Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0C00550g1.9ON73273238580.0
KLLA0C00572g1.9ON71272726800.0
ZYRO0F18392g1.9ON72573726580.0
Kpol_2002.121.9ON73972426380.0
NCAS0B090701.9ON73071826180.0
KNAG0C002601.9ON74468625890.0
TPHA0E039701.9ON74773325130.0
KAFR0D001801.9ON72372325060.0
TBLA0A075601.9ON74168524740.0
CAGL0B00418g1.9ON74372624120.0
NDAI0A001801.9ON74067924100.0
Ecym_1011na 1ON71673122890.0
YCL057W (PRD1)1.9ON71268522810.0
Suva_3.1561.9ON71268922630.0
Smik_3.181.9ON71269522540.0
Skud_3.71.9ON71269022450.0
AGR406C1.9ON68367919600.0
AGR405Cna 1ON71768018120.0
ABR185WsingletonON45743110061e-129
CAGL0D02112g2.432ON7616324832e-50
KNAG0A062002.432ON7896814568e-47
SAKL0E03938g2.432ON7675524495e-46
NDAI0E020102.432ON7785574488e-46
KAFR0D029502.432ON7776754488e-46
AFR198W2.432ON7766754372e-44
Ecym_60992.432ON7735494292e-43
KLTH0D04730g2.432ON7725574283e-43
ZYRO0G20130g2.432ON7866844283e-43
TDEL0A020802.432ON7876774241e-42
Skud_11.932.432ON7725494222e-42
Kwal_26.76162.432ON7705494212e-42
Suva_11.912.432ON7756304177e-42
NCAS0A042802.432ON7736814151e-41
TBLA0I007102.432ON7735514081e-40
Kpol_297.82.432ON7875574072e-40
Smik_11.1022.432ON7725494062e-40
TPHA0G023902.432ON7956273955e-39
YKL134C (OCT1)2.432ON7725493912e-38
KLLA0B12397g2.432ON7795623555e-34
ADR312W3.168ON66066980.004
TDEL0D045503.168ON61766940.013
Ecym_52423.168ON75566910.029
SAKL0C07480g3.168ON75166860.10
KLLA0C03960g3.168ON67666840.21
CAGL0C05159g3.168ON63567810.47
NDAI0G029403.168ON70566800.54
Smik_4.5865.367ON1031117790.79
Ecym_60063.576ON71969761.7
SAKL0G15290g5.107ON74851752.4
NCAS0A080405.618ON79281724.7
Suva_2.4515.296ON87788716.4
NCAS0G011706.269ON1504192718.3
Kwal_23.43705.59ON69245709.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0C00550g
         (732 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly s...  1490   0.0  
KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar ...  1036   0.0  
ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]...  1028   0.0  
Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON} (21544....  1020   0.0  
NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa] ...  1013   0.0  
KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9 Y...  1001   0.0  
TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {O...   972   0.0  
KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9 Y...   969   0.0  
TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa] ...   957   0.0  
CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar ...   933   0.0  
NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9        932   0.0  
Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to ...   886   0.0  
YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc met...   883   0.0  
Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W ...   876   0.0  
Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)   872   0.0  
Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)    869   0.0  
AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}...   759   0.0  
AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}...   702   0.0  
ABR185W Chr2 (758126..758380,758380..758709,758709..759029,75903...   392   e-129
CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {...   190   2e-50
KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {O...   180   8e-47
SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} simila...   177   5e-46
NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {O...   177   8e-46
KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {O...   177   8e-46
AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic ho...   172   2e-44
Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}...   169   2e-43
KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} simila...   169   3e-43
ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} simi...   169   3e-43
TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {O...   167   1e-42
Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {O...   167   2e-42
Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C...   166   2e-42
Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {O...   165   7e-42
NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {O...   164   1e-41
TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.4...   161   1e-40
Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON} ...   161   2e-40
Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {...   160   2e-40
TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {O...   156   5e-39
YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON} ...   155   2e-38
KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]...   141   5e-34
ADR312W Chr4 (1253622..1255604) [1983 bp, 660 aa] {ON} Syntenic ...    42   0.004
TDEL0D04550 Chr4 (833759..835612) [1854 bp, 617 aa] {ON} Anc_3.1...    41   0.013
Ecym_5242 Chr5 complement(498331..500598) [2268 bp, 755 aa] {ON}...    40   0.029
SAKL0C07480g Chr3 complement(690119..692374) [2256 bp, 751 aa] {...    38   0.10 
KLLA0C03960g Chr3 complement(361124..363154) [2031 bp, 676 aa] {...    37   0.21 
CAGL0C05159g Chr3 (492512..494419) [1908 bp, 635 aa] {ON} highly...    36   0.47 
NDAI0G02940 Chr7 complement(680031..682148) [2118 bp, 705 aa] {O...    35   0.54 
Smik_4.586 Chr4 (1043554..1046649) [3096 bp, 1031 aa] {ON} YDR32...    35   0.79 
Ecym_6006 Chr6 (14790..16949) [2160 bp, 719 aa] {ON} similar to ...    34   1.7  
SAKL0G15290g Chr7 complement(1316851..1319097) [2247 bp, 748 aa]...    33   2.4  
NCAS0A08040 Chr1 (1586844..1589222) [2379 bp, 792 aa] {ON} Anc_5...    32   4.7  
Suva_2.451 Chr2 (796994..799627) [2634 bp, 877 aa] {ON} YDR285W ...    32   6.4  
NCAS0G01170 Chr7 complement(208047..212561) [4515 bp, 1504 aa] {...    32   8.3  
Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {O...    32   9.8  

>SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly
           similar to gnl|GLV|KLLA0C00572g Kluyveromyces lactis
           KLLA0C00572g and similar to YCL057W uniprot|P25375
           Saccharomyces cerevisiae YCL057W PRD1 Zinc
           metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 732

 Score = 1490 bits (3858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 721/732 (98%), Positives = 721/732 (98%)

Query: 1   MLILKRANKFCSTTTSLLAIPALAFGAYSLLHSTNRTLRIPKSNYSTMSATMSATLVPPQ 60
           MLILKRANKFCSTTTSLLAIPALAFGAYSLLHSTNRTLRIPKSNYSTMSATMSATLVPPQ
Sbjct: 1   MLILKRANKFCSTTTSLLAIPALAFGAYSLLHSTNRTLRIPKSNYSTMSATMSATLVPPQ 60

Query: 61  AAPSWKYSPEDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPLINQLT 120
           AAPSWKYSPEDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPLINQLT
Sbjct: 61  AAPSWKYSPEDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPLINQLT 120

Query: 121 FLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDDAKFKKEHFELY 180
           FLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDDAKFKKEHFELY
Sbjct: 121 FLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDDAKFKKEHFELY 180

Query: 181 KFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFTTEELDGV 240
           KFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFTTEELDGV
Sbjct: 181 KFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFTTEELDGV 240

Query: 241 SASVMDQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLF 300
           SASVMDQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLF
Sbjct: 241 SASVMDQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLF 300

Query: 301 LETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSL 360
           LETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSL
Sbjct: 301 LETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSL 360

Query: 361 KEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGMLKIYETV 420
           KEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGMLKIYETV
Sbjct: 361 KEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGMLKIYETV 420

Query: 421 LKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAANFGI 480
           LKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAANFGI
Sbjct: 421 LKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAANFGI 480

Query: 481 ASSYVRDGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLVGGNHIGRF 540
           ASSYVRDGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLVGGNHIGRF
Sbjct: 481 ASSYVRDGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLVGGNHIGRF 540

Query: 541 NGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHVNGALF 600
           NGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHVNGALF
Sbjct: 541 NGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHVNGALF 600

Query: 601 ALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMXXXX 660
           ALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIM    
Sbjct: 601 ALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMSGAY 660

Query: 661 XXXXXXXMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNLREFLGREP 720
                  MWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNLREFLGREP
Sbjct: 661 SAGYYGYMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNLREFLGREP 720

Query: 721 NNEAFLKELGLS 732
           NNEAFLKELGLS
Sbjct: 721 NNEAFLKELGLS 732

>KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057W PRD1
           Zinc metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 712

 Score = 1036 bits (2680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/727 (68%), Positives = 592/727 (81%), Gaps = 22/727 (3%)

Query: 7   ANKFCSTTTSLLAIPALAFGAYSLLHSTNRTLRIPKSNYSTMSATMSAT-LVPPQAAPSW 65
           AN    + TSL+ IP LAF ++                ++ + + M+ T  V PQAAPSW
Sbjct: 6   ANLRFKSATSLVVIPTLAFASFQ---------------FNAIRSIMTKTDFVVPQAAPSW 50

Query: 66  KYSPEDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPLINQLTFLQHV 125
            Y+ E++L+ T+E I S++ L D+L  + NP+VE+ V P+L HENT  PL NQLTFLQHV
Sbjct: 51  NYTTEELLKQTHEAIDSSNELLDSLESISNPSVENFVTPYLHHENTISPLFNQLTFLQHV 110

Query: 126 SADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDDAKFKKEHFELYKFVEK 185
           S+DKE+RD STK TEL+++F IE+SLR  LF QFD VW   KDDA+FKK+HFE+YKFVEK
Sbjct: 111 SSDKELRDTSTKVTELIENFGIESSLRFKLFRQFDIVWNQLKDDAQFKKDHFEIYKFVEK 170

Query: 186 CHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFTTEELDGVSASVM 245
           CHKD++R+GLNLPEE+R++VKE++KKISNNSLQFSKNLGEQ EF+ FT EEL GVS +VM
Sbjct: 171 CHKDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVM 230

Query: 246 DQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLFLETLR 305
            QFE   D DG+ K+KV+FKYPDI PVLK+AKN ETRKRAF GDQNKVPQNE LFLETL+
Sbjct: 231 KQFET-VDEDGITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQ 289

Query: 306 LRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSLKEKDC 365
           LR++LA LL Y +YA+YNLDIKMAKK+E VL FL DLKNKLKPLG KE+  LK+LKE++C
Sbjct: 290 LRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPLGEKELTKLKNLKEEEC 349

Query: 366 KELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGMLKIYETVLKLKF 425
           KEL  P+D  YYIWDNRYYDN+YLK+N+ +DEEKI+EYFPLE TI GML+IYETVLKLKF
Sbjct: 350 KELNTPYDRRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKF 409

Query: 426 VEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAANFGIASSYV 485
           +EE + +    WH DVK+L+VWK+D    P FVGWIYFDLHPR+GKYGHAANFGI+SS++
Sbjct: 410 IEEDNGD---TWHPDVKKLSVWKMDD-NFPSFVGWIYFDLHPREGKYGHAANFGISSSFL 465

Query: 486 R-DGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLVGGNHIGRFNGPG 544
           + DG+RS+PVTALVCNFSKP+  KPALLKHSE+TTFFHELGHGIHDLVGGN IGRFNGP 
Sbjct: 466 KSDGSRSYPVTALVCNFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPS 525

