISFALVCHHNTSFI+FS++N S+ +F +LTH+S ++S++ C +MG+SGF
Sbjct: 258 VKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVICCGLMGFSGF 317

Query: 310 LVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAH-FHSGEA 368
             FK+KTKGN+LNNFP  D  INVAR CFGFNMLTTFP+EIFVLRDVV +  H  H  ++
Sbjct: 318 AAFKEKTKGNVLNNFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVVGNSLHECHLIKS 377

Query: 369 -TAPAELSTKKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLL 427
                +LS K+H  +TS LVF+TM++SLTTCNLGALFELIG+TTAS MAYILPP TNLLL
Sbjct: 378 YDEHTQLSDKQHTIITSLLVFITMSISLTTCNLGALFELIGSTTASTMAYILPPYTNLLL 437

Query: 428 TGRAKTLRQKLPYYGCIVFGFAVMVISSTQTILAAINGGEQKHCE 472
           T + K  + KLPYY CI FGF +M++SSTQTIL AING +++HCE
Sbjct: 438 TSKKKNWKAKLPYYLCICFGFMIMIVSSTQTILDAINGADEQHCE 482

>YEL064C Chr5 complement(29797..31239) [1443 bp, 480 aa] {ON}
           AVT2Putative transporter, member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 480

 Score =  464 bits (1195), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 246/468 (52%), Positives = 318/468 (67%), Gaps = 17/468 (3%)

Query: 16  QFELSSFDQHMQPAHASGSAADEDDETKFVDT----GADVEDPLVSGIVTENQTKSNIYM 71
           +FEL++F           +  D DD ++  ++      D++D LV+ ++ EN  KS++ M
Sbjct: 18  EFELTNF------PFPGTTDNDSDDGSQGQNSLNIITPDMDDTLVNDVLRENDKKSSMRM 71

Query: 72  AFMNMANSILGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQ 131
           AFMN+ANSILGAGII QPFAI N G+ GG+ + V L  +VDWT+RLIV+NL L GK TYQ
Sbjct: 72  AFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLAGKRTYQ 131

Query: 132 DSVEFAMGRRGKLLILAANGLFAXXXXXXXXXXXXDTIPHVLRAFFPAHTALFH----RN 187
            +VE  MG++GKLLIL  NGLFA            DTIPHVLRA F  +    H    RN
Sbjct: 132 GTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAIFSQNDGNVHFWLRRN 191

Query: 188 AIIFFVTLFVSYPLSLNRDXXXXXXXXXXXXXXXXXXXXXXXXXGPMLDAAYKG-SLTAS 246
            II  VT F+S+PLS+ R+                         GPML   +KG SL  S
Sbjct: 192 VIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPYDWKGHSLKLS 251

Query: 247 KLFITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGY 306
             F+   IF+ +SVISFALVCHHNTSFI+FS++N S+ +F +LTH+S ++S++ C +MGY
Sbjct: 252 DFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVICCALMGY 311

Query: 307 SGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHS- 365
           SGF VFK+KTKGN+LN+FP  D  IN+AR CFGFNMLTTFP+EIFVLRDVV +L H  + 
Sbjct: 312 SGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDVVGNLLHECNL 371

Query: 366 -GEATAPAELSTKKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTN 424
                   +LS K+HV +TS+LVF+TM +SLTTCNLGALFELIGATTAS MAYILPP TN
Sbjct: 372 IKNYDEHTQLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTN 431

Query: 425 LLLTGRAKTLRQKLPYYGCIVFGFAVMVISSTQTILAAINGGEQKHCE 472
           LLLT + K+ +++LP+Y CI FGF +M+ISSTQTI+ A+NG + +HC+
Sbjct: 432 LLLTSKKKSWKERLPFYLCICFGFMIMIISSTQTIIDAVNGSDGQHCQ 479

>Smik_5.23 Chr5 complement(32195..33646) [1452 bp, 483 aa] {ON}
           YEL064C (REAL)
          Length = 483

 Score =  447 bits (1149), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 246/465 (52%), Positives = 309/465 (66%), Gaps = 8/465 (1%)

Query: 16  QFELSSFDQHMQPAHASGSAADEDDETKFV-DTGADVEDPLVSGIVTENQTKSNIYMAFM 74
           +FEL+ F       + S   +   D  K +    +D +D LV+ ++ EN  KS++ MAFM
Sbjct: 18  EFELTDFPLPGITDNNSDDRSQGKDSLKAIYPIASDTDDTLVNKVLLENDKKSSMRMAFM 77

Query: 75  NMANSILGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQDSV 134
           N+ANSILGAGII QPFAI N G+ GG+ + + L  +VDWT+RLIV+NL L GK TYQ +V
Sbjct: 78  NLANSILGAGIITQPFAIKNAGILGGLISYIALGFIVDWTLRLIVINLTLAGKRTYQGTV 137

Query: 135 EFAMGRRGKLLILAANGLFAXXXXXXXXXXXXDTIPHVLRAFFPAHTALFH----RNAII 190
           E  MG++GKLLIL  NGLFA            DTIPHVLRA F       H    RN II
Sbjct: 138 EHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAIFSQKDGDIHFWLRRNVII 197

Query: 191 FFVTLFVSYPLSLNRDXXXXXXXXXXXXXXXXXXXXXXXXXGPMLDAAYKG-SLTASKLF 249
             VT+F+S+PLSL R+                         GPML   +KG SL     F
Sbjct: 198 IIVTIFISFPLSLKRNIEALSKASFLAVISMIIIVVTVVIRGPMLPYDWKGHSLQLRDFF 257

Query: 250 ITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGF 309
           +   IF+ +SVISFALVCHHNTSFI+FS++N S+ +F +LTH+S ++S++ C +MGYSGF
Sbjct: 258 VKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVICCGLMGYSGF 317

Query: 310 LVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHS--GE 367
             FK+KTKGNILN+FP  D  IN+AR CFGFNMLTTFP+EIFVLRDVV +L H       
Sbjct: 318 AAFKEKTKGNILNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDVVGNLLHECKIIKN 377

Query: 368 ATAPAELSTKKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLL 427
                +LS K+H+ +TS LVF+TM +SLTTCNLGALFELIGATTAS MAYILPP TNLLL
Sbjct: 378 YDEHTQLSGKQHIVITSLLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNLLL 437

Query: 428 TGRAKTLRQKLPYYGCIVFGFAVMVISSTQTILAAINGGEQKHCE 472
           T + K+   KLP+Y CI FGF +M+ISSTQTIL A+NG + +HC+
Sbjct: 438 TSKKKSWSAKLPFYLCICFGFMIMIISSTQTILDAVNGSDGQHCQ 482

>NDAI0I00130 Chr9 (12635..13969) [1335 bp, 444 aa] {ON} Anc_1.80
           YEL064C
          Length = 444

 Score =  441 bits (1134), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 229/442 (51%), Positives = 290/442 (65%), Gaps = 15/442 (3%)

Query: 39  DDETKFVDTGADVEDPLVSGIVTENQTKSNIYMAFMNMANSILGAGIIGQPFAINNCGLA 98
           D+E +  D+ A     LV  I+ EN  KSNIYMAF+NMANSILGAGII QP A+ N GL 
Sbjct: 9   DEEFQLQDSEA-----LVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLC 63

Query: 99  GGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQDSVEFAMGRRGKLLILAANGLFAXXXX 158
             +   ++L  +VDWT+RL++ N+ L+ K TY D+VE+ MGR+GK LIL  NGLFA    
Sbjct: 64  ASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALGGC 123

Query: 159 XXXXXXXXDTIPHVLRAFFPAHTALFHRNAIIFFVTLFVSYPLSLNRDXXXXXXXXXXXX 218
                   DTIPHVLR F   H+    RN++IFF TLF+SYPLSL RD            
Sbjct: 124 IGFCIIIGDTIPHVLRIFI--HSHFVTRNSVIFFSTLFISYPLSLLRDISALSSTSFLAL 181

Query: 219 XXXXXXXXXXXXXGPMLDAAYKGS-LTASKLFITPRIFQGISVISFALVCHHNTSFIYFS 277
                        GP L A  KGS + +S    +P +F+ +S++SFALVCHHNTSFI+ S
Sbjct: 182 ISMTVIVMTVVVFGPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHS 241

Query: 278 LKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFC 337
           ++N SL +F KLTHLS  +S++ C +MGY+GF +F  KTKGNILNNFP +   IN+AR C
Sbjct: 242 IRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVC 301

Query: 338 FGFNMLTTFPLEIFVLRDVVRDLAHFHSG-----EATAPAELSTKKHVAVTSALVFLTMT 392
           FGFNMLTT PLE+FVLRDV+  +   +       E      L+ K H  VT+ +VFLTM+
Sbjct: 302 FGFNMLTTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTMS 361

Query: 393 VSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTL--RQKLPYYGCIVFGFAV 450
           VSL TCNLGALFEL+GATTAS+MAYILPP  NLLL    + L  + K+P+Y CI+FGF V
Sbjct: 362 VSLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFTV 421

Query: 451 MVISSTQTILAAINGGEQKHCE 472
           M++SS QTI+ A+   EQKHCE
Sbjct: 422 MIVSSFQTIVEALADNEQKHCE 443

>KNAG0C00780 Chr3 complement(137135..138676) [1542 bp, 513 aa] {ON}
           Anc_1.80 YEL064C
          Length = 513

 Score =  373 bits (958), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 217/456 (47%), Positives = 273/456 (59%), Gaps = 47/456 (10%)

Query: 50  DVEDPLVSGIVTENQTKSNIYMAFMNMANSILGAGIIGQPFAINNCGLAGGVAAIVLLTL 109
           ++E+PL++GI+  N+ KS ++MAFMNMANSILGAGII QPFA+   G+ G     + L  
Sbjct: 21  ELENPLIAGIIETNEEKSPLHMAFMNMANSILGAGIISQPFAVREAGVLGAFVVYIALGF 80

Query: 110 LVDWTIRLIVVNLKLTGKTTYQDSVEFAMGRRGKLLILAANGLFAXXXXXXXXXXXXDTI 169
           LVDWT+RLIV NL +TG  TYQ+SV  A+G  G+L IL ANGLFA            DTI
Sbjct: 81  LVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLANGLFAFGGCVAFCIIIGDTI 140

Query: 170 PHVLRAFFPAHTALFHRNAIIFFVTLFVSYPLSLNRDXXXXXXXXXXXXXXXXXXXXXXX 229
           PHVLR   P       RN +I  VTL +S PLSL++                        
Sbjct: 141 PHVLRTVCPPQ--YIERNWVIIVVTLLISLPLSLSKKIKQLERASFLALVSMAVIVVTVA 198

Query: 230 XXGPMLDAAYKG--SLTASKLFITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFN 287
             GP L +  K   SL A + +    IF+ +S++SFALVCHHNTSFI+ SL+N S+ +FN
Sbjct: 199 VRGPFLPSELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFN 258

Query: 288 KLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFP 347
           +LTH SC VS+ VC +MGY+GF  FK+KTKGN+LNNF  DD  INVAR  FGFNMLTTFP
Sbjct: 259 RLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNMLTTFP 318

Query: 348 LEIFVLRDVVRDL-----------AHFH-------------------SGEATAPA----- 372
           LEIFVLR+VV D+              H                   S  A  PA     
Sbjct: 319 LEIFVLRNVVLDIWAGPTHRWYQHRRHHPPRGGHTATQQPPPPEPHGSSPARGPAGPHPG 378

Query: 373 -----ELSTKKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLL 427
                E S + H AVT  LV  TM V+L TCNLGAL E+IG+TT ++ AYILPPLT++LL
Sbjct: 379 LPPDPEPSEQPHTAVTVVLVLATMGVALVTCNLGALLEVIGSTTGALTAYILPPLTHVLL 438

Query: 428 TGR---AKTLRQKLPYYGCIVFGFAVMVISSTQTIL 460
           T R     T R++L +  C+VFG  VM++S+TQT+L
Sbjct: 439 TRRRPQPHTARERLGHCCCVVFGCTVMLVSTTQTLL 474

>KNAG0B02190 Chr2 (418852..420237) [1386 bp, 461 aa] {ON} Anc_7.420
           YER119C
          Length = 461

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 65/266 (24%), Positives = 113/266 (42%), Gaps = 64/266 (24%)

Query: 252 PRIFQGISVISFALVCHHNTSFIYFSLKNPSL-KRFNKLTHL---SCLVSMVVCFVMGYS 307
           P I   + +  FA  CHHN     FS+ N  + ++FN +T +   S  ++ ++  V+GYS
Sbjct: 194 PPILTTLPIFVFAYTCHHNM----FSVINEQVDQKFNVITKIAKYSMSLAFLLYIVIGYS 249

Query: 308 GFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSG- 366
           G+L F DK  GNI+  +P++ +   + R      +  TFPL+    R  +  + HF    
Sbjct: 250 GYLTFGDKIVGNIVTLYPNNASS-TIGRIAIAILVTLTFPLQCHPARASIHHIIHFFQAR 308

Query: 367 ----------------------------------------EATAPAELST-----KKHVA 381
                                                   E  +P EL       K+ + 
Sbjct: 309 SAENGNGSAMVLNQMEGVSPELETTPLTDAANCAEVDTAIEEGSPEELQVMPLEGKRFIF 368

Query: 382 VTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTLRQKLP-- 439
           +T  ++F +  ++++  +L  +  ++GAT ++ +++ILP +    L G       +LP  
Sbjct: 369 ITCTILFCSYLLAVSVTSLAKVLAIVGATGSTSISFILPGIFGYKLIGSECETGAELPFQ 428

Query: 440 -----YYG-CI-VFGFAVMVISSTQT 458
                Y G C+ V+G  VMV S T T
Sbjct: 429 TKMFKYLGLCLAVWGLVVMVASLTAT 454

>KLTH0C06006g Chr3 (518793..520130) [1338 bp, 445 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119C AVT6
           Vacuolar transporter exports aspartate and glutamate
           from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 445

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 106/239 (44%), Gaps = 42/239 (17%)

Query: 263 FALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILN 322
           FA  CHHN   I   L++ SLK   K++ +S  ++M +  ++G SG+  F D   GNI+ 
Sbjct: 203 FAYTCHHNMFSIVNELRDNSLKGIYKVSIISVALAMSLYLLIGGSGYATFGDNVAGNIIM 262

Query: 323 NFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSG---------------- 366
            +P       V R      ++  FPL+    R  V  + H+                   
Sbjct: 263 LYP-QSAATTVGRVAIALLVMLAFPLQCHPARASVDHILHYFGAGKSHEAAPSPSSESSQ 321

Query: 367 ------------EATAPAELST-----KKHVAVTSALVFLTMTVSLTTCNLGALFELIGA 409
                       E   P +L+      K+ +A+T++++ L+  ++++  +L  +  ++GA
Sbjct: 322 LIPSSDTEDIVVEEGGPRQLAVMPLEGKRFIAITTSILLLSYLLAISVTSLARVLAVVGA 381

Query: 410 TTASMMAYILPPLTNLLLT------GRAKTLRQKLPYYGCIV--FGFAVMVISSTQTIL 460
           T ++ +++ILP +    L       G++ T  + L Y    +  +G AV+V   + T+L
Sbjct: 382 TGSTSISFILPGIFGFQLIGSEDQPGQSSTKTKFLKYLSLTLACWGMAVLVTCLSATLL 440

>Kwal_27.10702 s27 (455802..457205) [1404 bp, 467 aa] {ON} YER119C -
           Hypothetical ORF [contig 33] FULL
          Length = 467

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 89/426 (20%), Positives = 157/426 (36%), Gaps = 58/426 (13%)

Query: 57  SGIVTENQTKSNIYMAFMNMANSILGAGIIGQPFAINNCGLAGGVAAIV----------L 106
           S I   N   S++    + + ++  GAGI+  P+A    GL  G   IV          +
Sbjct: 16  SSIYNPNAMSSSVGSGVLTLLHTACGAGILAMPYAFKPFGLVLGFCMIVFCGACSATGLM 75

Query: 107 LTLLVDWTIRLIVVNLKLTGKTTY-QDSVEFAMGRRGKLLILAANGLFAXXXXXXXXXXX 165
           L   V    +    +     + TY Q SV F +    K   +  + L             
Sbjct: 76  LQARVSKYAKERNASFFALSQITYPQLSVVFDLAIAVKCFGVGVSYL----------VVV 125

Query: 166 XDTIPHVLRAFFPAHTALFHRNAIIFFVTLFVSYPLSLNR--DXXXXXXXXXXXXXXXXX 223
            D +P +  A F +H+ L +RN  I  V   +  PL   R  D                 
Sbjct: 126 GDLMPRIF-ATFTSHSLLLNRNFHITLVMALIVSPLCFMRRLDSLRYASMIAVSSVAYLC 184

Query: 224 XXXXXXXXGPMLD-AAYKGSLTASKLFIT-PRIFQGISVISFALVCHHNTSFIYFSLKNP 281
                    P  +    KG ++  K   +   +     +  FA  CHHN   I   L++ 
Sbjct: 185 VLVVVHFLFPSEELRELKGYVSIQKPAGSFSALLSCFPIFVFAYTCHHNMFSIINELRDN 244

