Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0C00572g1.10ON33833816480.0
TDEL0C069301.10ON1841653953e-46
KLLA0C00594g1.10ON1941593615e-41
Kwal_33.130231.10ON1931633607e-41
ZYRO0F18370g1.10ON2201653611e-40
KLTH0F00572g1.10ON1951653354e-37
NDAI0A001901.10ON1711573255e-36
KAFR0D001901.10ON1851732812e-29
KNAG0C002701.10ON1741682793e-29
NCAS0B090601.10ON1671642741e-28
TPHA0E039601.10ON1771702575e-26
TBLA0A049701.10ON1811671823e-15
Ecym_10121.10ON1771711805e-15
Kpol_2002.131.10ON1641571373e-09
Suva_3.1571.10ON144120850.016
Skud_3.81.10ON144120830.026
YCL056C (PEX34)1.10ON144162790.091
Smik_3.191.10ON144130730.49
KLTH0D09416g8.601ON395143685.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0C00572g
         (338 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON...   639   0.0  
TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1....   156   3e-46
KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}...   143   5e-41
Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}...   143   7e-41
ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON} conse...   143   1e-40
KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}...   133   4e-37
NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON} ...   129   5e-36
KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON} ...   112   2e-29
KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON} ...   112   3e-29
NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1....   110   1e-28
TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10...   103   5e-26
TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa] {...    75   3e-15
Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON} si...    74   5e-15
Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON...    57   3e-09
Suva_3.157 Chr3 complement(236677..237111) [435 bp, 144 aa] {ON}...    37   0.016
Skud_3.8 Chr3 complement(14921..15355) [435 bp, 144 aa] {ON} YCL...    37   0.026
YCL056C Chr3 complement(26925..27359) [435 bp, 144 aa] {ON}  PEX...    35   0.091
Smik_3.19 Chr3 complement(28371..28805) [435 bp, 144 aa] {ON} YC...    33   0.49 
KLTH0D09416g Chr4 (779251..780438) [1188 bp, 395 aa] {ON} simila...    31   5.2  

>SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON}
           conserved hypothetical protein
          Length = 338

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/338 (92%), Positives = 314/338 (92%)

Query: 1   MHALSTVRSVEPRRDSVRTXXXXXXXXDSHLAAGNKLTCILAVRLIALDCLLPRLIAEIG 60
           MHALSTVRSVEPRRDSVRT        DSHLAAGNKLTCILAVRLIALDCLLPRLIAEIG
Sbjct: 1   MHALSTVRSVEPRRDSVRTCVCVCVCVDSHLAAGNKLTCILAVRLIALDCLLPRLIAEIG 60

Query: 61  GCCKYRHCTTRDPESLSLLAFVPEYTRSSPTSHDFYSFXXXXXXXXXXXXXXXXFPPPQC 120
           GCCKYRHCTTRDPESLSLLAFVPEYTRSSPTSHDFYSF                FPPPQC
Sbjct: 61  GCCKYRHCTTRDPESLSLLAFVPEYTRSSPTSHDFYSFLLKARALTLSTSLSLAFPPPQC 120

Query: 121 LVGFPLSLALSNEQEIDPSMAARRNTVDRMLELSTVLETSNEEHEDEKGKQQPASFEDIL 180
           LVGFPLSLALSNEQEIDPSMAARRNTVDRMLELSTVLETSNEEHEDEKGKQQPASFEDIL
Sbjct: 121 LVGFPLSLALSNEQEIDPSMAARRNTVDRMLELSTVLETSNEEHEDEKGKQQPASFEDIL 180

Query: 181 IGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVLSLRKSLGQLFR 240
           IGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVLSLRKSLGQLFR
Sbjct: 181 IGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVLSLRKSLGQLFR 240

Query: 241 LARARHMLQKERRSTPHKCSKTFAKIIADKFTQKIGQLDRQIKDVLLDVLQNLAYLLVVA 300
           LARARHMLQKERRSTPHKCSKTFAKIIADKFTQKIGQLDRQIKDVLLDVLQNLAYLLVVA
Sbjct: 241 LARARHMLQKERRSTPHKCSKTFAKIIADKFTQKIGQLDRQIKDVLLDVLQNLAYLLVVA 300