Query: 545 ATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHVNGALFALRQ 604
           ATPWDFVEAPSQMLEFWTWNK EL +LS+HY+T EKIP+ LLDSL+ TKH+NGALFALRQ
Sbjct: 526 ATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQ 585

Query: 605 LTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMXXXXXXXX 664
           L FGLFDM VHT KD+  L+VT LWN LR+E+ L++NGD  TKGFNSFGHIM        
Sbjct: 586 LHFGLFDMKVHTTKDISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGY 645

Query: 665 XXXMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNLREFLGREPNNEA 724
              MWA+VFA+DMY+TKF  DPLN DVGV+YRDI+L+RGGLYEI+DNL EFLGR+PNN+A
Sbjct: 646 YGYMWADVFASDMYYTKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKA 705

Query: 725 FLKELGL 731
           FLKELGL
Sbjct: 706 FLKELGL 712

>ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]
           {ON} similar to uniprot|P25375 Saccharomyces cerevisiae
           YCL057W PRD1 Zinc metalloendopeptidase found in the
           cytoplasm and intermembrane space of mitochondria
          Length = 725

 Score = 1028 bits (2658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/737 (66%), Positives = 593/737 (80%), Gaps = 18/737 (2%)

Query: 2   LILKRANKFCSTTT----SLLAIPALAFGAYSLLHSTNRTLRIPKSNYSTMSATMSATLV 57
           ++L+  ++    T     S++A+PALA G Y          R+ K  YSTMS+      +
Sbjct: 1   MLLRSCSRVAGFTRKSIFSVVAVPALAIGIY----------RVSKFQYSTMSS--PNLFI 48

Query: 58  PPQAAPSWKYSPEDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPLIN 117
            PQ+APSW ++P+ +L  T+  I S+   +D+LA + NPTVE+LVKP++ HEN    + +
Sbjct: 49  APQSAPSWAFTPQSLLDETHRLIESSKQFYDSLAQLSNPTVENLVKPYMHHENGVGLIES 108

Query: 118 QLTFLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDDA-KFKKEH 176
           QLTF Q VSADKE+RDAS +ATE LQ+F IE SLRHDLF+QFDK+W   KD + +   + 
Sbjct: 109 QLTFPQQVSADKEIRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKSFEQGSQE 168

Query: 177 FELYKFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFTTEE 236
           +E+YK+VEK H+DY R GL LPE+KR++VK+L+ KI+ NSL+FSKNLGEQKEFVAFT EE
Sbjct: 169 YEIYKYVEKIHRDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFTKEE 228

Query: 237 LDGVSASVMDQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQN 296
           LDGVS SVMDQFE+F D +G  K+KV+FKYPDI PVLKTAKNP+TRK AF  DQ+KVPQN
Sbjct: 229 LDGVSESVMDQFEQFKDENGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQN 288

Query: 297 EVLFLETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEA 356
           E LF+ETL+LR+ELA +LGYSTYANYNL++KMAK Q+ V  FL +LK+KLKPLG+KE E 
Sbjct: 289 EKLFVETLQLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAEN 348

Query: 357 LKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGMLKI 416
           LK +K+K+C+ L +P+D HYY+WD+RYYDNKYLK+NYNVD EKISEY+P+E TI GML I
Sbjct: 349 LKQIKQKECESLGLPYDGHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPIESTISGMLSI 408

Query: 417 YETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAA 476
           YET+LKLKFVEETD EK+ VWHEDVKQLAVWK+D    PEFVGWIYFDLHPRDGKYGHAA
Sbjct: 409 YETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGHAA 468

Query: 477 NFGIASSYVR-DGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLVGGN 535
           NFGI++SYV+ DG RS+PVTALVCNFSKPSAKKP+LLKH+EI+TFFHELGHGIHDLVG N
Sbjct: 469 NFGISASYVKEDGTRSYPVTALVCNFSKPSAKKPSLLKHNEISTFFHELGHGIHDLVGEN 528

Query: 536 HIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHV 595
            +  FNGPGA PWDFVEAPSQMLEFWTWN+ EL  LS HYE+GEKIP+ LL SLI+TKHV
Sbjct: 529 RLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLLQSLISTKHV 588

Query: 596 NGALFALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHI 655
           +GALFALRQL FGLFDM VHT K++  LD+  LWN+LR+EVSLVENGD  TKG++SFGHI
Sbjct: 589 DGALFALRQLHFGLFDMYVHTSKNVAKLDLLKLWNELREEVSLVENGDTFTKGYDSFGHI 648

Query: 656 MXXXXXXXXXXXMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNLREF 715
           M           MWAEVFAADMYHT+FAADPL+   GV+YRDIVL RGGLYE +DNLREF
Sbjct: 649 MSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNLREF 708

Query: 716 LGREPNNEAFLKELGLS 732
           LGREP+ EAFLKELGL+
Sbjct: 709 LGREPSEEAFLKELGLN 725

>Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON}
           (21544..23763) [2220 nt, 740 aa]
          Length = 739

 Score = 1020 bits (2638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/724 (65%), Positives = 587/724 (81%), Gaps = 23/724 (3%)

Query: 15  TSLLAIPALAFGAYSLLHSTNRTLRIPKSNYSTMSATMSATLVPPQAAPSWKYSPEDILQ 74
            S  A+PA+AF                   YSTM  T S+ L+ PQ AP+W ++PE I++
Sbjct: 33  VSFFAVPAIAFTILK---------------YSTM--TNSSLLIAPQPAPTWNWTPEGIVK 75

Query: 75  LTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPLINQLTFLQHVSADKEVRDA 134
                I  ++ + D LA + +PTVE+ + P++ HEN   PLINQLTFLQHVSADK++RD+
Sbjct: 76  DAESLIKDSNRIFDNLAAISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADKDIRDS 135