Query: 282 SLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFN 341
           SLK   K+  +S  +SM +  ++G SG+  F D   GNI+  +P       + R      
Sbjct: 245 SLKGIYKVCAISVALSMTLYLLIGGSGYATFGDNVPGNIITLYP-QSTTTTIGRVAIALL 303

Query: 342 MLTTFPLEIFVLRDVVRDLAHFHSGEATAPAE---------------------------- 373
           ++  FPL+    R  +  +  + S  +  P +                            
Sbjct: 304 VMLAFPLQCHPARASIDHIIQYFSKASDNPLQNSEASHLISSPRVSEDVMAEEDSPQQPQ 363

Query: 374 ---LSTKKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGR 430
              L  K+ +A+T+ ++  +  ++++  +L  +  ++GAT ++ +++ILP +    L G 
Sbjct: 364 VVPLEGKRFIAITAGILIFSFLLAISVTSLARVLAVVGATGSTSISFILPGIFGYQLIGS 423

Query: 431 AKTLRQ 436
             T  Q
Sbjct: 424 EHTTGQ 429

>ZYRO0B04026g Chr2 complement(339245..340555) [1311 bp, 436 aa] {ON}
           similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119C AVT6 Vacuolar transporter exports aspartate and
           glutamate from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 436

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/243 (21%), Positives = 106/243 (43%), Gaps = 36/243 (14%)

Query: 252 PRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLV 311
           P     + +  FA  CHHN   +Y   K+ S ++ NK+      ++ V+  ++G +G+L 
Sbjct: 191 PTPLTTLPIFVFAYTCHHNAFSVYNEQKDTSTRQLNKIGRYGMSIAFVLYTIIGGAGYLT 250

Query: 312 FKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAH-FHSGEATA 370
           F D   GNI+  +P   +   + R      ++  FPL+    R  + ++ + F S E   
Sbjct: 251 FGDHIAGNIITLYPPSLST-TIGRVAIVLLVMLAFPLQCHPARSSINNILYSFQSVEKNL 309

Query: 371 PAE------------------------LSTKKHVAVTSALVFLTMTVSLTTCNLGALFEL 406
             +                        L  K+   +T  ++  +  ++++  +L  L  +
Sbjct: 310 QGQTENSNLISEEESVESQAHGPPVPPLQGKRFTVITLVILIASYLLAISVTSLARLLAI 369

Query: 407 IGATTASMMAYILPPLTNLLLTGRAKTLRQKLP-------YYGCI--VFGFAVMVISSTQ 457
           +G+T ++ +++ILP +    L G   T  ++LP       + G +  ++GF VM+ S   
Sbjct: 370 VGSTGSTSISFILPGIFGYWLIGSEYT-PEELPRNLKFAKFAGLLLAIWGFIVMIASLAA 428

Query: 458 TIL 460
           +IL
Sbjct: 429 SIL 431

>CAGL0M06611g Chr13 complement(681693..683150) [1458 bp, 485 aa]
           {ON} similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088c
          Length = 485

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 60/121 (49%)

Query: 240 KGSLTASKLFITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMV 299
           +G ++  K++    +    S+I FA V   N   I   L++ S+    K+   S L+S +
Sbjct: 178 RGEISWFKVYDYKGLLSTFSIIIFAYVGAMNIFTIVNELQDNSMTNVRKVVDSSILISTI 237

Query: 300 VCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRD 359
           +   +G  G+L F   T GNIL N+ SD   I + +FC    ++ TFPL    LR  + +
Sbjct: 238 LFLFVGLFGYLTFGSLTMGNILLNYDSDSLAIGIGKFCLAMMLILTFPLLFHPLRTAINN 297

Query: 360 L 360
           +
Sbjct: 298 I 298

>CAGL0H04587g Chr8 (431944..433281) [1338 bp, 445 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119c
          Length = 445

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/235 (22%), Positives = 99/235 (42%), Gaps = 44/235 (18%)

Query: 263 FALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILN 322
           FA  CHHN   +    KN        +  +S LV+ V+  V+G +G+L F D   GNI+ 
Sbjct: 201 FAYTCHHNMFSVINEQKNTGFTYVRYIAIVSILVAFVLYVVIGSTGYLTFGDNITGNIIA 260

Query: 323 NFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHF--------HSGEATA---- 370
            +P D     + R      ++  FPL+    R+ + ++  +         S E TA    
Sbjct: 261 LYP-DTLSTTIGRIAIVLLVMLAFPLQCHPARESINNMIKYVQDRYSPQTSYELTAVDAD 319

Query: 371 -------------------PAELSTKKHVAVTSALVFLTMTVSLTTCNLGALFELIGATT 411
                                 + TK+ + +T+ ++F +  ++++  +L  +  ++GAT 
Sbjct: 320 NLEINNDVTSINSRANDKEEECMDTKRFMIITACILFCSYLLAISVTSLARVLAIVGATG 379

Query: 412 ASMMAYILPPLTNLLLTGRAKT-------LRQK---LPYYGCI--VFGFAVMVIS 454
           ++ +++ILP      L G   T       LR+      Y G +  ++G  +M+ S
Sbjct: 380 STTISFILPGYFGWSLIGTEYTSNGNQLPLRKSTVIFKYIGLVMTIWGIIIMITS 434

>NCAS0B06210 Chr2 (1171270..1172715) [1446 bp, 481 aa] {ON}
           Anc_2.295
          Length = 481

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 62/121 (51%)

Query: 240 KGSLTASKLFITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMV 299
           +G ++  +++    +    S+I FA V   N   I   L+N S++   K+ + S  +S +
Sbjct: 175 RGEISWIRIYDGKGLLSTFSIIIFAYVGAMNLFSICRELENDSMENILKVINGSIGISSI 234

Query: 300 VCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRD 359
              ++G SG+L F    +GNI+ N+  +   I + +FC  F +L +FPL    LR  V +
Sbjct: 235 FFLLVGISGYLTFGSNVQGNIILNYDPNSIWIYLGKFCLAFMLLLSFPLLFHPLRIAVNN 294

Query: 360 L 360
           L
Sbjct: 295 L 295

>KAFR0L01910 Chr12 complement(362409..363746) [1338 bp, 445 aa] {ON}
           Anc_7.420 YER119C
          Length = 445

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 54/255 (21%), Positives = 105/255 (41%), Gaps = 43/255 (16%)

Query: 252 PRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLV 311
           P     + +  FA  CHHN   +     N +     K+  ++ +++ ++  ++G+SG+L 
Sbjct: 191 PSPLTTLPIFVFAYTCHHNFFSVINEQSNIAFTHIKKIPIIAMILAYLLYILIGFSGYLT 250

Query: 312 FKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHF----HSGE 367
           F D   GNI+  +P   +   + R    F ++  FPL+    R  +  + H+    +S E
Sbjct: 251 FGDNIVGNIITLYPRTASS-TIGRLAIVFLVMLAFPLQCHPCRASIHHIWHYIQEKNSNE 309

Query: 368 -ATAPAE---------------------------LSTKKHVAVTSALVFLTMTVSLTTCN 399
            AT P                             L  K+   +T  ++  + T++++  +
Sbjct: 310 IATQPINVPPDEEDTLLAVELIEEDSPKQPEEIPLRGKRFNIITVCILLFSYTLAISVNS 369

Query: 400 LGALFELIGATTASMMAYILPPLTNLLLTGRA-KTLRQKLP-------YYGCI--VFGFA 449
           L  +  ++GAT ++ +++ILP +    L G         LP       Y G    ++G  
Sbjct: 370 LAKVLAIVGATGSTSISFILPGIFGFKLIGSEFSATSSPLPKSARFFRYLGLFLSIWGLF 429

Query: 450 VMVISSTQTILAAIN 464
           VM+ S   T+L  + 
Sbjct: 430 VMIASLAATLLLGVG 444

>TDEL0G02250 Chr7 complement(441289..442692) [1404 bp, 467 aa] {ON}
           Anc_2.295 YIL088C
          Length = 467

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 64/285 (22%), Positives = 112/285 (39%), Gaps = 69/285 (24%)

Query: 238 AYKGSLTASKLFITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVS 297
           +Y+G +   K++    +    S+I FA     N   I   LK  S+     + + S  +S
Sbjct: 174 SYRGEVCWFKVYDFKGLLSTFSIIVFAYTGSMNLFSIINELKENSMANITSVINTSITIS 233

Query: 298 MVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVV 357
             V   +G  G+L F   T GNI+ N+  D   + V + C G  ++ +FPL     R  +
Sbjct: 234 TAVFLAVGICGYLTFGSNTLGNIMLNYDPDSTWVYVGKLCLGSMVMLSFPLLFHPCRIAI 293

Query: 358 RDLA-----HFH------SGEATA--------PAELSTK--------------------- 377
            +L      HF       S +A A        P  LS +                     
Sbjct: 294 NNLVVWSEIHFKKDPIMPSQQAQARSRPGEGSPIRLSIQDEDNESLAGFDNDIESVDGDD 353

Query: 378 -----------------KHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILP 420
                            +  A+++ L+ L  +++L   +   +  L+GAT ++ +++ILP
Sbjct: 354 TQVIRGNNVETTPFPNSRFYAISAILLILMYSLALKVKSFAFVLALVGATGSTSISFILP 413

Query: 421 PL-------TNLLLTGRAKTLRQKLPYYGCIV----FGFAVMVIS 454
            L       T+ L  G++ + R +  Y  C V    +G +VM +S
Sbjct: 414 GLFGYKLIGTDSLAVGQSISPRDRF-YKRCSVLLVWYGLSVMALS 457

>Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa]
           {ON} complement(104836..106248) [1413 nt, 471 aa]
          Length = 470

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 68/136 (50%)

Query: 259 SVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKG 318
           S+I FA     N   I   L+N S++   K+ + S  +S  +  ++G SG+L F   T G
Sbjct: 198 SIIIFAFTGAMNLFSIINELENNSIRNITKVINRSIGISTFLFLLVGISGYLTFGSNTLG 257

Query: 319 NILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSGEATAPAELSTKK 378
           NI+ N+  D     + +FC G  ++ +FPL    LR  V ++  F+     +  E ++  
Sbjct: 258 NIMLNYDPDSKWCYIGKFCLGSMIVLSFPLLFHPLRIAVNNMVIFYQINYGSNKENTSPN 317

Query: 379 HVAVTSALVFLTMTVS 394
             + TS L  +++T++
Sbjct: 318 IRSNTSDLSPISLTIN 333

>Suva_2.28 Chr2 (46134..47513) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/266 (21%), Positives = 106/266 (39%), Gaps = 58/266 (21%)

Query: 233 PMLDAAYKGSLTASKLFITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHL 292
           P  DA     LT   +F+            FA  CHHN   +     + S K   ++  L
Sbjct: 196 PHQDAQSHSPLTTLPIFV------------FAYTCHHNMFSVINEQADKSFKILRRIPIL 243

Query: 293 SCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFV 352
           +  ++ V+  V+G +G++ F D   GNI+  +P +     + R      +   FPL+   
Sbjct: 244 AISLAYVLYVVIGGTGYMTFGDNIVGNIITLYP-NSIYTTIGRLAMLLLVTLAFPLQCHP 302

Query: 353 LRDVVRDL----------------------------------AHFHSGEATAPAELSTKK 378
            R  ++++                                  A  ++ ++  P E S + 
Sbjct: 303 CRSSIKNMIVFIKNLRKDKTDDSTAGFIPLDDLSSEDPQEEVAQQNNEQSNLPIESSRQT 362

Query: 379 HVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTG--------R 430
           +V     L+F +  ++++  +L  +  ++GAT ++ +++ILP L    L G        R
Sbjct: 363 NVITLCILIF-SYLLAISITSLAKVLAIVGATGSTSISFILPGLFGYKLIGSEFTNSNDR 421

Query: 431 AKTLRQKLPYYGCIVF--GFAVMVIS 454
             T  +   Y G ++F  G AVMV S
Sbjct: 422 VPTRVKLFKYLGLLLFIWGIAVMVAS 447

>NDAI0C03790 Chr3 complement(863178..865343) [2166 bp, 721 aa] {ON}
           Anc_5.252
          Length = 721

 Score = 53.5 bits (127), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 89/189 (47%), Gaps = 11/189 (5%)

Query: 277 SLKNPSLKRFNK-LTHLSCLVSMVV--CFVMGYSGFLVFKDKTKGNILNNFPSDDNVINV 333
           S++NP +  F K L+ + C+V+++   C ++ YS F    +K +  +L NFP D     +
Sbjct: 533 SMQNPQV--FPKCLSLVMCIVTIIFISCGLICYSAF---GEKVETVVLLNFPQDSAFTLM 587

Query: 334 ARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSGEATAPAELSTKKHVAVTSALVFLTMTV 393
            +  +   +L + PL++F    ++ +            + +  KK+      ++F  M  
Sbjct: 588 VQLLYSLAILLSTPLQLFPAIKILENWTFPIHASGKHNSRIKWKKNYFRCIMVIFTAMVA 647

Query: 394 SLTTCNLGALFELIGATTASMMAYILPPLTNL--LLTGRAKTLRQKLPYYGCI-VFGFAV 450
            +   +L     L+G+     + YI PPL +    L   +KT+R +L     + VFG  +
Sbjct: 648 WVGANDLDKFVSLVGSFACIPLIYIYPPLLHFKAFLNDTSKTMRFRLGLDMLVFVFGIII 707

Query: 451 MVISSTQTI 459
           MV +S +TI
Sbjct: 708 MVYTSWETI 716

>KLLA0E06931g Chr5 (628083..629453) [1371 bp, 456 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119C AVT6
           Vacuolar transporter exports aspartate and glutamate
           from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 456

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 51/249 (20%), Positives = 104/249 (41%), Gaps = 53/249 (21%)

Query: 263 FALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILN 322
           FA  CHHN   I     + SL    KL  ++  ++M +   +G  G+  F D   GNI+ 
Sbjct: 203 FAYTCHHNMFSIINEQSDKSLDSITKLIRIAITLAMSLYISIGALGYCTFGDHITGNIIT 262

Query: 323 NFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSGEATAP----------- 371
            +P+  +   + R      ++  FPL+    R  V  + H+ S   T P           
Sbjct: 263 LYPNSISS-TIGRIAIALLVILAFPLQCHPARASVNHILHYFSKGNTHPPMTTTSAEQNS 321

Query: 372 ----AELSTKKHVA----------------------------VTSALVFLTMTVSLTTCN 399
               +EL + + +                             +TS ++  +  ++++  +
Sbjct: 322 LLRDSELESSEQLTYECEDELIEENSANQPPVVTLEGPRFIFITSGILLFSYILAMSVTS 381

Query: 400 LGALFELIGATTASMMAYILPPL--TNLLLTGRAKTL----RQKLPYYGCI---VFGFAV 450
           L  +  ++GAT ++ +++ILP +    L+ +  AK++    ++++     +   ++GF V
Sbjct: 382 LANVLSIVGATGSTSISFILPGIFGYKLIASEYAKSVVPPAKERILRIISLLLAIWGFIV 441

Query: 451 MVISSTQTI 459
           M+ S + TI
Sbjct: 442 MITSLSATI 450

>CAGL0G03619g Chr7 complement(349789..351171) [1383 bp, 460 aa] {ON}
           similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119c or uniprot|P38176 Saccharomyces cerevisiae
           YBL089w or uniprot|P40501 Saccharomyces cerevisiae
           YIL088c
          Length = 460

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/260 (21%), Positives = 102/260 (39%), Gaps = 59/260 (22%)

Query: 252 PRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLV 311
           P     + +  FA  CHHN   +    K+   K    +  +S  ++ ++  ++G  G++ 
Sbjct: 192 PSPLTTLPIFVFAYTCHHNMFSVINEQKDNRFKTTKYIPLISTSLACILYILIGGCGYMT 251

Query: 312 FKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHF-------- 363
           F DK  GNI+  +P   + I + R      +   FPL+    R  + ++  F        
Sbjct: 252 FGDKIVGNIITLYPHSVSSI-IGRIAIALLVTLAFPLQCHPARSSIHNILAFFYPSLNPD 310

Query: 364 --HSGEATA----------------------------------------PAELSTKKHVA 381
             ++ E TA                                        P E+  K  +A
Sbjct: 311 LKNTQEPTANADTMSSSQLLATERTPLVRSISSIEDNELAEEQGSIKDVPIEMERKLFLA 370

Query: 382 VTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTG-------RAKTL 434
           +T+A++  +  V+++  +L  +  ++GAT ++ +++ILP +    L G       R   L
Sbjct: 371 ITAAILIPSYLVAMSVHSLDKVLAIVGATGSTSISFILPGIFGYRLIGSDGATLTRGDRL 430

Query: 435 RQKLPYYGCIVFGFAVMVIS 454
            +KL     I +GF VM  S
Sbjct: 431 LKKLGLAATI-WGFFVMTAS 449

>NDAI0B03510 Chr2 (882507..883997) [1491 bp, 496 aa] {ON} Anc_2.295
          Length = 496

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 58/111 (52%), Gaps = 4/111 (3%)

Query: 255 FQGI----SVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFL 310
           F+G+    S+I FA     N   +   L++ S++    + + S ++S  +  ++G SG+L
Sbjct: 189 FRGLLSTFSIIIFAYTGAMNLFSMIRELEDISMQNIKNVINGSIIISTGLFLLVGISGYL 248