Query: 301 VDVFKLKLPHRWRRLLEWVSSLVTVSRFFFTGFSTIAV 338
           VDVFKLKLPHRWRRLLEWVSSLVTVSRFFFTGFSTIAV
Sbjct: 301 VDVFKLKLPHRWRRLLEWVSSLVTVSRFFFTGFSTIAV 338

>TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1.10
           YCL056C
          Length = 184

 Score =  156 bits (395), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 77/165 (46%), Positives = 110/165 (66%)

Query: 174 ASFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVLSLRK 233
            SFED LI GLES+ + FD+VY  K+ GIIGE NF+YR LNKGG GSKLW  TL+LS+RK
Sbjct: 20  TSFEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLWFVTLLLSVRK 79

Query: 234 SLGQLFRLARARHMLQKERRSTPHKCSKTFAKIIADKFTQKIGQLDRQIKDVLLDVLQNL 293
            L Q+F++ R R  L+ E +            ++ +K    + + +  +++ LLD+LQN 
Sbjct: 80  CLRQIFQIVRNRIRLKTEIKGMDKNGKGLMNDVLKEKILLMLQKSNAMMRETLLDLLQNS 139

Query: 294 AYLLVVAVDVFKLKLPHRWRRLLEWVSSLVTVSRFFFTGFSTIAV 338
            YL++V +DVFKL +P R R++LE +S+ VT+ RFF  GFS++ V
Sbjct: 140 VYLMIVVIDVFKLNIPKRARQILEPLSNFVTIMRFFTMGFSSVDV 184

>KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}
           conserved hypothetical protein
          Length = 194

 Score =  143 bits (361), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 112/159 (70%)

Query: 175 SFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVLSLRKS 234
           S ED+LI  L S+++ FDD+YLL++FGII +TNF+Y+ LNKG +GSK+WL +L+LS+R+S
Sbjct: 32  SLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVWLVSLLLSIRRS 91

Query: 235 LGQLFRLARARHMLQKERRSTPHKCSKTFAKIIADKFTQKIGQLDRQIKDVLLDVLQNLA 294
           L +L+ L R +  L+KE  +     S  F K++ +K   +  QL  +I+ + +D+LQ+L 
Sbjct: 92  LTRLYTLIRLKLKLRKECMNIASTYSPGFKKLVKEKILAESNQLSLKIRSLCMDLLQDLL 151

Query: 295 YLLVVAVDVFKLKLPHRWRRLLEWVSSLVTVSRFFFTGF 333
           Y+++V++D+FK+ L  +++R LE +SS  TV +F  + +
Sbjct: 152 YMIIVSIDIFKINLSLKFKRALELISSAATVLKFVSSSY 190

>Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}
           [contig 123] FULL
          Length = 193

 Score =  143 bits (360), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 73/163 (44%), Positives = 106/163 (65%)

Query: 168 KGKQQPASFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATL 227
           K  +   + E+  I G+ES+  +FDD++LLK+FGII E+N+VYR LNK G  SK+WL +L
Sbjct: 25  KTNKGGEAIENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVWLLSL 84

Query: 228 VLSLRKSLGQLFRLARARHMLQKERRSTPHKCSKTFAKIIADKFTQKIGQLDRQIKDVLL 287
           VLS RK +  L  L  +R  L+KE        S +  + ++DK   KI  ++R++  V L
Sbjct: 85  VLSTRKCIRDLNNLWMSRSRLRKEEVHFTMHSSNSLRRALSDKIALKIKDVNRRLILVAL 144

Query: 288 DVLQNLAYLLVVAVDVFKLKLPHRWRRLLEWVSSLVTVSRFFF 330
           +++QN+AYL++VA DVF L L  RW+ LLE  SSL+TV +F F
Sbjct: 145 EIMQNIAYLIIVAADVFTLNLVERWKNLLEKCSSLLTVLKFLF 187

>ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON}
           conserved hypothetical protein
          Length = 220

 Score =  143 bits (361), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 72/165 (43%), Positives = 109/165 (66%), Gaps = 1/165 (0%)

Query: 175 SFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVLSLRKS 234
           +FED LI GLES+  +FD+VYLLK  GII E N +YR LNKG  GSKLW  TL+LS RKS
Sbjct: 56  TFEDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLLSARKS 115

Query: 235 LGQLFRLARARHMLQKERRSTPHKCSKTFAK-IIADKFTQKIGQLDRQIKDVLLDVLQNL 293
             +L ++ +A+  L++E +    +  +   K ++ +KFT  + +    IKDV+L++LQ L
Sbjct: 116 FSRLLKIMKAKSKLKEEMKELRTEGDEDLVKQVLRNKFTDALKKCSIIIKDVVLELLQTL 175