Query: 135 STKATELLQDFEIEASLRHDLFVQFDKVWQACKDDAKFKKE----HFELYKFVEKCHKDY 190
           S KATEL+Q+FEIEASLR DLF+QFDK+W   KD+++F ++    ++E Y+F+EKCHKD+
Sbjct: 136 SMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRFIEKCHKDF 195

Query: 191 VRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFTTEELDGVSASVMDQFEK 250
           +R+GLNL +EKR  VK++QKKI++NSL FSKNLGEQKEF+AFT EELDGVS +VM+QFEK
Sbjct: 196 IRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDAVMEQFEK 255

Query: 251 FTD-TDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLFLETLRLRDE 309
           F D   G EK KV+FKYPDILPVLK+AKNP TRK AF  DQNKVP+NE LF++TL+LR++
Sbjct: 256 FKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDTLKLRND 315

Query: 310 LAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSLKEKDCKELA 369
           L+ +L YS YANYNL++KMAK +ETV  FL+DLK KL+PLG+KEIE LK LKEKD KEL 
Sbjct: 316 LSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPLGLKEIEILKQLKEKDMKELN 375

Query: 370 IPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGMLKIYETVLKLKFVEET 429
           +P+DNHYYIWD+RYYDNKYLK+N+NVD EKISEY+P+E +I GMLKIYETV+KLKFVEET
Sbjct: 376 LPYDNHYYIWDHRYYDNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMKLKFVEET 435

Query: 430 DAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAANFGIASSYV-RDG 488
           D  K+ VWHEDVKQL+VWK+D  ++PEF+GWIYFDLHPRDGKYGHAANFGI+SSYV  + 
Sbjct: 436 DPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSSYVDEND 495

Query: 489 ARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLVGGNHIGRFNGPGATPW 548
            RS+PVTALVCNFSKP++ KP+LLKH+E+TTFFHELGHGIHDLVG N   R NGPG+ PW
Sbjct: 496 KRSYPVTALVCNFSKPTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPW 555

Query: 549 DFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHVNGALFALRQLTFG 608
           DFVEAPSQMLEFWTWNKNEL +LS+HY+TGEKIPE L++SL++TKHVNGALFALRQL F 
Sbjct: 556 DFVEAPSQMLEFWTWNKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFS 615

Query: 609 LFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMXXXXXXXXXXXM 668
            FDM VHT +D+  L++  LWN LR+++ LVENGD+++KG++SFGHIM           M
Sbjct: 616 TFDMEVHTAEDVSKLNLLELWNGLREQICLVENGDEMSKGYDSFGHIMSGAYSAGYYGYM 675

Query: 669 WAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNLREFLGREPNNEAFLKE 728
           WAEVFA DMY+TKFAADPLN   GV YRDI+LSRGG+YE++DNL EFLGREPNN AFLKE
Sbjct: 676 WAEVFATDMYYTKFAADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLGREPNNSAFLKE 735

Query: 729 LGLS 732
           +GL+
Sbjct: 736 MGLN 739

>NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa]
           {ON} Anc_1.9
          Length = 730

 Score = 1013 bits (2618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/718 (68%), Positives = 584/718 (81%), Gaps = 14/718 (1%)

Query: 16  SLLAIPALAFGAYSLLHSTNRTLRIPKSNYSTMSATMSATLVPPQAAPSWKYSPEDILQL 75
           S + +PA AF            +   KS Y T+       + P   AP+WK+SPE IL  
Sbjct: 23  SAIVLPATAF------------ILTRKSFYMTLPTNNKLLVAPTGTAPTWKWSPESILAK 70

Query: 76  TNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPLINQLTFLQHVSADKEVRDAS 135
           T E I + + L+D+LA +E P+VESLVKP++ +EN    ++NQLTFLQHVSADK +RDAS
Sbjct: 71  TKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGLIVNQLTFLQHVSADKLIRDAS 130

Query: 136 TKATELLQDFEIEASLRHDLFVQFDKVWQACKDDAKFKKEHFELYKFVEKCHKDYVRAGL 195
            +ATELLQDF IEAS+R DLF QFDK+W   KDD   K + FE YKF+EK HKDYVR GL
Sbjct: 131 VEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKSKDFETYKFIEKVHKDYVRNGL 190

Query: 196 NLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFTTEELDGVSASVMDQFEKFTD-T 254
           NLPEEKRN+VK+++KKI++NSL +SKNLGEQKE+V+FT E+L GVS SVM+QFEKF D  
Sbjct: 191 NLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVSFTKEQLKGVSESVMEQFEKFVDPK 250

Query: 255 DGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLFLETLRLRDELAGLL 314
              EK+KV+FKYPDI PVLKTA+ P+TRK A+  DQNKVPQNE LF+ETL+LR++LA LL
Sbjct: 251 TNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVETLKLRNQLAQLL 310

Query: 315 GYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSLKEKDCKELAIPFDN 374
           GYSTYANYNLDIKMAK QETV  F+ +LK+KLKPLG KEIE LK+LK+KDC+EL + +D+
Sbjct: 311 GYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQKEIETLKTLKKKDCEELGLAYDD 370

Query: 375 HYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGMLKIYETVLKLKFVEETDAEKK 434
           HYYIWD+RYYDNK+LK+NYNVD E+ISEY+PLE TI GML IYET+LKLKFV+ET+ + K
Sbjct: 371 HYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTIKGMLGIYETLLKLKFVDETNPKIK 430