Query: 311 VFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLA 361
            F    +GNI+ N+  + N I + +FC G  ++ +FPL    LR  V +L 
Sbjct: 249 TFGSNVEGNIILNYNPNSNWIYIGKFCLGTMLILSFPLLFHPLRIAVNNLV 299

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 46/95 (48%), Gaps = 14/95 (14%)

Query: 372 AELSTKKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPL-------TN 424
           A     +   +T+ L+ +   ++L   +   +  LIGAT ++ +++ILP L       T+
Sbjct: 392 AAFPDTRFYGITAFLLIVMYIIALNVKSFALVLALIGATGSTSISFILPGLFGYKLIGTD 451

Query: 425 LLLTGRAKTLRQKLPYYG-----CIVFGFAVMVIS 454
            L  G+   LR +L  Y       + FG AVM++S
Sbjct: 452 SLAIGQMVPLRDRL--YKRLSLLLVFFGLAVMILS 484

>TPHA0C03460 Chr3 complement(757629..759050) [1422 bp, 473 aa] {ON}
           Anc_2.295 YIL088C
          Length = 473

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 60/120 (50%), Gaps = 4/120 (3%)

Query: 249 FITPRIFQGI----SVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVM 304
           +I  R ++G     ++I FA     N   I   L+  S+K  + + + S  +S ++   +
Sbjct: 181 WIKIRDYKGFVTTFNIIIFAFTGAMNLFSIINELEENSMKNISHVINYSIGISTILFLSV 240

Query: 305 GYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFH 364
           G +G+L F   T GNI+ N+  +    NV  FC G  ++ +FPL    LRD V ++  ++
Sbjct: 241 GITGYLTFGSNTVGNIMLNYDPNSVWTNVGNFCLGAMVILSFPLLFHPLRDAVNNIIVYY 300

>Smik_11.90 Chr11 (157718..159760) [2043 bp, 680 aa] {ON} YKL146W
           (REAL)
          Length = 680

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 91/194 (46%), Gaps = 23/194 (11%)

Query: 277 SLKNPSLKRFNKLTHLSCLVSMVV--CFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVA 334
           S+K+P+  R   L+ + C+V++V   C ++ Y+ F       K  +L NFP D +     
Sbjct: 494 SMKHPNHFR-PSLSAVMCIVAVVFISCGLLCYAAF---GSDVKTVVLLNFPQDTSYTLTV 549

Query: 335 RFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSGEATAPAELSTKKHVAVT-------SALV 387
           +  +   +L + PL++F     +R L ++     T P+  S K +  V         A+V
Sbjct: 550 QLLYALAILLSTPLQLF---PAIRILENW-----TFPSNASGKHNPKVKWLKNYFRCAIV 601

Query: 388 FLTMTVSLTTCN-LGALFELIGATTASMMAYILPPLTNLLLTGRAKTLRQKLPY-YGCIV 445
            LT  ++    N L     L+G+     + YI PPL +   +  + T R +L      IV
Sbjct: 602 VLTSVLAWVGANDLDKFVSLVGSFACIPLIYIYPPLLHYKASSISGTSRARLLLDLIVIV 661

Query: 446 FGFAVMVISSTQTI 459
           FG AVMV +S QTI
Sbjct: 662 FGVAVMVYTSWQTI 675

>SAKL0F13134g Chr6 complement(1038673..1040205) [1533 bp, 510 aa]
           {ON} similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119C AVT6 Vacuolar transporter exports aspartate and
           glutamate from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 510

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 52/264 (19%), Positives = 99/264 (37%), Gaps = 65/264 (24%)

Query: 263 FALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILN 322
           FA  CHHNT  I   LK+ S++   K+   +  +++ +   +G SG+  F D   GNI+ 
Sbjct: 245 FAYTCHHNTFSIVNELKDNSVENVRKVVIGAMGLAVCLYIAIGGSGYGTFGDNIGGNIIM 304

Query: 323 NFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAH-------------------- 362
            +P   +   V R      ++  FPL+    R  +  + H                    
Sbjct: 305 LYPHSTST-TVGRIAIVLLVMLAFPLQCHPARASINHIIHHLFEERRGGAQNGEERESNA 363

Query: 363 --------------------FHSGEATAPAE---------------LSTKKHVAVTSALV 387
                                 S E + P +               L  +K V +TS ++
Sbjct: 364 ASKNRTDESACNGNSESSRLVQSTETSIPVDELIEECSARQPKVVPLEGRKFVVITSCIL 423

Query: 388 FLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTLRQKLPY------- 440
             +  ++++  +L  +  ++GAT ++ +++ILP +    L G       ++P+       
Sbjct: 424 IFSYALAVSVTSLARVLAVVGATGSTSISFILPGIFGYQLIGSEYENTSEMPWKTRWTKY 483

Query: 441 --YGCIVFGFAVMVISSTQTILAA 462
                  +G  VMV   + T+L+ 
Sbjct: 484 IALALTCWGLVVMVTCLSATLLSG 507

>Suva_9.112 Chr9 complement(191885..193360) [1476 bp, 491 aa] {ON}
           YIL088C (REAL)
          Length = 491

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 55/102 (53%)

Query: 259 SVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKG 318
           S+I FA     N   +   LK+ S++    + + S  +S ++  ++G SG+L F +KT G
Sbjct: 195 SIIIFAYTGSMNLFPMINELKDNSMENITLVINNSITLSTILFLIVGLSGYLTFGNKTSG 254

Query: 319 NILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDL 360
           N++ N+  +   I + +FC G  ++ +FPL    LR  V ++
Sbjct: 255 NLMLNYDPNSIWIVIGKFCLGSMLILSFPLLFQPLRVAVNNV 296

>Kwal_27.11485 s27 (819908..821323) [1416 bp, 471 aa] {ON} YIL088C -
           Hypothetical ORF [contig 27] FULL
          Length = 471

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 69/150 (46%), Gaps = 4/150 (2%)

Query: 238 AYKGSLTASKLFITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVS 297
           A +G ++  +++    +    +++ FA     N   I   LK+ S+   NK+   +  +S
Sbjct: 177 AIRGDVSWIRVYDFKGLISTFTIVIFAYTGSMNMFSIINELKDNSMTNINKVVSTTITIS 236

Query: 298 MVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVV 357
             +   +G  G+L F   T GNI+ N+  +       + C G  ++ +FPL +   R   
Sbjct: 237 SFLFLAVGLCGYLTFGSNTLGNIMLNYDPNSAWTTTGKLCLGSMVILSFPLLLHPCRIAA 296

Query: 358 RDLAHF---HSGEATAPAELSTKKHVAVTS 384
            ++ H+   + G+  A  +++  +H  VTS
Sbjct: 297 NNMVHWTIINYGKC-ADHQIARNQHTHVTS 325

>KLLA0E08559g Chr5 complement(766878..768260) [1383 bp, 460 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 460

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 51/105 (48%)

Query: 259 SVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKG 318
           S+I FA     N   I   LK  S+    K+ + S +VS     ++G  G+L F  +T G
Sbjct: 188 SIIVFAFTGSMNLFSIINELKENSMTNIKKIINNSIVVSSACFIILGLFGYLTFGKETLG 247

Query: 319 NILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHF 363
           N++ N+ +D   +  ARF  G  ++ +FPL     R    ++ H+
Sbjct: 248 NVILNYDADKLSVRFARFNLGLMVVLSFPLLFHPCRISANNMVHW 292

>TBLA0C03030 Chr3 (732818..734389) [1572 bp, 523 aa] {ON} Anc_5.252
           YKL146W
          Length = 523

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 39/186 (20%), Positives = 78/186 (41%), Gaps = 4/186 (2%)

Query: 277 SLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARF 336
           S+K+P    F K   L  ++  +V   +G  G+  F       +L NFP D+   ++ + 
Sbjct: 336 SMKSP--HHFKKSLILVLVIITLVFITIGLLGYSAFGSNVDTVLLQNFPQDNPCTSLVQL 393

Query: 337 CFGFNMLTTFPLEIFVLRDVVRDLAHFHSGEATAPAELSTKKHVAVTSALVFLTMTVSLT 396
            +   +L + PL++F    ++ +              +   K+   ++ ++  ++   L 
Sbjct: 394 LYSLAILLSTPLQLFPAIKILENWIFSKDASGKYNHSIKWAKNYFRSTIVILTSLISYLG 453

Query: 397 TCNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTLRQK--LPYYGCIVFGFAVMVIS 454
             +L     L+G+     + Y+ PPL +   T    T   K  L  +  + FG   M+ +
Sbjct: 454 ANDLNKFVALVGSFACIPLIYVYPPLLHYKATQLDNTFTWKTLLADFSLLTFGIITMIYT 513

Query: 455 STQTIL 460
           S QTI+
Sbjct: 514 SLQTII 519

>SAKL0E07392g Chr5 (602503..603921) [1419 bp, 472 aa] {ON} similar
           to uniprot|P40501 Saccharomyces cerevisiae YIL088C AVT7
           Putative transporter member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 472

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 56/124 (45%)

Query: 240 KGSLTASKLFITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMV 299
           +G +   K++    +    S+I FA  C  N   I   L + S+    K+ + S  ++  
Sbjct: 177 RGDVFWVKVYDYNGLISTFSIIIFAYTCTMNIFSIINELTDNSVSNVTKVANSSIGIATF 236

Query: 300 VCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRD 359
           +   +G +G+L F     GNI+ N+  D     V +FC G  ++ +FPL     R    +
Sbjct: 237 LILSVGITGYLTFGSNVLGNIILNYDPDSIWTRVGKFCLGCMVVLSFPLMFHPCRLATNN 296

Query: 360 LAHF 363
           + H+
Sbjct: 297 MVHW 300

>Kpol_1045.20 s1045 (42443..43843) [1401 bp, 466 aa] {ON}
           (42445..43845) [1401 nt, 467 aa]
          Length = 466

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 80/202 (39%), Gaps = 9/202 (4%)

Query: 167 DTIPHVLRAFFPAHTALFHRNAIIFFVTLFVSYPLSLNRDXXXXXXXXXXXXXXXXXXXX 226
           D +P VL  F   H  L +RN  I  V LF+  PL   ++                    
Sbjct: 104 DVLPQVLSTF-TNHEWLLNRNVNITLVMLFIVTPLCFLKNLNSLRYASMLAISSVAYLCA 162

Query: 227 XXXXXGPMLDAA---YKGSLTAS--KLFITPRIFQGISVISFALVCHHNTSFIYFSLKNP 281
                  M +     +KG ++    K  + P     + +  FA  CHHN   +     +P
Sbjct: 163 LVLIHFIMPNDETHNFKGDVSWGLPKNGLNP--LTTLPIYVFAYTCHHNMFSVINEQMDP 220

Query: 282 SLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFN 341
           +     K+  +S +++  +  ++G +G+L F D   GNI+  +P + +   + R    F 
Sbjct: 221 TYNSVKKIAIISMILAGFLYILIGGAGYLTFGDHITGNIITLYPQNIST-TIGRIAIIFL 279

Query: 342 MLTTFPLEIFVLRDVVRDLAHF 363
           +   FPL+    R  +  + H+
Sbjct: 280 VTLAFPLQCHPARASINHIIHY 301

>Smik_9.97 Chr9 complement(176731..178203) [1473 bp, 490 aa] {ON}
           YIL088C (REAL)
          Length = 490

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 53/102 (51%)

Query: 259 SVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKG 318
           S+I FA     N   +   LK+ S++    + + S  +S  +  ++G SG+L F +KT G
Sbjct: 195 SIIIFAYTGSMNLFPMINELKDNSMENITSVINNSISLSTALFLIVGLSGYLTFGNKTLG 254

Query: 319 NILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDL 360
           N++ N+      I + +FC G  ++ +FPL    LR  V ++
Sbjct: 255 NLILNYDPTSIWIVIGKFCLGLMLILSFPLLFQPLRIAVNNV 296

>KAFR0J01320 Chr10 (241859..243298) [1440 bp, 479 aa] {ON} Anc_2.295
           YIL088C
          Length = 479

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 68/135 (50%), Gaps = 6/135 (4%)

Query: 255 FQGI----SVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFL 310
           F+G+    S+I FA     N   I   LKN S++  + + + S  +S ++   +G +G+L
Sbjct: 187 FKGLLSTFSIIIFAYTGAMNLFSIINELKNNSMENVSSIINHSISISTILFLTVGIAGYL 246

Query: 311 VFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSGEATA 370
            F   T GNIL N+ +D   +++A+FC    ++ +FPL    LR  V +L  +       
Sbjct: 247 TFGCNTLGNILLNYDADSVWVSIAKFCLAIMLVLSFPLLFHPLRIAVNNLVVWLEINYGT 306

Query: 371 PAELSTKKHVAVTSA 385
           P + S  +H + T+ 
Sbjct: 307 PQQRS--QHYSQTAV 319

>YKL146W Chr11 (171783..173861) [2079 bp, 692 aa] {ON}  AVT3Vacuolar
           transporter, exports large neutral amino acids from the
           vacuole; member of a family of seven S. cerevisiae genes
           (AVT1-7) related to vesicular GABA-glycine transporters
          Length = 692

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 91/199 (45%), Gaps = 33/199 (16%)

Query: 277 SLKNPSLKRFN-KLTHLSCLVSMVV--CFVMGYSGFLVFKDKTKGNILNNFPSDDNVINV 333
           S+K+P  K F   L+ + C+V+++   C ++ Y+ F       K  +L NFP D +    
Sbjct: 506 SMKHP--KHFRPSLSAVMCIVAVIFISCGLLCYAAF---GSDVKTVVLLNFPQDTSYTLT 560

Query: 334 ARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSGEATAPAELSTKKHVAVT-------SAL 386
            +  +   +L + PL++F     +R L ++     T P+  S K +  V         A+
Sbjct: 561 VQLLYALAILLSTPLQLF---PAIRILENW-----TFPSNASGKYNPKVKWLKNYFRCAI 612

Query: 387 VFLTMTVSLTTCN-LGALFELIGATTASMMAYILPPLTN-----LLLTGRAKTLRQKLPY 440
           V LT  ++    N L     L+G+     + YI PPL +     L  T RA+ L   +  
Sbjct: 613 VVLTSILAWVGANDLDKFVSLVGSFACIPLIYIYPPLLHYKASILSGTSRARLLLDLI-- 670

Query: 441 YGCIVFGFAVMVISSTQTI 459
              IVFG AVM  +S QTI
Sbjct: 671 --VIVFGVAVMAYTSWQTI 687

>AGL285C Chr7 complement(175831..177153) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER119C
           (AVT6) and YBL089W (AVT5)
          Length = 440

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 90/204 (44%), Gaps = 28/204 (13%)

Query: 263 FALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILN 322
           FA  CHHN   I   L++ SL    ++   +  +++ +   +G +G+L F D   GNI+ 
Sbjct: 204 FAYTCHHNMFSIVNELRDNSLGACLRVVVAAIALAVALYATIGGAGYLTFGDHITGNIIA 263

Query: 323 NFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHF----HS---GEATA----- 370
            +P       + R      ++  FPL+    R  +  + H+    H+    EA+A     
Sbjct: 264 QYPPAP-ATTLGRAAIAVLVMLAFPLQCHPARASINHIWHYCIPSHTVAPSEASALIRGG 322

Query: 371 --PAE-------------LSTKKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMM 415
             PA+             L   +  A+T+AL+  +  V+++  +L  +  ++GAT ++ +
Sbjct: 323 SPPADAAEGPGNEPAAVPLGPPRFAAITAALLIASYAVAVSVTSLARVLAVVGATGSTAI 382

Query: 416 AYILPPLTNLLLTGRAKTLRQKLP 439
           ++ILP L    L G      Q  P
Sbjct: 383 SFILPGLFGYQLIGSESRADQLPP 406

>Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON}
           complement(5011..7074) [2064 nt, 688 aa]
          Length = 687

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 90/207 (43%), Gaps = 27/207 (13%)

Query: 277 SLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARF 336
           S+++PS  +F  +  L  + + V+  ++   G+L +   T+  IL NFP  + V+N+ + 
Sbjct: 482 SMRDPS--KFPLVLGLVMICTTVMFIIIATIGYLSYGSSTETIILQNFPQKNIVVNLIQL 539

Query: 337 CFGFNMLTTFPLEIFVLRDVVRDLAH------------------FHSGEATAPAELSTKK 378
            +   +L + PL+IF   ++V D                     +++        +   K
Sbjct: 540 FYALAILLSTPLQIFPAIEIVEDKIFPKPGSDPECKDEIPITTIYNANSGGLDWRIKWFK 599

Query: 379 HVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNL------LLTGRAK 432
           ++  T  +  + +     + NL  L  +IG+     + Y+ PP+ +L      +  G+  
Sbjct: 600 NMIRTMIVTCVILLAYFGSNNLDKLVAIIGSLACIPLVYMYPPMLHLKTYSIPMSKGKRF 659

Query: 433 TLRQKLPYYGCIVFGFAVMVISSTQTI 459
           T  +   Y   IVFG   MV ++ Q+I
Sbjct: 660 TWSKSFDYI-LIVFGGVSMVYTTYQSI 685