Query: 294 AYLLVVAVDVFKLKLPHRWRRLLEWVSSLVTVSRFFFTGFSTIAV 338
           AYL +V ++VFK+ +  +  ++LE +S  + V R F TG++T+ V
Sbjct: 176 AYLAIVVIEVFKINVSQKVIKILEPLSHFIAVIRIFTTGYTTLTV 220

>KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}
           conserved hypothetical protein
          Length = 195

 Score =  133 bits (335), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 104/165 (63%)

Query: 172 QPASFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVLSL 231
           Q  + E  L+ GLE++  +FDD+ LL++FG+IGE N  Y+ LNK G  SK WL +L LS 
Sbjct: 29  QGKNIESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSKAWLVSLTLSS 88

Query: 232 RKSLGQLFRLARARHMLQKERRSTPHKCSKTFAKIIADKFTQKIGQLDRQIKDVLLDVLQ 291
           R++   +  LA +R  L++E+     +      K++  K T +I ++++++  V L+++Q
Sbjct: 89  RRNASDIINLAISRSRLKREQAEFMRRPVNPVRKVLNAKVTARIQEINQKLILVALELIQ 148

Query: 292 NLAYLLVVAVDVFKLKLPHRWRRLLEWVSSLVTVSRFFFTGFSTI 336
           N+ YL +VA DV    L  +W+RLLE VSS+  ++R  F+GFS++
Sbjct: 149 NIGYLTLVAADVLAFGLTEKWKRLLERVSSIFAIARLLFSGFSSL 193

>NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON}
           Anc_1.10 YCL056C
          Length = 171

 Score =  129 bits (325), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 101/157 (64%), Gaps = 2/157 (1%)

Query: 175 SFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVLSLRKS 234
           + ED +IGGLE + N+FD+VYLLK+ GII E N +YR+LNKG  GSK+W  TL+L+ RK 
Sbjct: 4   TMEDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTTRKL 63

Query: 235 LGQLFRLARARHMLQKERRSTPH--KCSKTFAKIIADKFTQKIGQLDRQIKDVLLDVLQN 292
           + QL R  +AR  L KER+++    +     + ++ +K    I +    I D+LL++ Q 
Sbjct: 64  VHQLIRAVKARIRLVKERKNSKRITRNENLVSSVLHEKLDIGIKKCSSMIMDLLLELFQT 123

Query: 293 LAYLLVVAVDVFKLKLPHRWRRLLEWVSSLVTVSRFF 329
           L YL +V++++FKLK   +   +LE +S+L+ + R F
Sbjct: 124 LVYLFLVSINIFKLKFSDKMVYVLEHLSNLLVLIRMF 160

>KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON}
           Anc_1.10 YCL056C
          Length = 185

 Score =  112 bits (281), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/173 (38%), Positives = 105/173 (60%), Gaps = 8/173 (4%)

Query: 165 EDEKGKQQPASFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWL 224
           +D++  ++  + EDILI  LE +  VFD++Y LKN G+I E NF+Y+ LNKG LGSK+WL
Sbjct: 8   KDDEFHRKSITLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWL 67

Query: 225 ATLVLSLRKSLGQLFRLARARHMLQKERRSTPHKCSKT-----FAKIIADKFTQKIGQLD 279
            +L+LS+R+    L  + R R     E      K +++        I+ DK  Q + + +
Sbjct: 68  VSLILSIRRCFKNLTHMYRTRRKYVTELSIVSKKRNQSSENGLVNGILKDKLLQSLQKCN 127

Query: 280 RQIKDVLLDVLQNLAYLLVVAVDVFKLKLPHRWR---RLLEWVSSLVTVSRFF 329
             I+D+LL+ LQ L YL++V ++VFK+K   R+    R LE +S+L+TV+R  
Sbjct: 128 SIIRDLLLEFLQVLLYLIIVIIEVFKVKSLERYVKGIRNLEILSNLITVTRII 180

>KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON}
           Anc_1.10 YCL056C
          Length = 174

 Score =  112 bits (279), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 63/168 (37%), Positives = 106/168 (63%), Gaps = 8/168 (4%)