Query: 435 QVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAANFGIASSYV-RDGARSHP 493
            VWHEDVKQLAVWK+D  ++PEF+GWIYFDLHPRDGKY HAANFGI+SSY+ +DG RS P
Sbjct: 431 DVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSHAANFGISSSYITQDGDRSFP 490

Query: 494 VTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEA 553
           VTALVCNFSK + KKP+LLKH+EITTFFHELGHGIHDLVG N   RFNGPGATPWDFVEA
Sbjct: 491 VTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEA 550

Query: 554 PSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHVNGALFALRQLTFGLFDMT 613
           PSQMLEFWTWNKNEL +LS HY+TGEKI E LLDSLIATKHVNGALFALRQL FGLFDMT
Sbjct: 551 PSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMT 610

Query: 614 VHTCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMXXXXXXXXXXXMWAEVF 673
           VHT K++E L++  LWN+LR+++ LVENG+++TKG++SFGHIM           MWAEVF
Sbjct: 611 VHTTKNVEDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVF 670

Query: 674 AADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNLREFLGREPNNEAFLKELGL 731
           AADMY+TKFA+DPLN   GV+YRDIVL+ GGLYEI D L+EFLGREP N+AFLKELGL
Sbjct: 671 AADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKLKEFLGREPTNDAFLKELGL 728

>KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9
           YCL057W
          Length = 744

 Score = 1001 bits (2589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/686 (69%), Positives = 564/686 (82%), Gaps = 6/686 (0%)

Query: 52  MSATLVPPQAA-PSWKYSPEDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHEN 110
           MS  LVPP  A P W++    I +     I ST+  +D L  + NP++++LVKP++ HEN
Sbjct: 57  MSPQLVPPAGALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHEN 116

Query: 111 TTQPLINQLTFLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACK--- 167
           +   ++NQL FLQHVS+DKE+R+AS KATELLQ+FEIE SLRHDLF+QFDK+W+  K   
Sbjct: 117 SIGLMVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRK 176

Query: 168 DDAKFKKEHFELYKFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQK 227
           ++    +E FE+YKFVEKCHKD+VRAGLNL EE RN+VK+++ KI++NSL+FSKNLGEQK
Sbjct: 177 EEFSHDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQK 236

Query: 228 EFVAFTTEELDGVSASVMDQFEKFTD-TDGVEKHKVSFKYPDILPVLKTAKNPETRKRAF 286
           EF+ F+ E+LDGVS +VM+QFE+  D T     +KV+FKYPDI PVLK AKN ETRK AF
Sbjct: 237 EFLLFSKEQLDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAF 296

Query: 287 GGDQNKVPQNEVLFLETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKL 346
            GDQNKVPQNE LF+ TL+LRDELA LLGY TYANYNL+IKMAKKQ TV  FL DLK+KL
Sbjct: 297 CGDQNKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVFKFLNDLKDKL 356

Query: 347 KPLGVKEIEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPL 406
           KPLG KEI  LKS+KE +CKEL +PFD  YYIWD+RYYD KYLK+N+NVD E I+EY+P+
Sbjct: 357 KPLGEKEIGILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPI 416

Query: 407 EPTIGGMLKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLH 466
           + TI GMLKIYETV KLKFVEE D  KK VW+EDVKQ+AVWK+D  ++P FVGWIYFDLH
Sbjct: 417 DSTIEGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLH 476

Query: 467 PRDGKYGHAANFGIASSYVR-DGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELG 525
           PRDGKYGHAANFGIASSY+R DG+RS+PVTALVCNFSK SA KP+LLKH+EITTFFHELG
Sbjct: 477 PRDGKYGHAANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELG 536

Query: 526 HGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQL 585
           HGIHDLVG N   RFNGPGATPWDFVEAPSQMLEF+TW+KN L +LS+HY+TGE+IPE+L
Sbjct: 537 HGIHDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKL 596

Query: 586 LDSLIATKHVNGALFALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQV 645
           LDSLIATKHVNGALFALRQL FGLFDMTVHT KD+ SLD+  LW DLRQE+SLVENG Q 
Sbjct: 597 LDSLIATKHVNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQY 656

Query: 646 TKGFNSFGHIMXXXXXXXXXXXMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGL 705
           TKG++SFGHIM           MWAEVFA DMY TKFA +PL+  VG++YRDIVL+ GGL
Sbjct: 657 TKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGL 716

Query: 706 YEIDDNLREFLGREPNNEAFLKELGL 731
           YEIDDNL+EFLGREP+ +AFLKELGL
Sbjct: 717 YEIDDNLKEFLGREPSKDAFLKELGL 742

>TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {ON}
           Anc_1.9 YCL057W
          Length = 747

 Score =  972 bits (2513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/733 (64%), Positives = 573/733 (78%), Gaps = 20/733 (2%)

Query: 12  STTTSLLAIPALAFGAYSLLHSTNRTLRIPKSNYSTMSATMS-ATLVPPQAAPSWKYSPE 70
           S   SL+AIPA+A G Y   H  N+ LR     Y+     M+ A  + PQ +P W +SPE
Sbjct: 21  SILLSLVAIPAVAIGIY---HQNNQGLRF----YTASQVKMNEAAFIAPQLSPKWDFSPE 73

Query: 71  DILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPLINQLTFLQHVSADKE 130
            IL    + I +++  ++A+  +ENP++E+ V P +  EN     INQLTFLQHVS DK 
Sbjct: 74  RILSDAKKIIDTSNDFYNAMVAIENPSIENFVIPSINFENENSLAINQLTFLQHVSKDKL 133