>Skud_5.260 Chr5 (420651..421997) [1347 bp, 448 aa] {ON} YER119C
           (REAL)
          Length = 448

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 83/206 (40%), Gaps = 40/206 (19%)

Query: 263 FALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILN 322
           FA  CHHN   I    ++   +   K+  ++  +++++   +G +G+L F D   GNI+ 
Sbjct: 204 FAYTCHHNMFSIINEQRSSRFEHVMKIPLIAISLALILYVAIGCAGYLTFGDNIIGNIIM 263

Query: 323 NFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRD-LAHFHSGEATA----------- 370
            +P   +   V R      ++  FPL+    R  +   L HF    AT            
Sbjct: 264 LYPQTTSS-TVGRVAIVLLVMLAFPLQCHPARASIHQILQHFTEENATISTTSTSSPAPT 322

Query: 371 -------------------------PAE--LSTKKHVAVTSALVFLTMTVSLTTCNLGAL 403
                                    P E  L  K  + +T A++  +  V+++  +L  +
Sbjct: 323 NESSPLIRDNSLDINEVIEEESIYQPKETPLKGKSFIVITCAILIASYFVAISVSSLARV 382

Query: 404 FELIGATTASMMAYILPPLTNLLLTG 429
             ++GAT ++ +++ILP L    L G
Sbjct: 383 LAIVGATGSTSISFILPGLFGYKLIG 408

>TPHA0K00670 Chr11 (132771..134165) [1395 bp, 464 aa] {ON} Anc_7.420
           YER119C
          Length = 464

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/238 (20%), Positives = 87/238 (36%), Gaps = 61/238 (25%)

Query: 258 ISVISFALVCHHNTSFIYFSLKNPSLK-RFNKLTHLSCLVSMVVC---FVMGYSGFLVFK 313
           + +  FA  CHHN     FS+ N      FNKL  +     ++ C    ++G SG+L F 
Sbjct: 197 LPIFVFAYTCHHNM----FSVINEQQDIHFNKLKQICIFAMLLACTLYIIIGGSGYLTFG 252

Query: 314 DKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHF---------- 363
           +   GNI+  + S+     V R      ++  FPL+    R  +  + H+          
Sbjct: 253 NAITGNIITLY-SNSAATTVGRIAIVILVMLAFPLQCHPARASINHILHYFQLINCDNNQ 311

Query: 364 ----HSGEATA--------------------------------------PAELSTKKHVA 381
                SG   +                                      P  L  K    
Sbjct: 312 VQESESGHRESSGLIDNEITPQPQLQEAFEQPPDEVVEEEFPEQQKSFEPVTLDPKTFTV 371

Query: 382 VTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTLRQKLP 439
           VT  ++  +  ++++  +L  +  ++GAT ++ +A+ILP +    L G   +  Q +P
Sbjct: 372 VTICILICSYILAVSVTSLAKVLAIVGATGSTSIAFILPGVFGYQLIGSEYSTSQIVP 429

>KNAG0A05380 Chr1 (791957..793381) [1425 bp, 474 aa] {ON} Anc_2.295
           YIL088C
          Length = 474

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 58/121 (47%)

Query: 240 KGSLTASKLFITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMV 299
           +G++   +++    +    S+I FA V   N   I   L + ++   +K+ + S  +S V
Sbjct: 178 RGTILWFEIYSGKGLLSTFSIIIFAYVGAMNLFTIINELSDNNITNISKIINRSIAISTV 237

Query: 300 VCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRD 359
               +G +G+L F   T GNI+ N+  +   +N+ +F     +L +FPL    LR    +
Sbjct: 238 AFLSVGITGYLTFGSNTLGNIILNYDPNSIWVNIGKFSLASMLLLSFPLLFHPLRIACNN 297

Query: 360 L 360
           L
Sbjct: 298 L 298

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 46/89 (51%), Gaps = 12/89 (13%)

Query: 377 KKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPL-------TNLLLTG 429
            +  ++T  L+ +   ++L   +   +  L+GAT ++ +++ILP L       ++ L  G
Sbjct: 378 SRFYSITVGLLVVMYLIALRITSFALVLALVGATGSTSISFILPGLFGYKLIGSDSLAVG 437

Query: 430 RAKTLRQKLPYYGC----IVFGFAVMVIS 454
           +  + R +  Y  C    + FGFAVM++S
Sbjct: 438 QMISPRDRF-YKKCSLALVWFGFAVMILS 465

>ZYRO0A02112g Chr1 complement(171184..172587) [1404 bp, 467 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 467

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 59/134 (44%)

Query: 240 KGSLTASKLFITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMV 299
           +G ++   ++    +    S+I FA     N   I   L+N ++     + + S  ++ V
Sbjct: 175 RGDISWWSVYDYKGLMSTFSIIIFAYTGSMNLFSIVNELRNNTMTNITAVVNRSIAIATV 234

Query: 300 VCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRD 359
               +  +G+L F   T GNI+ N+      +++ +FC G  ++ TFPL     R  V +
Sbjct: 235 FFIAVALAGYLTFGSNTLGNIMLNYDDTSIYVHIGKFCLGSMVVLTFPLLFHPCRIAVNN 294

Query: 360 LAHFHSGEATAPAE 373
           L  +   +    AE
Sbjct: 295 LCVWAQLQREKRAE 308

>YIL088C Chr9 complement(197931..199403) [1473 bp, 490 aa] {ON}
           AVT7Putative transporter, member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 490

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 58/110 (52%), Gaps = 4/110 (3%)

Query: 255 FQGI----SVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFL 310
           F+G+    S+I FA     N   +   LK+ S++    + + S  +S  +  ++G SG+L
Sbjct: 187 FKGLLSTFSIIIFAFTGSMNLFPMINELKDNSMENITFVINNSISLSTALFLIVGLSGYL 246

Query: 311 VFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDL 360
            F ++T GN++ N+  +   I + +FC G  ++ +FPL    LR  V ++
Sbjct: 247 TFGNETLGNLMLNYDPNSIWIVIGKFCLGSMLILSFPLLFHPLRIAVNNV 296

>KLTH0G10604g Chr7 complement(895162..896568) [1407 bp, 468 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7
          Length = 468

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 56/125 (44%)

Query: 239 YKGSLTASKLFITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSM 298
           ++G ++   ++    +    ++I FA     N   I   LK+ S++  NK+   S   S 
Sbjct: 175 FRGDVSWIGVYDKKGLVSTFTIIVFAFTASMNLFSIINELKDNSMQNINKVITSSISTSA 234

Query: 299 VVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVR 358
            +   +G  G+L F     GNI+ N+  +     + + C G  ++ +FPL +   R    
Sbjct: 235 ALFLSVGVCGYLTFGSNVVGNIMLNYDPESIWTTIGKLCLGTMVILSFPLLLHPCRIAAN 294

Query: 359 DLAHF 363
           ++ H+
Sbjct: 295 NMMHW 299

>TPHA0F01700 Chr6 complement(387868..389202) [1335 bp, 444 aa] {ON}
           Anc_2.177 YNL101W
          Length = 444

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 74/185 (40%), Gaps = 29/185 (15%)

Query: 284 KRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNML 343
           K F K+  L  L   ++  ++G  G+L + +K K  IL +F +    +N+   CF   +L
Sbjct: 237 KDFPKILLLVMLTMSIIFILIGTCGYLSYGEKIKVIILQSF-APGIFVNIIIVCFTIGIL 295

Query: 344 TTFPLEIFVLRDVVRDLAHFHSGEATAPAELST-----------------KKHVAVTSAL 386
            + PL++F L  ++ D        A A  +L                    KH+ +    
Sbjct: 296 LSTPLQLFSLTSLLEDFLFTKKKIAVADEDLKVLEESDILCSESDTEAQGTKHINLRVYK 355

Query: 387 VFLTMTVSLTTCNLG--------ALFELIGATTASMMAYILPPLTNLL---LTGRAKTLR 435
           + L   +  T C +G         L  ++G+     + YI PPL NL    L G  K   
Sbjct: 356 IILRFLIVTTVCLIGYITSDKLNKLVAIVGSLACIPLVYIYPPLLNLYECSLPGIIKNNW 415

Query: 436 QKLPY 440
             LP+
Sbjct: 416 SILPF 420

>Skud_11.81 Chr11 (157889..160027) [2139 bp, 712 aa] {ON} YKL146W
           (REAL)
          Length = 712

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 92/197 (46%), Gaps = 23/197 (11%)

Query: 274 IYFSLKNPSLKRFNKLTHLSCLVSMVV--CFVMGYSGFLVFKDKTKGNILNNFPSDDNVI 331
           I  S+++P+  R   L+ + C+V++V   C ++ Y+ F       K  +L NFP + +  
Sbjct: 523 IQESMRHPNHFR-PSLSAVMCIVAVVFISCGLLCYAAF---GADVKTVVLLNFPQNSSYT 578

Query: 332 NVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSGEATAPAELSTKKHVAVT-------S 384
              +  +   +L + PL++F     +R L ++     T P+  S K +  V         
Sbjct: 579 LTVQLLYALAILLSTPLQLF---PAIRILENW-----TFPSNASGKHNPKVKWLKNYFRC 630

Query: 385 ALVFLTMTVSLTTCN-LGALFELIGATTASMMAYILPPLTNLLLTGRAKTLRQKLPYYGC 443
           A+V LT  ++    N L     L+G+     + YI PPL +   +  + T R +L     
Sbjct: 631 AIVLLTSILAWVGANDLDKFVSLVGSFACVPLIYIYPPLLHFKASSISGTSRGRLLLDLI 690

Query: 444 IV-FGFAVMVISSTQTI 459
           ++ FG AVMV +S QTI
Sbjct: 691 VISFGVAVMVYTSWQTI 707

>YER119C Chr5 complement(399496..400842) [1347 bp, 448 aa] {ON}
           AVT6Vacuolar aspartate and glutamate exporter; member of
           a family of seven genes (AVT1-7) related to vesicular
           GABA-glycine transporters; involved in
           compartmentalizing acidic amino acids in response to
           nitrogen starvation
          Length = 448

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 50/255 (19%), Positives = 105/255 (41%), Gaps = 45/255 (17%)

Query: 254 IFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFK 313
           +   + +  FA  CHHN   I    ++   +   K+  ++  +++++   +G +G+L F 
Sbjct: 195 VLNTLPIFVFAYTCHHNMFSIINEQRSSRFEHVMKIPLIAISLALILYIAIGCAGYLTFG 254

Query: 314 DKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIF---------------------- 351
           D   GNI+  +P   +   + R      ++  FPL+                        
Sbjct: 255 DNIIGNIIMLYPQAVSS-TIGRIAIVLLVMLAFPLQCHPARASIHQILQHFAEENVSISA 313

Query: 352 --------------VLRDVVRDLAHFHSGEAT-APAE--LSTKKHVAVTSALVFLTMTVS 394
                         ++RD   DL      E+   P E  L  K  + +T +++  +  V+
Sbjct: 314 TSADEPTVATESSPLIRDSSLDLNEVIEEESIYQPKETPLRGKSFIVITCSILVASYLVA 373

Query: 395 LTTCNLGALFELIGATTASMMAYILPPLTNLLLTG----RAKTLRQKL-PYYGCIVFGFA 449
           ++  +L  +  ++GAT ++ +++ILP L    L G     A  L  K+  Y G ++F + 
Sbjct: 374 ISVSSLARVLAIVGATGSTSISFILPGLFGYKLIGTEHKTAVPLTTKIFKYTGLLLFIWG 433

Query: 450 VMVISSTQTILAAIN 464
           ++++ +  T    +N
Sbjct: 434 LIIMITCLTAALKLN 448

>YBL089W Chr2 (49574..50953) [1380 bp, 459 aa] {ON}  AVT5Putative
           transporter, member of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 459

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 48/235 (20%), Positives = 99/235 (42%), Gaps = 44/235 (18%)

Query: 263 FALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILN 322
           FA  CHHN   +     + S K   ++   + +++  +  ++G +G++ F +   GNIL 
Sbjct: 214 FAYTCHHNMFSVINEQVDKSFKVIRRIPIFAIVLAYFLYIIIGGTGYMTFGENIVGNILT 273

Query: 323 NFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDL----AHFHSGE----------- 367
            +P+  +   + R      ++  FPL+    R  V+++     +F  G+           
Sbjct: 274 LYPNSIST-TIGRLAMLLLVMLAFPLQCHPCRSSVKNIIIFIENFRKGKLYDNRASFIPL 332

Query: 368 ----ATAPAELSTK-------------KHV-AVTSALVFLTMTVSLTTCNLGALFELIGA 409
               +  P E  T+             +H+  +T  ++  +  ++++  +L  +  ++GA
Sbjct: 333 DNFNSEDPQEAPTQQNNEEPNLRSESLRHINIITLCILLFSYLLAISITSLAKVLAIVGA 392

Query: 410 TTASMMAYILPPLTNLLLTG--------RAKTLRQKLPY--YGCIVFGFAVMVIS 454
           T ++ +++ILP L    L G        R  T  +   Y      ++G AVMV S
Sbjct: 393 TGSTSISFILPGLFGYKLIGSEFTGTNERVPTSIKIFKYLSLSLFIWGIAVMVAS 447

>Suva_5.240 Chr5 complement(375238..376584) [1347 bp, 448 aa] {ON}
           YER119C (REAL)
          Length = 448

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 84/445 (18%), Positives = 157/445 (35%), Gaps = 58/445 (13%)

Query: 67  SNIYMAFMNMANSILGAGIIGQPFAINNCGLAGGVAAIVLL--TLLVDWTIRLIVVNLKL 124
           ++I    + + ++  GAGI+  P+A    GL  GV  IV+     +    I+  V     
Sbjct: 3   TSIRSGVLTLLHTACGAGILAMPYAFKPFGLVPGVVMIVICGACAMQSLLIQARVARYVA 62

Query: 125 TGKTTYQDSVEFAMGRRGKLLILAANGLFAXXXXXXXXXXXXDTIPHVLRAFFPAHTALF 184
            GK ++         R   +  LA   +              D +P ++ ++   +  L 
Sbjct: 63  PGKASFSTLTRLINPRLSIVFDLAI-AVKCFGVGVSYMIVVGDLMPQIMSSW-TGNAWLL 120

Query: 185 HRNAIIFFVTLFVSYPLS-LNRDXXXXXXXXXXXXXXXXXXXXXXXXXGPMLDAAYKGSL 243
            RN  I  + LF   PLS L +                              D   +   
Sbjct: 121 SRNVQISLIMLFFVAPLSFLKKLNSLRYASMVAISSVAYLCVLVLVHYVVPSDEILRLKG 180

Query: 244 TASKLFITPR------IFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVS 297
             S LF  P+          + +  FA  CHHN   I    K+   +   K+  +S  ++
Sbjct: 181 RVSYLF--PQQSHDLNFLNTLPIFVFAYTCHHNMFSIINEQKSVRFEHVMKIPLISISLA 238

Query: 298 MVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVV 357
           + +   +G +G+L F D   GNI+  +P   +   V R      ++  FPL+    R  +
Sbjct: 239 LALYIAIGCAGYLTFGDNIIGNIIMLYPQTVSS-TVGRIAIVLLVMLAFPLQCHPARASI 297

Query: 358 RDLAHFHSGE----------------ATAP-----------------------AELSTKK 378
             +  + + E                 ++P                         L  K 
Sbjct: 298 HQILQYFTEENATTSTTSVAGRTVTNESSPLIRNNSIDINEVIEEEPIYQPKDTPLRGKS 357

Query: 379 HVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTLRQKL 438
            + +T  ++  +  V+++  +L  +  ++GAT ++ +++ILP L    L G        L
Sbjct: 358 FIIITCGILVASYCVAISVSSLAHVLAIVGATGSTSISFILPGLFGYKLIGTEHKADIPL 417

Query: 439 P-----YYGCIVFGFAVMVISSTQT 458
           P     Y G  +F   ++++ +  T
Sbjct: 418 PTRLFKYSGLALFVLGLLIMVTCLT 442

>NCAS0F02310 Chr6 complement(458165..460171) [2007 bp, 668 aa] {ON}
           Anc_5.252 YKL146W
          Length = 668

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 76/176 (43%), Gaps = 8/176 (4%)

Query: 291 HLSCLVSMVVCFVM------GYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLT 344
           H S  +SMV+C V       G   +  F  K +  +L NFP D     + +  +   +L 
Sbjct: 489 HFSKCLSMVMCIVTVIFISCGLLCYSAFGSKVETVVLLNFPHDSPYTLMVQLLYALAILL 548

Query: 345 TFPLEIFVLRDVVRDLAHFHSGEATAPAELSTKKHVAVTSALVFLTMTVSLTTCN-LGAL 403
           + PL++F    ++ +     S       ++   K+      +V LT  ++    N L   
Sbjct: 549 STPLQLFPAIKILENWCFPISASGKNNPKVKWLKNY-FRCIIVLLTAFIAYVGANDLDKF 607