Query: 175 SFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVLSLRKS 234
           S+ED+L+G LES+ ++FD++YLLK+ GII + NF+YR LNKG +GSK+W  TL+LS+RK+
Sbjct: 8   SWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLILSIRKN 67

Query: 235 LGQLFRLARARHML--QKERRSTPHKCSKTFA-KIIADKFTQKIGQLDRQIKDVLLDVLQ 291
           L +L RL + R  L  + E+     K   +    ++ +K +  + +    I D  LD+ Q
Sbjct: 68  LKRLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDTFLDLAQ 127

Query: 292 NLAYLLVVAVDVFKLKLPHRWRRLLEW---VSSLVTVSRFFFTGFSTI 336
            L YL +V+ D F   +P R+++  ++   +S++VT+ R   + ++TI
Sbjct: 128 LLIYLFIVSGDCF--NIPPRFKKFKKYLGPMSNVVTILRMLVSVYTTI 173

>NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1.10
           YCL056C
          Length = 167

 Score =  110 bits (274), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 104/164 (63%), Gaps = 3/164 (1%)

Query: 176 FEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVLSLRKSL 235
            ED ++  LES+ N+FD+VY  K+ G++ E N +YR LNKG  GSKLW  TL+LS +K +
Sbjct: 4   LEDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGSKLWFLTLLLSSKKLI 63

Query: 236 GQLFRLARARHMLQKERRSTPHKCSKT---FAKIIADKFTQKIGQLDRQIKDVLLDVLQN 292
            +L +  + R  ++KE   +P +  +       ++ +K    + +    I++ +L++LQ 
Sbjct: 64  TRLTKSLKIRAKIKKEIDESPKENDEDKSLVNSLLREKLELSLAKCMDIIRNNVLELLQT 123

Query: 293 LAYLLVVAVDVFKLKLPHRWRRLLEWVSSLVTVSRFFFTGFSTI 336
           + YL +  ++VFK+K+P +W+ LLE +S+++T+ R F +G+S++
Sbjct: 124 MMYLSIAFINVFKVKVPQKWKHLLEQLSNIITIIRVFISGYSSL 167

>TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10
           YCL056C
          Length = 177

 Score =  103 bits (257), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 56/170 (32%), Positives = 104/170 (61%), Gaps = 3/170 (1%)

Query: 160 SNEEHEDEKGKQQPASFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLG 219
           S++   DE G ++   FE  L+  LES+TN+FD V+ L++ G+I E NF YR+LN+  +G
Sbjct: 3   SSDVFSDENGNEE--GFESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIG 60

Query: 220 SKLWLATLVLSLRKSLGQLFRLARARHMLQKERRSTPHKCSKTFAKIIADKFTQKIGQLD 279
           SK+W  TL+LS+RK    + +  +   +L+ E  +   K +   + II  K       L 
Sbjct: 61  SKIWFVTLILSIRKLYKNILKSTKLLSLLKTE-LTKIEKNNDLTSDIILQKIQNNNTILK 119

Query: 280 RQIKDVLLDVLQNLAYLLVVAVDVFKLKLPHRWRRLLEWVSSLVTVSRFF 329
           ++IK+ +++++Q+  YL++V++++FK+ +  +    LE +S+ V++ +FF
Sbjct: 120 KKIKNFIIELIQDFIYLIIVSLEIFKISISKKLNHRLEILSNSVSMLKFF 169

>TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa] {ON}
           Anc_1.10 YCL056C
          Length = 181

 Score = 74.7 bits (182), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 99/167 (59%), Gaps = 11/167 (6%)

Query: 178 DILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVLSLRKSLGQ 237
           DIL G LES+ +VFD++Y L++ G+I +TN  YR LN+  LGSK+WL TLVL++RK   +
Sbjct: 12  DILYG-LESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITLVLNIRKDTLE 70

Query: 238 LFRLARARHMLQKE--------RRSTPHKCSKTFAKIIADKFTQKIGQLDRQIKDVLLDV 289
           L +L + +  +  E        +       SK    II DK    +  ++  IKD + D+
Sbjct: 71  LLKLLKLKTKISDELEFQLTKLKMEKIGNYSKDVTLIIKDKLQNSLKIINNSIKDRIFDL 130

Query: 290 LQNLAYLLVVAVDV--FKLKLPHRWRRLLEWVSSLVTVSRFFFTGFS 334
           +QNL YLL++ +++     K   R++ +LE +S+++ VSR F T F+
Sbjct: 131 IQNLIYLLILLINIGGHYYKSLQRFKHILEIISNMLIVSRVFSTNFN 177

>Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON}
           similar to XP_452220 - K. lactis - KLLA0C00594g
          Length = 177

 Score = 73.9 bits (180), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 82/171 (47%), Gaps = 14/171 (8%)

Query: 153 LSTVLETSNE-EHEDEKGKQQPASFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYR 211
           LS +   + E   ED      P +FED L   L S    +D +YL ++ GII + N +Y+
Sbjct: 9   LSGIFRYAEELSKEDSDTNGSPTTFEDQLTENLRSAVTFYDLIYLFQSIGIIKKDNVIYK 68

Query: 212 HLNKGGLGSKLWLATLVLSLRKSLGQLFRLARARHMLQKERRSTPHKCSKTFAKIIADKF 271
            L  G + S   L  L+L  RK+  +L RL R  + L   +   P          I  K+
Sbjct: 69  ALAVGKINSGSRLLFLLLVARKTFLKLLRLVRLWYAL---KNVLPPAS-------IKKKY 118

Query: 272 TQKIGQLDRQIKDVLLDVLQNLAYLLVVAVDVFKLKLPHRWR---RLLEWV 319
            +   ++ R I  + +D+L  L YL+VV +D+FK K+    R   RLL W+
Sbjct: 119 NETKSRVKRSILRLSVDLLDTLVYLIVVLIDLFKFKVSDSTRKLSRLLFWI 169

>Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON}
           complement(23954..24448) [495 nt, 165 aa]
          Length = 164

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/157 (31%), Positives = 93/157 (59%), Gaps = 5/157 (3%)

Query: 176 FEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVLSLRKSL 235
           +EDI++ GLE + ++FD +Y +K  GII + +F+YR + +     KLWLATL+L ++K +
Sbjct: 6   WEDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKIIQNNFSLKLWLATLLLIIKKLV 65

Query: 236 GQLFRLARARHMLQKERRS-----TPHKCSKTFAKIIADKFTQKIGQLDRQIKDVLLDVL 290
            +LF+  +    L+ E +        +  +     I+ +K  +KI Q    IK  LLD++
Sbjct: 66  VKLFQNYKILRFLKIELKQHINNNNNNNKNNHINSILLEKLNKKINQHYNFIKLNLLDLI 125

Query: 291 QNLAYLLVVAVDVFKLKLPHRWRRLLEWVSSLVTVSR 327
           QNL Y  +V +++ KLK+  + + +LE +++ +T+ +
Sbjct: 126 QNLLYCAIVIIELLKLKISKKSKFILELLANSITIVK 162

>Suva_3.157 Chr3 complement(236677..237111) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score = 37.4 bits (85), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 57/120 (47%), Gaps = 8/120 (6%)

Query: 181 IGGLESLTNVFDDVY-LLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVLSLRKSLGQLF 239
           IGG +  T V++ V  LL  F ++     V   L   G+  K+WL    +S+ + + +L 
Sbjct: 10  IGGRDPWTKVWNGVSSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSWISVVRCVWKLI 69

Query: 240 RLARARHMLQKERRSTPHKCSKTFAKIIADKFTQKIGQLDRQIKDVLLDVLQNLAYLLVV 299
           +L R +  + +      +        +I +K        + QIK +  ++LQ+L+YL+V+
Sbjct: 70  KLCRVKFKINERLNGQGNG-------LIKEKLINFGKMYNDQIKQITANLLQDLSYLMVL 122

>Skud_3.8 Chr3 complement(14921..15355) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score = 36.6 bits (83), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 58/120 (48%), Gaps = 8/120 (6%)

Query: 181 IGGLESLTNVFDDVY-LLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVLSLRKSLGQLF 239
           IGG +  TN+++    LL  F ++     V   L   G+  K+WL    +S+ + + +L 
Sbjct: 10  IGGKDIWTNIWNSASSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSWVSVVRCIWKLI 69

Query: 240 RLARARHMLQKERRSTPHKCSKTFAKIIADKFTQKIGQLDRQIKDVLLDVLQNLAYLLVV 299
           +L + +  + +      +        +I +K        + QI+ ++ ++LQ+L+YL+V+
Sbjct: 70  KLCKVKFKIDERLNGQGNG-------LIKEKLVNFRKMYNDQIRQIIANLLQDLSYLMVL 122