Query: 131 VRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDDAKFKK------EHFELYKFVE 184
           +RDAS +ATEL+ +F+IE SLR+D+F QFDK++   KD+ K+        + +E++K+VE
Sbjct: 134 IRDASLEATELITNFDIEISLRYDMFKQFDKIFNDLKDNKKYNDLKTATPKDYEIFKYVE 193

Query: 185 KCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFTTEELDGVSASV 244
           KCHKDYVR+GLNL EEKRNE+KE++K+I+ NSLQFSKNLGEQ EFVAFT EEL+GVS  V
Sbjct: 194 KCHKDYVRSGLNLSEEKRNEIKEIKKRIALNSLQFSKNLGEQNEFVAFTKEELEGVSDDV 253

Query: 245 MDQFEKFTDTD-GVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLFLET 303
           M QFE +TD   G +K KV+FKYPDI PVLKTAKNP TRK AF  DQNKVP+NE LF++T
Sbjct: 254 MKQFETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDT 313

Query: 304 LRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSLKEK 363
           L+LR +L  +LGY TYANYNLDIKMAK QETV+ FL DLK+KLKPL  KEIE LK++K+ 
Sbjct: 314 LKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKT 373

Query: 364 DCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGMLKIYETVLKL 423
           + +EL + +D+HYYIWD+RYYDNKYLK+ +NVD EKISEY+P+E TI GMLKIYETV+ L
Sbjct: 374 EAQELNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVESTIQGMLKIYETVMNL 433

Query: 424 KFVEETDAEKKQVWH-EDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAANFGIAS 482
           KF+EETD + K  W  +DVKQLAVWK+D    PEFVGWIYFDLHPR+GKYGHAANFG+A 
Sbjct: 434 KFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMAP 493

Query: 483 SYV-RDGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLVGGNHIGRFN 541
           SY+ +D  R +PVTALVCNFS  +A KPALLKH+EITTFFHELGHGIHDLVG N IGRFN
Sbjct: 494 SYIDKDSKRIYPVTALVCNFSAATADKPALLKHNEITTFFHELGHGIHDLVGNNGIGRFN 553

Query: 542 GPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHVNGALFA 601
           GPGA PWDFVEAPSQMLEFWTWNKNEL +LS+HY+TGEKIPE LL+SLIATKHVNGALFA
Sbjct: 554 GPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLESLIATKHVNGALFA 613

Query: 602 LRQLTFGLFDMTVHTCKD---LESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMXX 658
           LRQL FGLFDM VHT  D   ++++D+  LWN LR+E+SLVENGD++ KG++SFGHIM  
Sbjct: 614 LRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSD 673

Query: 659 XXXXXXXXXMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNLREFLGR 718
                    MWAEVFA DMY++KFA DPLN   G+ YRDI+L+RGG+ E +DNL+EFLGR
Sbjct: 674 SYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIRETNDNLKEFLGR 733

Query: 719 EPNNEAFLKELGL 731
           EP+ EAFLKELGL
Sbjct: 734 EPSKEAFLKELGL 746

>KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9
           YCL057W
          Length = 723

 Score =  969 bits (2506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/723 (66%), Positives = 579/723 (80%), Gaps = 27/723 (3%)

Query: 16  SLLAIPALAFGAYSLLHSTNRTLRIPKSNYSTMSATMSATLVPPQAAPSWKYSPEDILQL 75
           SL+ IPA ++  Y+ L+S               + T+SA  + PQAAPSW ++P  +L  
Sbjct: 18  SLVCIPATSYLVYNRLYS---------------NMTISA-FIAPQAAPSWNWNPSRLLFD 61

Query: 76  TNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPLINQLTFLQHVSADKEVRDAS 135
               I +++ L+D L+ ++ PTVE+LV+P++ HEN   PLIN+L FLQHVS D ++R+AS
Sbjct: 62  AECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPKIREAS 121

Query: 136 TKATELLQDFEIEASLRHDLFVQFDKVWQAC---KDDAKFKKEH-FELYKFVEKCHKDYV 191
            KATELLQ FEIEASLRHDLF+QFDK+WQ     KDD  F KE+ FE +KF+EK HKDYV
Sbjct: 122 LKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDD--FVKEYDFETWKFIEKVHKDYV 179

Query: 192 RAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFTTEELDGVSASVMDQFEKF 251
           R+GLNLPE+KR ++KE++ KI NNSLQ+SKNLGEQKE +AFT EELDGVS +V +QFEKF
Sbjct: 180 RSGLNLPEDKREKIKEIKIKIGNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFEKF 239

Query: 252 TDTD-GVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLFLETLRLRDEL 310
            D + G EK KV+FKYPDI PVLKTAKNPETR++AF  DQNKVPQNE LF+ETL+LR+EL
Sbjct: 240 IDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNEL 299

Query: 311 AGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSLKEKDCKELAI 370
           A  L YSTYANYNL+ KMAK+QETVL FL DLK +LKPL +KEI  LK +K+K+CKEL  
Sbjct: 300 ATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKELNR 359

Query: 371 PFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGMLKIYETVLKLKFVEETD 430
            +D+HYYI+D+RYYDNKYLK+N+NVD E ISEY+PLE TI GMLKIYE + KLKF EET 
Sbjct: 360 EYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNEET- 418

Query: 431 AEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAANFGIASSYV--RDG 488
            + K VWHEDVKQLAVWK+D  E PEFVGWIYFDLHPRDGKYGHAANFGI+SSYV    G
Sbjct: 419 -KNKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDIETG 477

Query: 489 ARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLVGGNHIGRFNGPGATPW 548
            RS+PVTALVCNFSK +A +P+LLKH+EITTFFHELGHGIHDLVG N + RFNGPGATPW
Sbjct: 478 KRSYPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPW 537