Query: 404 FELIGATTASMMAYILPPLTNLLLTGRAKTLRQKLPYYGCIVFGFAVMVISSTQTI 459
             L+G+     + YI PPL +L      +T+ + +     ++FG AVM  +S QTI
Sbjct: 608 VSLVGSFACIPLIYIYPPLLHLKAYWGEQTILRMVLDSLVLIFGVAVMGYTSWQTI 663

>TBLA0F01390 Chr6 complement(342433..343719) [1287 bp, 428 aa] {ON} 
          Length = 428

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/235 (19%), Positives = 102/235 (43%), Gaps = 39/235 (16%)

Query: 255 FQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKD 314
           F+ + +  FA  CHHN   +    K+   KR   +  ++  ++ ++  ++G  G+  F  
Sbjct: 187 FKTLPIFVFAYTCHHNMFAVINEQKHTDFKRLKFIPLIAISIACILYLIVGCLGYATFGA 246

Query: 315 KTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDL-------------- 360
               NI+  +P++  +  + +      +   +PL+    R  + ++              
Sbjct: 247 NITSNIVAKYPTNSVLTVLGQTAMLTVVTLAYPLQCQPARASILNILYALFPKLKNNKSD 306

Query: 361 ---AHFHSG---------EATAP----AELSTKKHVAVTSALVFLTMTVSLTTCNLGALF 404
              A  + G         + + P    +E S   H  VTS ++F +  ++++  +L  + 
Sbjct: 307 VEEASMNDGYQVDLEENKQQSEPERIISEPSIILHSIVTSLILFGSWCIAVSVNSLAQVL 366

Query: 405 ELIGATTASMMAYILPPLTNLLLT------GRAKTLRQKLPYYGCIVFGFAVMVI 453
            ++GAT ++ +++ILP L  ++L       G+ KTL     + G I+ G+ + V+
Sbjct: 367 AIVGATGSTFISFILPGLFAVVLIPKDNDFGKGKTLWI---WIGGILMGWGISVM 418

>Skud_9.86 Chr9 complement(173889..175361) [1473 bp, 490 aa] {ON}
           YIL088C (REAL)
          Length = 490

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 4/110 (3%)

Query: 255 FQGI----SVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFL 310
           F+G+    S+I FA     N   +   LK+ S+     + + S  +S  +  ++G SG+L
Sbjct: 187 FKGLLSTFSIIIFAYTGSMNLFPMINELKDNSMGNITLVINNSISLSTALFLIVGLSGYL 246

Query: 311 VFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDL 360
            F + T GN++ N+  +   I + +FC G  ++ +FPL    LR  V ++
Sbjct: 247 TFGNSTLGNLILNYDPNSVWIIIGKFCLGSMLILSFPLLFQPLRVAVNNV 296

>Ecym_7133 Chr7 (264196..265569) [1374 bp, 457 aa] {ON} similar to
           Ashbya gossypii AGL285C
          Length = 457

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/202 (19%), Positives = 83/202 (41%), Gaps = 45/202 (22%)

Query: 263 FALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILN 322
           FA  CHHN   I   L++ SL    ++  ++  +++ +  V+G SG+L F D   GNI+ 
Sbjct: 204 FAYTCHHNMFSIVNELRDNSLTNCVRVVLIAMGLAVSLYTVIGGSGYLTFGDNITGNIVT 263

Query: 323 NFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHF------------------- 363
            +P   +   +AR      ++  FPL+    R  + ++  +                   
Sbjct: 264 IYPRSVSS-TLARIAIVLLVMLAFPLQCHPARASINNIWCYFSESKIFSPLANEESGLMR 322

Query: 364 HSGEATAPAE-------------------------LSTKKHVAVTSALVFLTMTVSLTTC 398
           H G    P                           +  K+   +T++++  + T++++  
Sbjct: 323 HEGSPRTPPSNNEFSISPDWSPLQTSSQPIPTTTTIEGKRFFVITTSILIASYTLAVSVS 382

Query: 399 NLGALFELIGATTASMMAYILP 420
           +   +  ++GAT ++ +++ILP
Sbjct: 383 SFARVLAIVGATGSTSISFILP 404

>Kwal_23.2839 s23 (38499..40343) [1845 bp, 614 aa] {ON} YKL146W -
           Hypothetical ORF [contig 246] FULL
          Length = 614

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 86/195 (44%), Gaps = 25/195 (12%)

Query: 277 SLKNPSLKRFNKL---THLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINV 333
           S+K+P  ++F+K       S  V+ +VC ++ YS F    D  K  IL NFP D  +   
Sbjct: 428 SMKHP--EKFSKCLFGVMASVSVAFIVCGLLCYSAF---GDSVKIVILLNFPRDSAMTAT 482

Query: 334 ARFCFGFNMLTTFPLEIF-VLRDVVRDLAHFHSGEATAPAELSTKKHVAVTSALVFLTMT 392
            +  +   +L + PL++F ++R +   +    +     P     K +  V  A+V L M 
Sbjct: 483 VQLLYALAILLSTPLQLFPIIRILETSIFPKDASGKYNPRVKWMKNYFRV--AIVLLNML 540

Query: 393 VSLTTCN-LGALFELIGATTASMMAYILPPLTNLLLTGRAKTLRQ----KLPYYG---CI 444
           ++    N L     L+G+     + YI PP+ +       KT  Q    KL   G     
Sbjct: 541 IAWLGANDLDKFVSLVGSFACIPLIYIYPPMLHY------KTFAQGGASKLALLGDQLIA 594

Query: 445 VFGFAVMVISSTQTI 459
            FG AVM+ ++ Q +
Sbjct: 595 FFGVAVMIYTTYQAV 609

>Skud_2.19 Chr2 (33154..34533) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/241 (19%), Positives = 100/241 (41%), Gaps = 46/241 (19%)

Query: 263 FALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILN 322
           FA  CHHN   +     +   +   ++  ++  ++ V+  ++G +G++ F     GNIL 
Sbjct: 214 FAYTCHHNMFSVINEQADKGFRILKRIPIIAISLAFVLYVIIGGAGYMTFGKNIVGNILT 273

Query: 323 NFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDL----AHFHSG------------ 366
            +P+  +   + R      ++  FPL+    R  ++++     +F  G            
Sbjct: 274 LYPNSVST-TIGRLAMLLLVMLAFPLQCHPCRSSIKNIIIFIENFRKGKLQENRDDCIPL 332

Query: 367 ------------------EATAPAELSTKKHVAVTSALVFLTMTVSLTTCNLGALFELIG 408
                             +   P+E S   ++ +T  ++  +  ++++  +L  +  ++G
Sbjct: 333 DVLSSVNSQEESRQQNNEQQNFPSESSRHTNI-ITLCILGSSYLLAISITSLAKVLAIVG 391

Query: 409 ATTASMMAYILPPLTNLLLTGRAKTLRQK--------LPYYGCIVF--GFAVMVISSTQT 458
           AT ++ +++ILP L    L G     R +        L Y G ++F  G  VM+ S + T
Sbjct: 392 ATGSTSISFILPGLFGYKLIGSEYISRDERVPASVKILKYLGLLLFIWGIVVMIASLSAT 451

Query: 459 I 459
           +
Sbjct: 452 V 452

>Smik_5.264 Chr5 complement(408587..409933) [1347 bp, 448 aa] {ON}
           YER119C (REAL)
          Length = 448

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/215 (20%), Positives = 83/215 (38%), Gaps = 40/215 (18%)

Query: 254 IFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFK 313
           +   + +  FA  CHHN   I    ++   +   K+  ++  +++++   +G +G+L F 
Sbjct: 195 VLNTLPIFVFAYTCHHNMFSIINEQRSSRFEHIMKIPLIAVSLALILYIAIGCTGYLTFG 254

Query: 314 DKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRD-LAHFHSGEATA-- 370
           D   GNI+  +P   +   V R      ++  FPL+    R  +   L H      T   
Sbjct: 255 DNIIGNIIMLYPQTVSS-TVGRIAIVLLVMLAFPLQCHPARASIHQILQHLERENITTST 313

Query: 371 ----------------------------------PAE--LSTKKHVAVTSALVFLTMTVS 394
                                             P E  L  K  V +T  ++  +  V+
Sbjct: 314 TSVSGPTFANENSPLMGDRGLDINEVIEEESIYQPKETSLKGKSFVFITCGILLASYLVA 373

Query: 395 LTTCNLGALFELIGATTASMMAYILPPLTNLLLTG 429
           ++  +L  +  ++GAT ++ +++ILP L    L G
Sbjct: 374 ISVSSLARVLAIVGATGSTSISFILPGLFGYKLIG 408

>Ecym_8249 Chr8 (510061..511944) [1884 bp, 627 aa] {ON} similar to
           Ashbya gossypii ACR051C
          Length = 627

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 98/456 (21%), Positives = 173/456 (37%), Gaps = 85/456 (18%)

Query: 49  ADVEDPLVSGIVTENQT----------KSNIYMAFMNMANSILGAGIIGQPFAINN---- 94
           +D E+PL+ G V E  +          K++++   + +  + +G G++  P    N    
Sbjct: 207 SDEEEPLL-GTVEERSSSATRSGGRKGKASVFKTVLLLLKAFVGTGVLFMPKGFQNGGWL 265

Query: 95  ----CGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQDSVEFAMGRRGKL--LILA 148
               C +  GV +     LL++      V      G+  Y  S++     RG L  ++L+
Sbjct: 266 FSCGCLIFFGVVSCFCFLLLIEAKTEACVNGYGDLGRVAYGKSMQ-----RGILASIVLS 320

Query: 149 ANGLFAXXXXXXXXXXXXDTIPHVLRAFFPAHTALFHRNAIIFFVTLFVSYPLSLNRDXX 208
             G  A                  L+ FF       HR ++  F+ L V  PL+L R   
Sbjct: 321 QIGFSAAYTIFTATN---------LQVFFGEVFGWSHRLSVYIFLQLVVYLPLALTRRIS 371

Query: 209 XXXXXXXXXXXXXXXXXXXXXXXGPMLDAAYKGSLTASKLFITP--RIFQGISVISFALV 266
                                    +    Y  +  + K+F      +F G ++ ++  +
Sbjct: 372 RLSGTALAADVLILFGLVYVYGYSAVYVLRYGVASQSMKMFNRQDWTLFVGTAIFTYEGI 431

Query: 267 CHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVV--------CFVMGYSGFLVFKDKTKG 318
                  I  S+  P   RF      SCLV ++         C ++ YS F     + + 
Sbjct: 432 GLLVP--IQESMSRPG--RFA-----SCLVWVIAAVTSIFISCGLLCYSAF---GSRVET 479

Query: 319 NILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSGEATAPAELSTKK 378
            IL NFP D  + +  +F +   ++ + PL++F     +R L H         + +S K 
Sbjct: 480 VILLNFPKDSVLSSSVQFLYAMAIMLSTPLQLF---PAIRILEH-----GIISSSVSGKH 531

Query: 379 HVAVTSA-------LVFLTMTVSLTTC-NLGALFELIGATTASMMAYILPPLTNLLL--- 427
              V  A       +VF+T++++     +L     LIG+     + YI PPL + +L   
Sbjct: 532 DPRVKWAKNWFRVLVVFVTVSIAWVGADDLDKFVSLIGSFACVPLIYIYPPLLHYMLFKG 591

Query: 428 TGRAKT----LRQKLPYYGCIVFGFAVMVISSTQTI 459
           TGR       L Q + ++G I      M  +S+QT+
Sbjct: 592 TGRVSNAALFLDQLVVWFGVI-----GMFYTSSQTV 622

>Smik_2.31 Chr2 (43199..44578) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/270 (17%), Positives = 106/270 (39%), Gaps = 56/270 (20%)

Query: 233 PMLDAAYKGSLTASKLFITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHL 292
           P  D++    LT   +F+            FA  CHHN   +     + + +   ++   
Sbjct: 196 PHRDSSSHSPLTTLPIFV------------FAYTCHHNMFSVINEQTDKTFRILRRIPIF 243

Query: 293 SCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFV 352
           +   + ++  ++G +G++ F +   GNIL  +P+  +   + R      ++  FPL+   
Sbjct: 244 AISFAYILYLIIGGAGYMTFGENIVGNILTLYPNSIST-TIGRLAMLLLVMLAFPLQCHP 302

Query: 353 LRDVVRDLAHF---------------------------------HSGEATAPAELSTKKH 379
            R  ++++  F                                  S E       S +  
Sbjct: 303 CRSSIKNIFIFIEDFRKGRLHDNRTGFIPLDDFNSEEPHDELSQQSSEGPTLRSESQRHT 362

Query: 380 VAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTLR-QKL 438
             +T  ++  +  ++++  +L  +  ++GAT ++ +++ILP L    L G   T R +++
Sbjct: 363 NVITLCVLVFSYILAISITSLAKVLAIVGATGSTSISFILPGLFGYKLIGSEFTNRNERV 422

Query: 439 P-------YYG--CIVFGFAVMVISSTQTI 459
           P       Y G    ++G  +M+ S + T+
Sbjct: 423 PVSIKIFKYLGLSLFIWGLVIMIASLSATV 452

>NDAI0E04010 Chr5 (888700..890115) [1416 bp, 471 aa] {ON} Anc_7.420
          Length = 471

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 47/252 (18%), Positives = 99/252 (39%), Gaps = 55/252 (21%)

Query: 263 FALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILN 322
           FA  CHHN   +     + S     KL  ++  ++  +  ++G SG+  F D   GNI+ 
Sbjct: 216 FAYTCHHNMFSVINEQIDNSFHNIKKLAIIAMSLAFSLYIIIGGSGYYTFGDNIVGNIIT 275

Query: 323 NFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSG---------------- 366
            +P   +   + R    F +   FPL+    R  +  +  + +                 
Sbjct: 276 LYPQSVSS-TIGRMAIVFLVTLAFPLQCHPARASIHHIILYITMKINDAKEIKPSNPQQE 334

Query: 367 ------------------------EATAPAE-----LSTKKHVAVTSALVFLTMTVSLTT 397
                                   E  +P +     L  K+ + +T++++  +  ++++ 
Sbjct: 335 PLALSANNQERAMLIRSERSDTLIEEESPLQPVTVPLEGKQFILITTSILICSYLLAISV 394

Query: 398 CNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTLRQKLP-------YYGCI--VFGF 448
            +L  +  ++GAT ++ +++ILP +    L G      ++LP       Y G +  ++G 
Sbjct: 395 SSLAHVLAIVGATGSTSISFILPGVFGYKLIGSEMLTTEQLPIKTRLFKYSGLLLSIWGV 454

Query: 449 AVMVISSTQTIL 460
            +M+ S   +IL
Sbjct: 455 FIMITSLAASIL 466

>TDEL0C02820 Chr3 complement(500004..501368) [1365 bp, 454 aa] {ON}
           Anc_7.420 YER119C
          Length = 454

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/248 (19%), Positives = 97/248 (39%), Gaps = 52/248 (20%)

Query: 263 FALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILN 322
           FA  CHHN   +    K+ S +   K+   +  +++ +  ++G  G+L F D   GNI+ 
Sbjct: 202 FAYTCHHNMFSVINEQKDTSFRHIKKVAIYAMFLALSLYLLIGGMGYLTFGDHIIGNIIK 261

Query: 323 NFPSDDNVINVARFCFGFNMLTTFPLE-----------IFVLRD---------------- 355
            +P   +   V R      ++  FPL+           +F L++                
Sbjct: 262 LYPQFAST-TVGRIAIVLLVMLAFPLQCHPARASINHILFYLQEHLSQSKQNTRTDNTAN 320

Query: 356 ----------------VVRDLAHFHSGEATAPAELSTKKHVAVTSALVFLTMTVSLTTCN 399
                           ++ +L    S        L  +K V +T  L+  +  ++++  +
Sbjct: 321 AVDEASTLIVNGDQEYMIDELIEEDSANQPPVVPLHGRKFVIITIFLLLASYLLAISVSS 380

Query: 400 LGALFELIGATTASMMAYILPPLTNLLLTGR-----AKTLRQKLPYYGCI---VFGFAVM 451
           L  +  ++G+T ++ +++ILP +    L G      +   + KL  Y  +   V+G  VM
Sbjct: 381 LARVLAVVGSTGSTSISFILPGIFGYQLIGSEVDSGSLPFKTKLFKYAGLALAVWGVVVM 440

Query: 452 VISSTQTI 459
               T T+
Sbjct: 441 ATCLTATL 448

>ADL205C Chr4 complement(341897..343303) [1407 bp, 468 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL088C
          Length = 468

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 45/105 (42%)

Query: 259 SVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKG 318
           S+I FA     N   I   L + S++   ++ + S   S  +  ++G +G+L F      
Sbjct: 194 SIIVFAFTGSMNMFSIINELGDNSMRNIQRIVYYSIAASTALFILVGMAGYLTFGSNVAQ 253

Query: 319 NILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHF 363
           N++ NF  D     V     G  +L +FPL     R    ++ H+
Sbjct: 254 NVILNFDPDAVSTQVGSLALGLMVLLSFPLLFHPGRIAFNNMVHW 298

>KNAG0H02330 Chr8 (425024..426955) [1932 bp, 643 aa] {ON} Anc_5.252
           YKL146W
          Length = 643

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 83/196 (42%), Gaps = 8/196 (4%)