>YCL056C Chr3 complement(26925..27359) [435 bp, 144 aa] {ON}
           PEX34Peroxisomal integral membrane protein that
           regulates peroxisome populations; interacts with Pex11p,
           Pex25p, and Pex27p to control both constitutive
           peroxisome division and peroxisome morphology and
           abundance during peroxisome proliferation
          Length = 144

 Score = 35.0 bits (79), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 33/162 (20%), Positives = 72/162 (44%), Gaps = 22/162 (13%)

Query: 168 KGKQQPASFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATL 227
           K      S +DI       ++++ D   +L+N G++ +  +V       GL  K+WL   
Sbjct: 4   KKNTAEISAKDIWENIWSGVSSLLDFFAVLENLGVVNDKLYV------SGLLRKVWLCYS 57

Query: 228 VLSLRKSLGQLFRLARARHMLQKERRSTPHKCSKTFAKIIADKFTQKIGQLDRQIKDVLL 287
            +S+ K + +L +L + +  + +      +        ++ DK      + +  I+ +  
Sbjct: 58  CISVIKCVWKLIKLCKVKFKIDQRLDGEGNG-------LVKDKLINFKKKYNEHIRHITA 110

Query: 288 DVLQNLAYLLVVAVDVFKLKLPHRWRRLLEWVSSLVTVSRFF 329
            +LQ+L+YL+V         L +   RL + +S+++T+ R  
Sbjct: 111 ALLQDLSYLMV---------LIYPGTRLFKRLSNIITLCRII 143

>Smik_3.19 Chr3 complement(28371..28805) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score = 32.7 bits (73), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 27/130 (20%), Positives = 62/130 (47%), Gaps = 13/130 (10%)

Query: 170 KQQPASFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVL 229
           K    S +++ I     ++++ D   +L+N G++ +  +V       G+  K+WL    +
Sbjct: 6   KSAEVSGKNLWINVWNGVSSLLDFFAVLENLGVVDDKLYV------SGVLRKVWLCYSWI 59

Query: 230 SLRKSLGQLFRLARARHMLQKERRSTPHKCSKTFAKIIADKFTQKIGQLDRQIKDVLLDV 289
           S+ K + +L  L + +  +  +R + P         ++ +K      +   QI+ +   +
Sbjct: 60  SVIKCVWKLINLCKVKFKID-QRLNGPGN------GLVKEKLMNFKKRYRDQIRQITATL 112

Query: 290 LQNLAYLLVV 299
           LQ+L+YL+V+
Sbjct: 113 LQDLSYLMVL 122

>KLTH0D09416g Chr4 (779251..780438) [1188 bp, 395 aa] {ON} similar
           to uniprot|Q6B2A9 Saccharomyces cerevisiae YPL112C PEX25
           Peripheral peroxisomal membrane peroxin required for the
           regulation of peroxisome size and maintenance recruits
           GTPase Rho1p to peroxisomes induced by oleate interacts
           with homologous protein Pex27p
          Length = 395

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 65/143 (45%), Gaps = 29/143 (20%)

Query: 190 VFDDVYLLKNFGII---GETNFVYRHLNKGGLGSKLWLATLVLSLRKSLGQLFRLARARH 246
           V D++ LL  F +    G   +V +H       S  W   ++L L+K+   L +L RA+ 
Sbjct: 227 VMDELMLLHKFKVWHHPGLYTWVAKH------ESLSWYYDIMLGLKKNWCSLQQLNRAQL 280

Query: 247 ML----QKERRS---TPHKCSKTFAKIIA-------------DKFTQKIGQLDRQIKDVL 286
            L    Q ++R+   +     KT + I               D+F+++I  ++RQ + V+
Sbjct: 281 ELSIQEQVKKRALELSSRLQGKTASPIKQQLLQDLQTGQEHNDQFSKRIRDIERQRRVVI 340

Query: 287 LDVLQNLAYLLVVAVDVFKLKLP 309
           LD+++     L    DVF LK P
Sbjct: 341 LDLVRLSFDFLADTTDVFNLKTP 363

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,986,255
Number of extensions: 1189281
Number of successful extensions: 4564
Number of sequences better than 10.0: 22
Number of HSP's gapped: 4681
Number of HSP's successfully gapped: 22
Length of query: 338
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 228
Effective length of database: 40,868,139
Effective search space: 9317935692
Effective search space used: 9317935692
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 66 (30.0 bits)