Query: 549 DFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHVNGALFALRQLTFG 608
           DFVEAPSQMLEFWTWN NEL +LS HYE+ EKIP+ LL SLI TKHVNGALFALRQL FG
Sbjct: 538 DFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFG 597

Query: 609 LFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMXXXXXXXXXXXM 668
           LFDMTVHT  ++ESL++  LWN+LR+E+ LVE G +++KG++SFGHIM           M
Sbjct: 598 LFDMTVHTTNNVESLNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYM 657

Query: 669 WAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNLREFLGREPNNEAFLKE 728
           WAEVFAADMYHTKF+ +PL+ +VGV+YRDIVL+ GGLYEI DNLR+FLGREP+  AFLKE
Sbjct: 658 WAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAFLKE 717

Query: 729 LGL 731
           LGL
Sbjct: 718 LGL 720

>TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa]
           {ON} Anc_1.9 YCL057W
          Length = 741

 Score =  957 bits (2474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/685 (68%), Positives = 564/685 (82%), Gaps = 6/685 (0%)

Query: 54  ATLVPPQAAPSWKYSPEDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQ 113
             L  PQAAP+W ++P  +++   + I  ++  +DAL  +++P   + + P++ +EN   
Sbjct: 57  VNLNAPQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVG 116

Query: 114 PLINQLTFLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDDA-KF 172
            LINQLTFLQHVS++K++RDAS KAT+LLQ+FEIE SLR+ LF+QFDK+W   KD   K+
Sbjct: 117 SLINQLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKY 176

Query: 173 KKE--HFELYKFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFV 230
           +K+    E Y+FV K H+D+VRAGLNL E KR ++KE++K I+NNSL+F+ NLGEQ EFV
Sbjct: 177 EKDPKDLENYEFVRKVHRDFVRAGLNLDESKREKIKEIKKAIANNSLKFATNLGEQTEFV 236

Query: 231 AFTTEELDGVSASVMDQFEKFTD-TDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGD 289
           AFT EELDGVS SVM+QFEKF D   G E +KV+FKYPDI PVLKTA+NPETRK+AF GD
Sbjct: 237 AFTKEELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGD 296

Query: 290 QNKVPQNEVLFLETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPL 349
           QNKV +N VLF  TL+LR++LA +LGYSTYANYNL++KMAK Q++V  FLEDL ++LKPL
Sbjct: 297 QNKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPL 356

Query: 350 GVKEIEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPT 409
           G KEIE LKS+KEK+ KEL +PFDNHYY+WD+RYYDNKYLK+NYNVD EKISEY+PL+ T
Sbjct: 357 GSKEIEILKSIKEKEFKELNLPFDNHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPLDST 416

Query: 410 IGGMLKIYETVLKLKFVEETDAEK-KQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPR 468
           I GML IYET+L LKF+EE D  K K VWH++VKQLAVWK+D  E+PEFVGWIYFDLHPR
Sbjct: 417 IEGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPR 476

Query: 469 DGKYGHAANFGIASSYVR-DGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHG 527
           DGKYGHAANFGI+SSY++ +  RS+PVTALVCNFSK +A KPALLKH+EITTFFHELGHG
Sbjct: 477 DGKYGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHG 536

Query: 528 IHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLD 587
           IHDLVG N+  RFNGPGA PWDFVEAPSQMLEFWTWNKNEL +LS+HY+TGEKIP +LL+
Sbjct: 537 IHDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLN 596

Query: 588 SLIATKHVNGALFALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQVTK 647
           SL+ATKHVNGALFALRQL FGLFDM VHT KDLE+LD   LWN+LR+EVSLVENGD  TK
Sbjct: 597 SLVATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTK 656

Query: 648 GFNSFGHIMXXXXXXXXXXXMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYE 707
           G++SFGHIM           MWAEVFA DMY+TKFAA+PL   VGV YRD VL+RGGLYE
Sbjct: 657 GYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYE 716

Query: 708 IDDNLREFLGREPNNEAFLKELGLS 732
           I+DNL +FLGR+P+NEAFLKELGL+
Sbjct: 717 IEDNLIQFLGRKPSNEAFLKELGLN 741

>CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057w PRD1
           proteinase yscD
          Length = 743

 Score =  933 bits (2412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/726 (64%), Positives = 570/726 (78%), Gaps = 13/726 (1%)

Query: 13  TTTSLLAIPALAFGAYSLLHSTNRTLRIPKSNYSTMSATM---SATLVPPQAAPSWKYSP 69
           TT +L+A+P   F +Y  +H  N T      NYS ++ T      +L PPQ  PSW++ P
Sbjct: 23  TTFALIALPL--FVSYRGIH-LNNTYTSSIRNYSQLANTRFTNMPSLTPPQYPPSWEFKP 79

Query: 70  EDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPLINQLTFLQHVSADK 129
           EDIL  T E IA+T   +D L  ++NPT+E+L+ P++ HEN  + LINQLTFLQHVS DK
Sbjct: 80  EDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHENENELLINQLTFLQHVSEDK 139

Query: 130 EVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDDAKFKKEHFELYKFVEKCHKD 189
            +RDAS +AT LLQDFEIE+  R DLF QFD +W   KD  K + E FE+++FVEKCHKD
Sbjct: 140 TIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKD-KKDEFEDFEIWRFVEKCHKD 198

Query: 190 YVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFTTEELDGVSASVMDQFE 249
           YVRAGLNLP +K  +VKE++KKI++N L+FSKNLGEQKE++ FT EEL GV  SV++QFE
Sbjct: 199 YVRAGLNLPADKLEKVKEIKKKIADNCLKFSKNLGEQKEYILFTAEELKGVPESVIEQFE 258