Query: 274 IYFSLKNPSLKRFNKLTHLSCLVSMVV--CFVMGYSGFLVFKDKTKGNILNNFPSDDNVI 331
           I  S+K+P + R   L+ +  +V+++   C ++ YS F    D     +L NFP D    
Sbjct: 452 IQESMKHPEVFR-KSLSGVMVIVTVIFISCGLLCYSAFGSHVDTV---VLVNFPQDSYTT 507

Query: 332 NVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSGEATAPAELSTKKHVAVTSALVFLTM 391
            + +  +   +L + PL++F    ++       +        +   K+      ++F T+
Sbjct: 508 AIVQLLYALAILLSTPLQLFPAIRILEQWTFNSNASGKHNPRVKWLKNYFRCGVVIFTTV 567

Query: 392 TVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTLRQ--KLPYYGCIVFGFA 449
              +   +L     L+G+     + YI PPL +   +    T  +   +      +FGF+
Sbjct: 568 LAWVGASDLDKFVSLVGSLACIPLIYIHPPLLHHRASRSDGTSSRGILILDLLICIFGFS 627

Query: 450 VMVISSTQTILAAING 465
           VMV +S Q I   I G
Sbjct: 628 VMVYTSWQAITLWIFG 643

>KAFR0H03660 Chr8 (698211..700151) [1941 bp, 646 aa] {ON} Anc_5.252
           YKL146W
          Length = 646

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 83/194 (42%), Gaps = 22/194 (11%)

Query: 277 SLKNPSLKRFNKLTHLSCLVSMVV--CFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVA 334
           S+++P  K  + L  + C+VS+V   C ++ YS F       +  +L NFP D     + 
Sbjct: 462 SMRHPE-KFQSSLFGVMCIVSVVFISCGLLCYSAF---GSNVQTVVLLNFPQDSPYTLLV 517

Query: 335 RFCFGFNMLTTFPLEIFVLRDVVRDLAHF---HSGEATAPAELSTKKHVAVTSALVFLTM 391
           +  +   +L + PL++F     +R L H+    +       ++  +K+      +V  ++
Sbjct: 518 QLFYSMAILLSTPLQLF---PAIRILEHWTFPSNASGKYNPKIKWRKNYFRCIIVVLTSV 574

Query: 392 TVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTLRQKLPYYGCI------V 445
              +   NL     L+G+     + YI PPL +     +A    Q   Y+  I       
Sbjct: 575 LAWVGASNLDKFVSLVGSLACIPLIYIHPPLLHF----KAFKDDQDTRYWSLICDILLLA 630

Query: 446 FGFAVMVISSTQTI 459
           FG  VM  +S QT+
Sbjct: 631 FGVGVMTYTSVQTL 644

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 46/99 (46%), Gaps = 2/99 (2%)

Query: 54  PLVSGIVTENQTKSNIYMAFMNMANSILGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDW 113
           P +S I   ++T +  + A + +  S +G G++  P A +N G       +++  +L  +
Sbjct: 242 PSISSIRAAHKTST--FKAVLLLLKSFVGTGVLFLPKAFSNGGWGFSSLCLLMCAVLSYY 299

Query: 114 TIRLIVVNLKLTGKTTYQDSVEFAMGRRGKLLILAANGL 152
              L+++     G   Y D  E   G + KL ILA+  L
Sbjct: 300 CFILLIITKDKVGVAGYGDMGEVLYGSKMKLAILASIAL 338

>KLLA0E13795g Chr5 complement(1216938..1218659) [1722 bp, 573 aa]
           {ON} similar to uniprot|P36062 Saccharomyces cerevisiae
           YKL146W AVT3 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 573

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 70/161 (43%), Gaps = 5/161 (3%)

Query: 299 VVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVR 358
           + C ++ YS F     K +  IL NFPS+    N  +  +   +L + PL++F    ++ 
Sbjct: 413 ISCGLICYSAF---GAKVETVILLNFPSNSIFTNAVQLIYALAILLSTPLQLFPAIKILE 469

Query: 359 DLAHFHSGEATAPAELSTKKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYI 418
           +     +      A++  +K+      ++   +   +   +L     LIG+     + YI
Sbjct: 470 NKIFHKNASGKFDAKVKWRKNYFRAFVVLIAVIIAWIGANDLDKFVSLIGSFACIPLIYI 529

Query: 419 LPPLTNLLLTGRAKTLRQKLPYYGCIVFGFAVMVISSTQTI 459
            PPL +  +    K L Q +     ++FG  VM  +S QTI
Sbjct: 530 YPPLFHYKVFENNKKL-QAID-LAILIFGALVMSYTSWQTI 568

>AER380C Chr5 complement(1349610..1351760) [2151 bp, 716 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL101W
           (AVT4)
          Length = 716

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 57/131 (43%), Gaps = 14/131 (10%)

Query: 29  AHASGSAADEDDETKFVD----TGADVEDPLVSGIVTENQ--------TKSNIYMAFMNM 76
            H +G + DE  E   V     TG D   PL+     E Q         K++ + AF+ M
Sbjct: 251 GHFAGESFDE--EFALVPPTYATGVDEHTPLLLNTDPEQQQQVPAHLRVKTSTFKAFLLM 308

Query: 77  ANSILGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQDSVEF 136
             S +G G++  P A +N GLA  ++ +   +    W   ++V +   TG +++ D    
Sbjct: 309 IKSFIGTGVLFLPNAFSNGGLAFSISMLFFFSAYSYWCYYILVRSKDATGVSSFGDIGGI 368

Query: 137 AMGRRGKLLIL 147
             G   K +IL
Sbjct: 369 LFGSWMKFIIL 379

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 43/206 (20%), Positives = 83/206 (40%), Gaps = 27/206 (13%)

Query: 277 SLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARF 336
           S+++P  + F K+  L  + + V+   +G  G+L +  + +  IL N P D   +N+ + 
Sbjct: 509 SMRHP--EEFPKVLGLVIITTTVLFITIGTLGYLAYGSQIQSVILLNLPQDALSVNMIQL 566

Query: 337 CFGFNMLTTFPLEIFVLRDVV---------------RDLAHFHSGEATAPAELSTKKHVA 381
            +   +L + PL++F    ++               +D A F   + +  A    K    
Sbjct: 567 FYSMAILLSTPLQLFPAIGIIENKFFPRFTKVDIKGQDSADFQLQQNSGRANWRVKWSKN 626

Query: 382 VTSALVFLTMTV--SLTTCNLGALFELIGATTASMMAYILPPLTNLL--------LTGRA 431
           +  +++ L + +       NL     ++G      + YI P + +L          +   
Sbjct: 627 LVRSIIVLLVIILAYFGADNLDLFVSIVGCLACIPLVYIYPSMLHLRSCSTPDHEKSNTW 686

Query: 432 KTLRQKLPYYGCIVFGFAVMVISSTQ 457
           KT    L  Y  I+FGF  M  +S Q
Sbjct: 687 KTRCSVLIDYILIIFGFVSMCYTSYQ 712

>TDEL0F01320 Chr6 (235988..238135) [2148 bp, 715 aa] {ON} Anc_2.177
           YNL101W
          Length = 715

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 85/211 (40%), Gaps = 29/211 (13%)

Query: 277 SLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARF 336
           S+++P  ++F  +  L    S V+   +   G+L +    +  IL N P  +  +N+ +F
Sbjct: 509 SMRHP--EKFPMVLALVIGSSTVLFITIASIGYLAYGSAIETVILLNLPQKNVFVNLIQF 566

Query: 337 CFGFNMLTTFPLEIFVLRDVVRD--LAHF------------------HSGEATAPAELST 376
            +   ++ + PL++F    ++ +     F                  +SG+     +   
Sbjct: 567 FYSLAIMLSTPLQLFPAIKIIENKVFPKFTKIYVKKDDDTTDIQLRPNSGKLNWKVKWLK 626

Query: 377 KKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTLRQ 436
               A+  ALV L          L     +IG+     + Y+ PP+ +L    R ++  Q
Sbjct: 627 NSVRAIIVALVILMAYYG--ADKLDKFVSIIGSFACIPLVYMYPPMLHLQSYSRPRSAGQ 684

Query: 437 KLPYYGC-----IVFGFAVMVISSTQTILAA 462
           K P+        IVFG   M  +S Q+I A+
Sbjct: 685 KFPWRSIVDCVLIVFGGVSMCYTSYQSIFAS 715

>Kwal_26.8401 s26 complement(767440..769602) [2163 bp, 720 aa] {ON}
           YNL101W - Hypothetical ORF [contig 60] FULL
          Length = 720

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/210 (20%), Positives = 87/210 (41%), Gaps = 27/210 (12%)

Query: 277 SLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARF 336
           S+K+P  ++F  +  L  + + V+   +G  G+L +  KT+  IL N P  + ++N+ +F
Sbjct: 513 SMKHP--EKFPLVLALVIISATVLFVTVGTLGYLSYGAKTETVILLNLPQGNILVNLIQF 570

Query: 337 CFGFNMLTTFPLEIFVLRDVVRD-----------------LAHFHSGEATAPAELSTKKH 379
            +   +L + PL++F    ++ +                   H+          +   K+
Sbjct: 571 FYSSAILLSTPLQLFPAIAIIENKVFPKFTKIYVKRSDHTKVHYKPNSGKLDWRVKWLKN 630

Query: 380 VAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGR-----AKTL 434
              +  +  + +       +L     ++G+     + YI PP+ +L    R       ++
Sbjct: 631 FVRSLIVSLVVIAAYFGADHLDTFVSIVGSFACIPLVYIYPPMLHLESCSRPACQNETSI 690

Query: 435 RQKLPY---YGCIVFGFAVMVISSTQTILA 461
            +K P    Y  I+FG   MV +S Q+I  
Sbjct: 691 WKKWPMAVDYVLIIFGAIGMVYTSYQSIFG 720

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 38/83 (45%), Gaps = 16/83 (19%)

Query: 29  AHASGSAADED--DETKFVDTGADVEDPLVSGIVTENQTKSNIYM------------AFM 74
            H +G + +++   E    D G D   PL++   T+ +T   IY+            AF+
Sbjct: 253 GHFAGESFEDEFYTEESTSDEGIDERSPLLAR--TQAETGKRIYVPKSAKGTTSTMKAFL 310

Query: 75  NMANSILGAGIIGQPFAINNCGL 97
            M  S +G G++  P A +N GL
Sbjct: 311 LMIKSFIGTGVLFLPGAFSNGGL 333

>ZYRO0A10538g Chr1 (852296..854122) [1827 bp, 608 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 608

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 94/436 (21%), Positives = 155/436 (35%), Gaps = 49/436 (11%)

Query: 50  DVEDPLVSGIVTEN----QTKSNIYMAFMNMANSILGAGIIGQPFAINNCGLA------- 98
           D E  L+  + T +    Q K+  + A + +  S +G G++  P A +N G A       
Sbjct: 193 DEESVLLERVPTRDSKKQQRKATTFKAILLLLKSFVGTGVLFLPRAFHNGGWAFSTGCLL 252

Query: 99  -GGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQDSVEFAMGRRGKLLILAANGLFAXXX 157
              +A+ +   LL+    ++ V      GK  Y   VEF++     L  L  +  +    
Sbjct: 253 FCAIASSLAFVLLIKTKDKVGVSGYGDLGKALYGPKVEFSILFSIALSQLGFSAAYTVFT 312

Query: 158 XXXXXXXXXDTIPHVLRAF-FPAHTALFHRNAIIFFVTLFVSYPLSLNRDXXXXXXXXXX 216
                    +       AF FPA +       II    +F+  PLSL R+          
Sbjct: 313 ATNLKVFFEN-------AFNFPADSVPL-SAYIILQALIFI--PLSLTRNITKLSGTALI 362

Query: 217 XXXXXXXXXXXXXXXGPMLDAAYKGSLTASKLFITPR---IFQGISVISFALVCHHNTSF 273
                           P L  A  G  T S LF       +F G ++ +F  +       
Sbjct: 363 ADLFILLGLLYVYYY-PALYIAKHGIATDSVLFFNRSDWSLFIGTAIFTFEGI------- 414

Query: 274 IYFSLKNPSLKRFNKLTHLS---CLVSMVVCFVMGYSG---FLVFKDKTKGNILNNFPSD 327
               L  P  +   K  H       V  +V F+   SG   +L F  K +  +L NFP D
Sbjct: 415 ---GLLIPIQESMKKPEHFYPSLGFVMSIVTFIFVSSGLLCYLAFGAKVETVVLLNFPQD 471

Query: 328 DNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSGEATAPAELSTKKHVAVTSALV 387
                  +  +   +L + PL++F    +        +        +   K+   T  ++
Sbjct: 472 SIATISVQLIYSLAILLSTPLQLFPAIRIFETWTFPSNASGKHNHRVKWLKNYFRTGVVI 531

Query: 388 FLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTLRQKLPYYGCIV-- 445
           F  +   +   +L     L+G+     + YI PPL +L     + T   K    G ++  
Sbjct: 532 FTALLAWVGANDLDKFVSLVGSFACIPLIYIYPPLLHL---KSSDTQTSKFIILGDLLIF 588

Query: 446 -FGFAVMVISSTQTIL 460
            FG  VM  +S Q I+
Sbjct: 589 FFGVGVMAYTSYQNIV 604

>KLLA0C13277g Chr3 (1135255..1137420) [2166 bp, 721 aa] {ON} similar
           to uniprot|P50944 Saccharomyces cerevisiae YNL101W AVT4
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 721

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 43/209 (20%), Positives = 84/209 (40%), Gaps = 26/209 (12%)

Query: 277 SLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARF 336
           S++ P  ++F  +  L  L + V+   +   G+L F    +  IL N P D+  +N+ +F
Sbjct: 515 SMRKP--EKFPLVLGLVILTATVLFISIAALGYLAFGRYIETVILLNLPQDNIFVNLVQF 572

Query: 337 CFGFNMLTTFPLEIF------------VLRDVV----RDLAHFHSGEATAPAELSTKKHV 380
            +   +L + PL++F              R  V    ++             ++   K+ 
Sbjct: 573 FYSLAILLSTPLQLFPAIGIIESKLVPKFRKTVSPTNKNDVQLSPNSGKLDWKVKWTKNF 632

Query: 381 AVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRA-----KTLR 435
             +  ++F+       +  L      IG      + Y+ PPL +L    +      +TL+
Sbjct: 633 LRSIIVIFVICLAYFGSSKLDVFVSFIGCFACIPLVYMYPPLLHLKSCSQPAYKQNQTLK 692

Query: 436 QKLPY---YGCIVFGFAVMVISSTQTILA 461
            +L     YG ++FG   M+ +S Q I+ 
Sbjct: 693 NRLMITMDYGLVIFGGVSMLYTSYQCIMG 721

 Score = 37.7 bits (86), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 48/110 (43%), Gaps = 18/110 (16%)

Query: 35  AADEDDETKFVDTGADVEDPLVSG------------IVTENQTKSNIYMAFMNMANSILG 82
           A DEDDE        + E PL++             I   +Q K++ + AF+ M  S +G
Sbjct: 267 AVDEDDEFN------ESEVPLLNASDRERLGHNKRVIARPSQVKTSTFKAFLLMLKSFIG 320

Query: 83  AGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQD 132
            G++  P A  N GL   V  +    +   W   +++ +   TG +++ D
Sbjct: 321 TGVLFLPSAFANGGLIFSVLMLSFFGMYSYWCYYILIRSKVATGVSSFGD 370

>Kpol_1032.88 s1032 complement(188477..190204) [1728 bp, 575 aa]
           {ON} complement(188477..190204) [1728 nt, 576 aa]
          Length = 575

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/185 (21%), Positives = 80/185 (43%), Gaps = 4/185 (2%)

Query: 277 SLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARF 336
           S+  P L R + L+ +  +V+++   V G   +  F    +  +L NFP D     + + 
Sbjct: 388 SMAKPHLFRLS-LSLVMVIVTLIFVSV-GLLCYSAFGSDVETVVLLNFPQDSPYTLIVQL 445

Query: 337 CFGFNMLTTFPLEIFVLRDVVRDLAHFHSGEATAPAELSTKKHVAVTSALVFLTMTVSLT 396
            +   +L + PL++F    ++ +             ++   K+   T  ++  +    + 
Sbjct: 446 LYSLAILLSTPLQLFPAIRILENWVFKSRYSGKYNPKIKWAKNYFRTLVVIGTSFIAWIG 505

Query: 397 TCNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTLRQ-KLPYYGC-IVFGFAVMVIS 454
             +L     L+G+     + YI PPL ++    R  T+    L    C I+FGF +++ +
Sbjct: 506 ADDLDKFVSLVGSFACIPLIYIYPPLLHIKALKRNGTVTNLHLIVDSCMIIFGFTILIYT 565

Query: 455 STQTI 459
           S QTI
Sbjct: 566 SCQTI 570

>Suva_11.79 Chr11 (157798..159957) [2160 bp, 719 aa] {ON} YKL146W
           (REAL)
          Length = 719

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 90/199 (45%), Gaps = 33/199 (16%)

Query: 277 SLKNPSLKRFN-KLTHLSCLVSMVV--CFVMGYSGFLVFKDKTKGNILNNFPSDDNVINV 333
           S+K+P+   F   L+ + C+V++V   C ++ Y+ F       K  +L NFP D +    
Sbjct: 533 SMKHPN--HFQPSLSAVMCIVAVVFISCGLLCYAAF---GADVKTVVLLNFPQDSSYTLT 587

Query: 334 ARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSGEATAPAELSTKKHVAVT-------SAL 386
            +  +   +L + PL++F     +R L ++     T P+  S K +  V         A+
Sbjct: 588 VQLLYALAILLSTPLQLF---PAIRILENW-----TFPSNASGKHNPKVKWLKNYFRCAI 639

Query: 387 VFLTMTVSLTTCN-LGALFELIGATTASMMAYILPPLTN---LLLTG--RAKTLRQKLPY 440
           V LT  ++    N L     L+G+     + YI PP+ +     L+G  RA+ L   +  
Sbjct: 640 VLLTSVLAWVGANDLDKFVSLVGSFACIPLIYIYPPMLHYKAFSLSGISRARLLLDLV-- 697

Query: 441 YGCIVFGFAVMVISSTQTI 459
              + FG  VM  +S QTI
Sbjct: 698 --VLSFGVVVMAYTSWQTI 714

>Ecym_5408 Chr5 complement(838376..840523) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AER380C
          Length = 715

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 60/128 (46%), Gaps = 12/128 (9%)

Query: 29  AHASGSAADEDDETKFVDTGADVED---PLVSGIVTEN------QTKSNIYMAFMNMANS 79
            H +G + DE  E   V T + V D   PL+SG  TE       + K++ + AF+ +  S
Sbjct: 254 GHFAGESFDE--EFDLVQTYSKVIDETTPLLSG-DTERLHPITVRVKTSTFKAFLLLIKS 310

Query: 80  ILGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQDSVEFAMG 139
            +G G++  P A +N GLA  +  + + +    W   ++V     TG +++ D      G
Sbjct: 311 FVGTGVLFLPNAFSNGGLAFSIIMLFIFSGYSYWCYYILVRTKVSTGVSSFGDIGAMLYG 370

Query: 140 RRGKLLIL 147
              K +IL
Sbjct: 371 PWMKYIIL 378

>SAKL0G11462g Chr7 (980180..982030) [1851 bp, 616 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 616

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 92/422 (21%), Positives = 152/422 (36%), Gaps = 55/422 (13%)

Query: 64  QTKSNIYMAFMNMANSILGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLK 123
           Q K+ ++   + +  S +G G++  P   +N G      A++  +++  W   L++    
Sbjct: 221 QHKATVFKTIILLIKSFVGTGVLFLPKGFHNGGWGFSSVALLFCSVVSYWCFMLLINTKN 280

Query: 124 LTGKTTYQDSVEFAMGRRGKLLILAANGLFAXXXXXXXXXXXXDTIPHVLRAFFPAHTAL 183
                 Y D      GR+ K  IL++  L                    L+AFF     +
Sbjct: 281 KIRVNGYGDLGGQLYGRKMKFAILSSIVLSQIGFAAAYTVFTATN----LQAFF---ANI 333

Query: 184 FHRN---AIIFFVTLFVSYPLSLNRDXXXXXXXXXXX--------XXXXXXXXXXXXXXG 232
           FH +   AI   + + V  PLSL R                                  G
Sbjct: 334 FHWDYPLAIYILLQMVVYIPLSLTRSIAKLSGTVLIADFFILVGLLYLYYYCAYYVSVHG 393

Query: 233 PMLDAAYKGSLTASKLFITPRIF--QGISVISFALVCHHNTSFIYFSLKNPSLKRFNKL- 289
              D+    + +   LFI   IF  +GI ++            I  S+K P  ++F +  
Sbjct: 394 IASDSMVLFNSSNWTLFIGTAIFTYEGIGLLIP----------IQESMKQP--EKFPRCL 441

Query: 290 --THLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFP 347
               L   V  + C  + YS F       K  IL NFP D       +F +   +L + P
Sbjct: 442 FGVMLGITVIFISCGCLCYSAF---GADVKTVILLNFPQDSIFTGGVQFSYALAILLSTP 498

Query: 348 LEIFVLRDVVRDLAHFHSGEATAPAELSTKKHVAVTSA-------LVFLTMTVSLTTCN- 399
           L++F     +R L +     A  P+  S K +  V          +V  ++ ++    N 
Sbjct: 499 LQLF---PAIRILEN-----AVFPSHASGKHNPKVKWLKNYFRCFVVIASVAIAWVGAND 550

Query: 400 LGALFELIGATTASMMAYILPPLTNLLLTGRAKTLRQKLPYYGCIV-FGFAVMVISSTQT 458
           L     L+G+     + YI PP+ +          R  L     ++ FG A+MV  S QT
Sbjct: 551 LDKFVSLVGSLACIPLIYIYPPMLHYKAFRGTNISRHDLVLDQVVLWFGIAIMVYISLQT 610

Query: 459 IL 460
           +L
Sbjct: 611 VL 612

>CAGL0G06622g Chr7 complement(631859..634060) [2202 bp, 733 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101w
          Length = 733

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 90/206 (43%), Gaps = 25/206 (12%)

Query: 277 SLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARF 336
           S++ P  ++F  +  L  + + VV  ++   G+L +  +    IL N P  + ++++ + 
Sbjct: 526 SMRKP--EKFPLVLGLVIICTTVVFIIVATIGYLAYGSEVDTVILLNLPQKNILVSLIQL 583

Query: 337 CFGFNMLTTFPLEIFVL-------------RDVVRDLAHFHSGEATAPAELSTKK----H 379
            +   ++ + PL++F               R V R     H+ E    +  S+ K     
Sbjct: 584 LYSIAIMLSTPLQMFPAIRIIESGLFKQYDRWVNRSDREGHATEHNTSSGKSSWKVKWMK 643

Query: 380 VAVTSALVFLTMTVSLTTC-NLGALFELIGATTASMMAYILPPLTNLLLTGRAKT----- 433
            AV S++V L + ++     NL     +IG+     + Y+ PP+ +L  T   ++     
Sbjct: 644 NAVRSSIVILVVAIACVGADNLDKFLSIIGSFACIPLVYMYPPMLHLKSTSLPRSNGKIM 703

Query: 434 LRQKLPYYGCIVFGFAVMVISSTQTI 459
            R+ +     I+FG   MV +S Q+I
Sbjct: 704 SRRVIIDIVLIIFGGISMVYTSYQSI 729

>KLTH0D09042g Chr4 complement(746802..748958) [2157 bp, 718 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 718

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 44/210 (20%), Positives = 91/210 (43%), Gaps = 27/210 (12%)

Query: 277 SLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARF 336
           S+K+P  ++F  +  L  + + V+   +   G+L +  +T+  IL N P D  ++N+ +F
Sbjct: 511 SMKHP--EKFPLVMALVIITATVLFVSVATLGYLSYGAETQTVILLNLPQDSILVNLIQF 568

Query: 337 CFGFNMLTTFPLEIF----VLRDVV-----------RDLAHFHSGEATAPAELSTKKHVA 381
            +   +L + PL++F    ++ + V            D         +   +   K    
Sbjct: 569 FYSSAILLSTPLQLFPAIAIIENKVFPKFTKIYVKRSDHTKIQYKPNSGKLDWRIKWLKN 628

Query: 382 VTSALVFLTMTVS--LTTCNLGALFELIGATTASMMAYILPPLTNLLLTGR-----AKTL 434
              +L+  ++ ++      +L A   ++G+     + YI PP+ +L    +      K++
Sbjct: 629 FVRSLIVSSVVIAAYFGANHLDAFVAIVGSLACIPLVYIYPPMLHLRSCSKPRFAGEKSV 688

Query: 435 RQKLPY---YGCIVFGFAVMVISSTQTILA 461
            +K P    Y  +VFG   MV +S Q+I  
Sbjct: 689 WRKWPILLDYVLVVFGAIGMVYTSYQSIFG 718

>TBLA0F03230 Chr6 (785400..787085) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 41/221 (18%), Positives = 93/221 (42%), Gaps = 37/221 (16%)

Query: 277 SLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARF 336
           S++NP  ++F  +  L  LV   +  ++G  G+L F       IL++F   +  +++A+ 
Sbjct: 343 SMRNP--EKFPLVLSLVLLVCTAIFMLIGTLGYLTFGKDITPVILSSFNQKNKFVSIAQL 400

Query: 337 CFGFNMLTTFPLEIFVLRDVVRDLAHFHSGEATAPAELSTK------------------- 377
           C+   +L + P+++F +  +V +     +   TA +  S++                   
Sbjct: 401 CYSIAILLSTPIQLFPVYKMVEEAIFKKNKNNTAISSTSSEPQDNDNEENKAMLTEKIIL 460

Query: 378 -----------KHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLL 426
                      K+++ T+ ++ +T+     + +L     ++G+     + YI PP  +L 
Sbjct: 461 SGRDSNKIKWLKNLSRTTIVLLVTIISYFGSQDLSKFVAIVGSVACIPLIYIYPPFFHLK 520

Query: 427 LTGRAKTLRQKLPYYGCI-----VFGFAVMVISSTQTILAA 462
                 +L  K  +   I     +FG   ++ +S Q+I  +
Sbjct: 521 THSLPNSLNLKFKWRVIIDITLLIFGLLAVLYTSYQSIFNS 561

>NCAS0G02630 Chr7 (473803..475920) [2118 bp, 705 aa] {ON} Anc_2.177
          Length = 705

 Score = 38.1 bits (87), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 41/208 (19%), Positives = 84/208 (40%), Gaps = 25/208 (12%)

Query: 277 SLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARF 336
           S+KNP  ++F  +  L  + + ++   +   G+L +       IL N P  +  +N+ + 
Sbjct: 499 SMKNP--EKFPLVLGLVLITATILFISIATIGYLSYGSSIDVVILLNLPQSNIFVNLIQL 556

Query: 337 CFGFNMLTTFPLEIFVLRDVVRD-------LAHFHSGEATAPAELSTK-----------K 378
            +   ++ + PL++F    ++           +   G +    ELS             K
Sbjct: 557 FYSLAIMLSTPLQMFPAIKIIESKLFPKFIKVYAKDGNSPGSYELSLNSGKLNWKVKWLK 616

Query: 379 HVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTLRQKL 438
           +   +  +  + +   L   NL  +  +IG+     + YI PPL +L       ++ QK+
Sbjct: 617 NFVRSIIVTLVVLIAYLEVENLDKVVSIIGSLACIPLVYIYPPLLHLRSHSIPFSVNQKV 676

Query: 439 PY-----YGCIVFGFAVMVISSTQTILA 461
            +     Y  + FG   M  +S Q+I +
Sbjct: 677 KWRVLFDYLLVGFGTVSMFYTSYQSIFS 704

>TBLA0F01400 Chr6 complement(345013..346374) [1362 bp, 453 aa] {ON}
           Anc_7.420 YER119C
          Length = 453

 Score = 37.7 bits (86), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 36/77 (46%), Gaps = 6/77 (7%)

Query: 255 FQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVC---FVMGYSGFLV 311
           F+ + +  FA  CHHN   ++  L   S   F+KL ++      + C    ++G  G++ 
Sbjct: 190 FKTLPIFVFAYTCHHN---MFAVLNEQSTNEFSKLKYIPLTAISIACIMYLIVGTFGYVT 246

Query: 312 FKDKTKGNILNNFPSDD 328
           F      NI+  +P++ 
Sbjct: 247 FGSNITSNIVAQYPTNS 263

>NCAS0E02440 Chr5 (477113..478600) [1488 bp, 495 aa] {ON} Anc_7.420
          Length = 495

 Score = 37.4 bits (85), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 42/98 (42%), Gaps = 1/98 (1%)

Query: 263 FALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILN 322
           FA  CHHN   +    K         +  ++ L+++V+  ++G +G+  F +   GNI+ 
Sbjct: 206 FAYTCHHNVFAVINEQKKTRFAHVKVIAIIAMLLALVLYVLIGGAGYFTFGNHIVGNIIT 265

Query: 323 NFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDL 360
            +P       + R    F +   FPL+    R  +  +
Sbjct: 266 LYPHSITS-TIGRVAIVFLVTLAFPLQCHPARASIHHI 302

>KNAG0C03380 Chr3 (665325..666962) [1638 bp, 545 aa] {ON} Anc_7.420
           YER119C
          Length = 545

 Score = 37.0 bits (84), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 64/148 (43%), Gaps = 9/148 (6%)

Query: 241 GSLTASKLFITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNK--LTHLSCLVSM 298
           G++T +     PR+  G+ ++ F   CH N        +   LK   +  LT+L+   + 
Sbjct: 177 GTVTRATSNGAPRLL-GLPLLMFMFTCHQNIFPTLNCARERGLKHTLRVPLTYLAAYAA- 234

Query: 299 VVCFVMGYSGFLVFKDKTK---GNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRD 355
            VC + G +G+L F   T+    N+L  +P    +  + R     ++  +FPL     R 
Sbjct: 235 -VCLICGITGYLTFHKSTRTIPSNVLLLYPQGSILGTLCRVTTLLSVTLSFPLLCHPTRA 293

Query: 356 VVRDL-AHFHSGEATAPAELSTKKHVAV 382
            +  + AH+  G+ +  ++   K    V
Sbjct: 294 ALNHIWAHWGRGQDSQASQPRYKTDATV 321

>TDEL0E03740 Chr5 (707081..708922) [1842 bp, 613 aa] {ON} Anc_5.252
           YKL146W
          Length = 613

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 69/158 (43%), Gaps = 28/158 (17%)

Query: 277 SLKNPSLKRFNKLTHLSCLVSMV--VCFVMGYSGFL---VFKDKTKGNILNNFPSDDNVI 331
           S++ P  + FNK     CL+ ++  V FV   SG +    F  K +  +L NFP D    
Sbjct: 427 SMEKP--QHFNK-----CLLGVMSGVAFVFITSGLICYSAFGSKVETVVLLNFPQDSPFT 479

Query: 332 NVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSGEATAPAELSTKKHVAVT-------S 384
             A+  +   +L + PL++F     +R L ++     T P + S K +  +        S
Sbjct: 480 KSAQLLYVLAILLSTPLQLF---PAIRILENW-----TFPVDASGKHNPHIKWLKNYFRS 531

Query: 385 ALVFLTMTVSLTTCN-LGALFELIGATTASMMAYILPP 421
           A+V  T  ++    N L     L+G+     + YI PP
Sbjct: 532 AIVIATSLIAWGGANDLDKFVSLVGSFACVPLIYIYPP 569

>KLTH0G07502g Chr7 (608628..610433) [1806 bp, 601 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 601

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 39/188 (20%), Positives = 78/188 (41%), Gaps = 11/188 (5%)

Query: 277 SLKNPSLKRFNKLTHLSCLVSMVVCFVM-GYSGFLVFKDKTKGNILNNFPSDDNVINVAR 335
           S+K+P  ++FNK   L  +VS+ + F++ G   +  F    +  IL NFP    +    +
Sbjct: 415 SMKHP--EKFNKCL-LGVMVSVSIAFILCGLLCYSAFGSSVETVILLNFPRKSAMTASVQ 471

Query: 336 FCFGFNMLTTFPLEIFVLRDVVRDLAHFHSGEATAPAELSTKKHVAVTSALVFLTMTVSL 395
             +   ++ + PL++F +  ++       +        +   K+      ++  T+   L
Sbjct: 472 LLYALAIMLSTPLQLFPIIRILETSIFPKNASGKYNPRVKWMKNYFRIGIVLANTLIAWL 531

Query: 396 TTCNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTLRQKLPYYGCIV----FGFAVM 451
              +L     ++G+     + YI PP+ +          +  L   GC V    FG AVM
Sbjct: 532 GANDLDKFVSIVGSFACIPLIYIYPPMLHYKAFSNGGGSKLSL---GCDVAIASFGVAVM 588

Query: 452 VISSTQTI 459
             ++ Q +
Sbjct: 589 TYTTYQAV 596

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 46/111 (41%), Gaps = 14/111 (12%)

Query: 36  ADEDDETKFVDTGADVEDPLVSGIVTENQTKSNIYMAFMNMANSILGAGIIGQPFAINN- 94
           A ED+ET  V   A         I      KS+ + A + +  S +G G++  P A +N 
Sbjct: 184 AIEDEETALVGRRARHR------ISHRQPHKSSTFKAVLLLLKSFVGTGVLFLPRAFHNG 237

Query: 95  -------CGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQDSVEFAM 138
                  C LA GV +     LL++  ++  V      G   Y  ++E A+
Sbjct: 238 GWAFSTTCLLACGVISYYCFVLLINTKLKKNVNGYGDLGAAVYGRNMELAI 288

>CAGL0E06468g Chr5 (647086..649131) [2046 bp, 681 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146w or
           uniprot|P50944 Saccharomyces cerevisiae YNL101w
          Length = 681

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 74/192 (38%), Gaps = 10/192 (5%)

Query: 281 PSLKRFNKLTHLSCLVSMVVCFVM------GYSGFLVFKDKTKGNILNNFPSDDNVINVA 334
           P  +   K  H    +S V+C V       G   +  F    +  +L NFP +       
Sbjct: 492 PIQESMKKPEHFHASLSGVMCVVTVVFISCGLICYCAFGADVETVVLLNFPQESIYTRAV 551

Query: 335 RFCFGFNMLTTFPLEIFVLRDVVRDLAHF-HSGEATAPAELSTKKHVAVTSALVFLTMTV 393
           +  +   +L + PL++F    ++ +     HS     P     K +    +A+V  +  +
Sbjct: 552 QLLYALAILLSTPLQLFPAIKILENWTFSPHSSGKHNPKVKWLKNY--FRAAIVCFSALI 609

Query: 394 SLTTCN-LGALFELIGATTASMMAYILPPLTNLLLTGRAKTLRQKLPYYGCIVFGFAVMV 452
           +    N L     L+G+     + YI PP+ +     + K+          + FG  VM+
Sbjct: 610 AWAGANDLDKFVSLVGSFACIPLIYIYPPMLHFKAFKKDKSKLFMASDIFLLFFGIIVMI 669

Query: 453 ISSTQTILAAIN 464
            +S QTI   +N
Sbjct: 670 YTSLQTIGMWLN 681

>TPHA0B02530 Chr2 (580212..582002) [1791 bp, 596 aa] {ON} Anc_5.252
           YKL146W
          Length = 596

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 72/170 (42%), Gaps = 7/170 (4%)

Query: 295 LVSMVVCFV-MGYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVL 353
           +V + V F+ +G   +  F    +  +L NFP D       +  +   +L + PL++F  
Sbjct: 424 MVIVTVIFISVGLLCYCAFGSSVETVVLLNFPQDSPYTLTVQLLYCLAILLSTPLQLFPA 483

Query: 354 RDVVRDLAHFHSGEATAPAELSTKKHVAVTSALVFLTMTVSLTTCN-LGALFELIGATTA 412
             ++ +      G      ++   K+    S +V  T  ++ +  N L     L+G+   
Sbjct: 484 IRILENWVFKKKGSGKYNPKIKWAKNY-FRSLIVIGTTCIAWSGANDLDKFVSLVGSFAC 542

Query: 413 SMMAYILPPLTNL---LLTGRAKTLRQKLPYYGCIVFGFAVMVISSTQTI 459
             + YI PPL +     + G A  ++  L     I+FG  +M  +S QTI
Sbjct: 543 IPLIYIYPPLLHYKACKINGSANLVQNYLDII-LILFGVILMSYTSFQTI 591

>ACR051C Chr3 complement(448844..450880) [2037 bp, 678 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL146W
          Length = 678

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 40/191 (20%), Positives = 85/191 (44%), Gaps = 8/191 (4%)

Query: 274 IYFSLKNPSLKRFNKLTHLSCLVSMVVCFV-MGYSGFLVFKDKTKGNILNNFPSDDNVIN 332
           I  S+++P  ++F +   L  +V++   F+  G   +  F  K +  IL NFP D  +  
Sbjct: 488 IQESMRSP--EKFRRCL-LWVMVAVTAVFISFGMLCYAAFGAKVETVILLNFPQDSALGT 544

Query: 333 VARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHSGEATAPAELSTKKHVAVTSALVFLTMT 392
             +  +   ++ + PL++F    ++ ++    S       ++   K+      +V + + 
Sbjct: 545 GVQLLYAAAIMLSTPLQLFPAIRILENVVVTTSRSGKYSTKVKWIKNWFRALVVVLMLVL 604

Query: 393 VSLTTCNLGALFELIGATTASMMAYILPPLTNLLL---TGRAKTLRQKLPYYGCIVFGFA 449
            SL + +L     LIG+     + Y+ PPL + ++   TG    +   L     + FG  
Sbjct: 605 ASLGSNDLDKFVSLIGSFACIPLIYVYPPLLHYVVFRGTGTVSQVALALD-LAVMAFGLG 663

Query: 450 VMVISSTQTIL 460
           +M  ++ QT++
Sbjct: 664 IMGYTTVQTVV 674

>TPHA0B02980 Chr2 (679253..681502) [2250 bp, 749 aa] {ON} Anc_2.177
           YNL101W
          Length = 749

 Score = 34.3 bits (77), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 35/189 (18%), Positives = 79/189 (41%), Gaps = 16/189 (8%)

Query: 277 SLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARF 336
           S+K+P  + F  +  L  L + V+  ++G  G+L +    +  IL N    +  +N+ + 
Sbjct: 549 SMKHP--EHFPFVLFLVILTATVLFILIGTIGYLAYGKYIETVILMNLSQSNVFVNLVQL 606

Query: 337 CFGFNMLTTFPLEIFVLRDVVRDL------------AHFHSGEATAPAELSTKKHVAVTS 384
            +   +L + PL++F    ++ +             + F S        +  +K+   + 
Sbjct: 607 FYSVAILLSTPLQLFPAIKIIENRMFTSFRSTDNGSSQFLSNSGKLNWRIKWRKNCLRSI 666

Query: 385 ALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTLRQKLPYYGCI 444
            +  + +   L   NL     LIG+     + Y+ PP+ +L         + K  +   +
Sbjct: 667 IVSCVILIAYLGYNNLDKFVSLIGSFACIPLVYMYPPMLHLKSYSIPSLKQHKFNF--TV 724

Query: 445 VFGFAVMVI 453
           +F F+++V+
Sbjct: 725 IFDFSLIVL 733

 Score = 33.9 bits (76), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 48/105 (45%), Gaps = 4/105 (3%)

Query: 45  VDTGADVEDPLVSGIVTENQTKSNIYMAFMNMANSILGAGIIGQPFAINNCGLAGGVAAI 104
           V +G  V  P++       + K+    AF+ +  S +G GI+  P A +  GL   +  +
Sbjct: 321 VTSGVRVSKPMIQ----TAKGKTPTTKAFLLLLKSFIGTGILFLPNAFSKGGLLFSIGML 376

Query: 105 VLLTLLVDWTIRLIVVNLKLTGKTTYQDSVEFAMGRRGKLLILAA 149
           +   L   W   +++ + ++T  +++ D      GR  K +IL +
Sbjct: 377 LFFGLYSYWCYFILIRSKQITKVSSFGDIGLILYGRWMKTIILCS 421

>Ecym_3335 Chr3 complement(639655..641079) [1425 bp, 474 aa] {ON}
           similar to Ashbya gossypii ADL205C
          Length = 474

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/105 (20%), Positives = 44/105 (41%)

Query: 259 SVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKG 318
           S+I  A     N   +   LK+ S     ++ + S  +S ++   +G  G+L F +    
Sbjct: 195 SIIILAYTGSMNMFSVINELKDNSTANAKRVVYYSVGISTLIFLSVGLGGYLTFGNNVLT 254

Query: 319 NILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHF 363
           N++ N+        +  F  G  ++ +FPL     R    ++ H+
Sbjct: 255 NVILNYDESAITTRIGTFSLGTMVILSFPLLFHPGRIAFNNMVHW 299

>ZYRO0B09548g Chr2 complement(742965..745121) [2157 bp, 718 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 718

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 41/75 (54%), Gaps = 2/75 (2%)

Query: 277 SLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARF 336
           S+++P  ++F  +  +  + S V+   +G  G+L +  K K  IL N P  +  +N+ +F
Sbjct: 513 SMRHP--EKFPLVLGMVIITSTVLFITIGSIGYLAYGYKIKTVILLNLPQANISVNLIQF 570

Query: 337 CFGFNMLTTFPLEIF 351
            +   ++ + PL++F
Sbjct: 571 FYSLAIMLSTPLQLF 585

>SAKL0E10362g Chr5 complement(860653..862854) [2202 bp, 733 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 733

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 40/210 (19%), Positives = 82/210 (39%), Gaps = 27/210 (12%)

Query: 277 SLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARF 336
           S+K+P  ++F  +  L    + V+   +   G+L +   T+  IL N P  +  +N+ +F
Sbjct: 526 SMKHP--EKFPLVLGLVIGAATVLFVTIATLGYLSYGQNTETVILLNLPQGNLCVNLIQF 583

Query: 337 CFGFNMLTTFPLEIF----VLRDVV-------------RDLAHFHSGEATAPAELSTKKH 379
            +   +L + PL++F    ++ + V             R              ++   K+
Sbjct: 584 FYSLAILLSTPLQLFPAIAIIENKVFPRFTKIYVKKNNRTDVELRPNSGKLDWKVKWLKN 643

Query: 380 VAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRAK-----TL 434
              +  + F+ +     + NL     ++G      + Y+ PPL +L    + +       
Sbjct: 644 SVRSVIVSFVILLAYYGSENLDKFVSIVGCFACIPLVYMYPPLLHLRSCSKPQCHGVTKW 703

Query: 435 RQKLPY---YGCIVFGFAVMVISSTQTILA 461
            +K P    Y  I FG   M+ +S Q +  
Sbjct: 704 WKKWPIGLDYLLITFGGVSMIYTSYQCVFG 733

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 22/107 (20%), Positives = 44/107 (41%), Gaps = 12/107 (11%)

Query: 38  EDDETKFVDTGADVEDPLVSGIVTENQTKSNI------------YMAFMNMANSILGAGI 85
           E++E    +   D   PL+SG +     ++ +            + AF+ M  S +G G+
Sbjct: 275 EEEEDNRGNKTIDERSPLLSGDIESRGGRAKVHAPRSAKGTTSTFKAFLLMIKSFIGTGV 334

Query: 86  IGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQD 132
           +  P A  N GL   V  +    +   W   +++ +   T  +++ D
Sbjct: 335 LFLPNAFANGGLTFSVCMLSFFGIYSYWCYYILIQSKVATKVSSFGD 381

>TBLA0C05630 Chr3 (1364052..1366280) [2229 bp, 742 aa] {ON}
           Anc_2.177 YNL101W
          Length = 742

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 36/172 (20%), Positives = 74/172 (43%), Gaps = 17/172 (9%)

Query: 292 LSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIF 351
           + C+ S+ +  ++G  G++ + +     IL N P+D   +   +  +   ++ + PL+IF
Sbjct: 578 IGCVTSLFI--LIGSMGYVTYGEDINTVILINLPNDKVTVQSIQLLYSIAIMLSIPLQIF 635

Query: 352 VLRDVVRDLAHFHSGEATAPAELSTKKHV-------AVTSALVFLTMTVSLTTCN-LGAL 403
               ++ +    + G +      S K +V        + S ++ + + +S    N L   
Sbjct: 636 PAIKIIENFI-INYGVSGGDYRRSGKYNVYYKWLKNCLRSIIIVIIILISKEFINQLDKF 694

Query: 404 FELIGATTASMMAYILPPLTNLLLTGRAKTLRQKLPYYGCIVFGFAVMVISS 455
             +IG+     + YI P L +L   G       K   +  I+ G AVMV ++
Sbjct: 695 VSIIGSVACIPLVYIYPSLLHLRCGG------NKFRNWVMILLGLAVMVFTT 740

>Suva_12.83 Chr12 (119404..121215) [1812 bp, 603 aa] {ON} YJR001W
           (REAL)
          Length = 603

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 71/181 (39%), Gaps = 11/181 (6%)

Query: 25  HMQPAHASGSAADEDDETKFVDTGADVEDPLVSGIVTENQTKSNIYMAFMNMANSILGAG 84
            M    A  + A+ D E+  V     ++  +V+ +  ++     I+    N  N ++G G
Sbjct: 171 EMMSGGAGRNYANNDMESIVVKRVEGIDGKVVTLLAGQSTGPQTIF----NSINVLIGIG 226

Query: 85  IIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGKT--TYQDSVEFAMGRRG 142
           ++  P  +   G   G   + +  L    T  L+   L  T  T  +Y D    A G +G
Sbjct: 227 LLALPLGLRYAGWVLGFTLLSIFALGTFCTAELLSRCLD-TDPTLISYADLGYAAFGSKG 285

Query: 143 KLLILAANGLFAXXXXXXXXXXXXDTIPHVLRAFFPAHTALFHRNAIIFFVTLFVSYPLS 202
           + LI A   L              D+    L A FP ++  F +    FF+T  V  PLS
Sbjct: 286 RALISALFTLDLLGSGVSLVILFGDS----LNALFPQYSTTFFKIVSFFFITPPVFIPLS 341

Query: 203 L 203
           +
Sbjct: 342 V 342

>KAFR0D02000 Chr4 (407474..409618) [2145 bp, 714 aa] {ON} Anc_2.177
           YNL101W
          Length = 714

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 50/112 (44%), Gaps = 1/112 (0%)

Query: 38  EDDETKFVDTGADVEDPLVSGIVTENQTKSNIYMAFMNMANSILGAGIIGQPFAINNCGL 97
           E++ +  V TG  + D +    V   +  ++   AF+ +  S +G G++  P A +N GL
Sbjct: 271 EEERSPLV-TGLTLPDSVTRANVETIKGTTSTRKAFLLLLKSFVGTGVLFLPDAFHNGGL 329

Query: 98  AGGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQDSVEFAMGRRGKLLILAA 149
           A  +  + L+ L   W   ++V         ++ D      G+  K +IL A
Sbjct: 330 AFSIIVLTLVGLYSYWCYYILVQTKVKVKACSFGDIGSQLYGKWMKSVILVA 381

>TBLA0B07210 Chr2 (1705801..1707294) [1494 bp, 497 aa] {ON}
           Anc_2.295 YIL088C
          Length = 497

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 29/44 (65%), Gaps = 4/44 (9%)

Query: 67  SNIYMAFMNMANSILGAGIIGQPFAINNCGLAGGVAAIVLLTLL 110
           ++I+ + +N+  +I+GAG++  PFA  N G+  G    +LLTLL
Sbjct: 6   ASIHSSIINLTKTIVGAGMLAIPFAFRNDGILVG----ILLTLL 45

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 384 SALVFLTM-TVSLTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRAKTLR 435
           SA + ++M +++L   +   +  L+GAT ++ +++ILP L   +L GR K  R
Sbjct: 406 SAFLLISMFSIALNIKSFALVLSLVGATGSTSISFILPGLLGYILIGRDKISR 458

>Smik_10.279 Chr10 (433747..435555) [1809 bp, 602 aa] {ON} YJR001W
           (REAL)
          Length = 602

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 70/181 (38%), Gaps = 11/181 (6%)

Query: 25  HMQPAHASGSAADEDDETKFVDTGADVEDPLVSGIVTENQTKSNIYMAFMNMANSILGAG 84
            M    A  S  + D E+  V     V+  +V+ +  ++     I+    N  N ++G G
Sbjct: 170 EMMSGGAGRSCINNDMESIVVKRVEGVDGKVVTLLAGQSTAPQTIF----NSINVLIGIG 225

Query: 85  IIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGKT--TYQDSVEFAMGRRG 142
           ++  P  +   G   G+  + +  +    T  L+   L  T  T  +Y D    A G +G
Sbjct: 226 LLALPLGLKYAGWVLGLTMLAIFAIGTFCTAELLSRCLD-TDPTLISYADLGYAAFGSKG 284

Query: 143 KLLILAANGLFAXXXXXXXXXXXXDTIPHVLRAFFPAHTALFHRNAIIFFVTLFVSYPLS 202
           + LI A   L              D+    L A FP ++  F +    F +T  V  PLS
Sbjct: 285 RALISALFTLDLLGSGVSLVILFGDS----LNALFPQYSTTFFKIVSFFVITPPVFIPLS 340

Query: 203 L 203
           +
Sbjct: 341 V 341

>NDAI0F02660 Chr6 complement(649723..651855) [2133 bp, 710 aa] {ON}
           Anc_2.177
          Length = 710

 Score = 30.8 bits (68), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 42/210 (20%), Positives = 80/210 (38%), Gaps = 28/210 (13%)

Query: 277 SLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKDKTKGNILNNFPSDDNVINVARF 336
           S+KNP  ++F  +     + +  +   +   G+L +   T+  IL N P D   +   + 
Sbjct: 503 SMKNP--EKFPLVLGFVLIAATFLFITIASIGYLSYGSSTEVVILLNLPQDSIFVISIQL 560

Query: 337 CFGFNMLTTFPLE------------------IFVLRDVVRDLAHFHSGEATAPAELSTKK 378
            +   ++ + PL+                  I+V  D  R    F      A  ++   K
Sbjct: 561 FYSLAIMLSTPLQMFPAIKIIENKVFPRFTKIYVEGDGDRCDVEFRLNSGKANWKVKWLK 620

Query: 379 HVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNL-------LLTGRA 431
           +   +  + F+ +       NL  +  LIG+     + YI PPL +L         +G  
Sbjct: 621 NFVRSIIVSFVIIFAYYEVDNLDKVVSLIGSFACIPLVYIYPPLLHLRSRSRSQSPSGDP 680

Query: 432 KTLRQKLPYYGCIVFGFAVMVISSTQTILA 461
              +  L +   +VFG   M+ +S Q++  
Sbjct: 681 SKWKLVLDHI-LVVFGGISMIYTSYQSMFG 709

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.138    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,035,845
Number of extensions: 1558729
Number of successful extensions: 5598
Number of sequences better than 10.0: 119
Number of HSP's gapped: 5626
Number of HSP's successfully gapped: 166
Length of query: 473
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 360
Effective length of database: 40,524,141
Effective search space: 14588690760
Effective search space used: 14588690760
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)