Query: 250 KFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLFLETLRLRDE 309
           K  D  G++K KV++KYPDI PVLK A+NPETR +AF GDQNKVP+NE LF +TL+LR+E
Sbjct: 259 KVNDEFGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQNKVPENEHLFKDTLKLRNE 318

Query: 310 LAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSLKEKDCK-EL 368
           LA +LGY TYANYNLDIKMAK  +TVL+F+ DL  KL+    KE++ LK+LK+++ + E 
Sbjct: 319 LALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELDILKNLKKQEFENEF 378

Query: 369 AIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGMLKIYETVLKLKFVEE 428
            + +D  YYIWD+RYYDNKYLKEN+NVDEEKI+EY+PLE TI GMLKIYET+LKLKFVE 
Sbjct: 379 NMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLESTIDGMLKIYETLLKLKFVEV 438

Query: 429 TDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAANFGIASSYVR-D 487
              E K+ WH+DVKQLAVWK+D  E+PEFVGWI+FDLHPRDGKYGHAANFG++SSY+  +
Sbjct: 439 --KENKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAANFGLSSSYISAN 496

Query: 488 GARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLVGGNHIGRFNGPGATP 547
           G RS+P+TALVCNFSK +  KP+LLKHSEITTFFHELGHGIHDLVG N IGRFNGPGA P
Sbjct: 497 GTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHGIHDLVGNNRIGRFNGPGAVP 556

Query: 548 WDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHVNGALFALRQLTF 607
           WDFVEAPSQMLEFWTWN  EL +LSQ+Y+   KI  +LL+SLI TKHVNGALFALRQL F
Sbjct: 557 WDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKHVNGALFALRQLHF 616

Query: 608 GLFDMTVH--TCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMXXXXXXXXX 665
           GLFDM VH  + ++L+ LD+  LWNDLR+++ L+ NGDQ T G+NSFGHIM         
Sbjct: 617 GLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTTGYNSFGHIMSGSYSAGYY 676

Query: 666 XXMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNLREFLGREPNNEAF 725
             MWAEVFA DMY+TKF ADPLN +VGV+YRDIVL+RGGLYEIDDNL EFLGR+P  +AF
Sbjct: 677 GYMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGLYEIDDNLEEFLGRKPAKDAF 736

Query: 726 LKELGL 731
           L+ELGL
Sbjct: 737 LEELGL 742

>NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9
          Length = 740

 Score =  932 bits (2410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/679 (66%), Positives = 545/679 (80%), Gaps = 5/679 (0%)

Query: 56  LVPPQAAPSWKYSPEDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPL 115
           + P    P W ++P+ IL  T   I  T+  +++++ +E+P++E+L+ P++ +EN    L
Sbjct: 64  IAPANTVPDWTWTPKQILDETKSYIEKTNKYYNSISEIESPSIENLIIPYMNYENKMGLL 123

Query: 116 INQLTFLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDDAKFKKE 175
           INQLTFLQHVSADK++RDAS +AT LL+D +I  SLR +++ QF+KVW+  ++D  F K 
Sbjct: 124 INQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQNDDDFLKN 183

Query: 176 H-FELYKFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFTT 234
           H FE YKF+EK HKD +R GL    E+  ++K ++ KIS ++L FS NLGEQ E+V+FT 
Sbjct: 184 HQFETYKFIEKIHKDSLRNGLK--SERNYQLKYIKGKISADALTFSSNLGEQNEYVSFTK 241

Query: 235 EELDGVSASVMDQFEKFTDTDGVEK-HKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKV 293
           EELDGVS +VMDQFEKF D    EK +KV+FKYPDI PVLKTAKNP+TRK AF GDQNKV
Sbjct: 242 EELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQNKV 301

Query: 294 PQNEVLFLETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKE 353
           P+NE L    L+LR ELA  LGYSTYANYNLDIKMAK QETVL FL DLK KLKPL  KE
Sbjct: 302 PENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDLKEKLKPLAEKE 361

Query: 354 IEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGM 413
           I+ LK LK+K+C+EL IP+D HYYIWD+RYYDNKYLK+N+NVD EKISEY+PLE TI GM
Sbjct: 362 IKILKDLKKKECEELGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLESTIDGM 421

Query: 414 LKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYG 473
           LKIYETVL LKF+EETD   K VWH DVKQL+VW +D   +P FVGWIYFDL+PRDGKYG
Sbjct: 422 LKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKYG 481

Query: 474 HAANFGIASSYV-RDGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLV 532
           HAANFGIASSY+  +  RS+PVTALVCNFSKP+  KPALLKHSEITTFFHELGHGIHDLV
Sbjct: 482 HAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGIHDLV 541

Query: 533 GGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIAT 592
           G N   RFNGPG+ PWDFVEAPSQMLEFWTWNKNEL +LS+HY+TGEKIPE LLDSLI+T
Sbjct: 542 GQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLIST 601

Query: 593 KHVNGALFALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSF 652
           KHVNGALFALRQL FGLFDMTVHT KD+E+LD+  LWN+ R+E+ LVENG+  TKG+NSF
Sbjct: 602 KHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGENFTKGYNSF 661

Query: 653 GHIMXXXXXXXXXXXMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNL 712
           GHI+           MWAEVFAADMYHTKFA +PL+  VG++YRD++L++GGLYEI+DNL
Sbjct: 662 GHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEINDNL 721

Query: 713 REFLGREPNNEAFLKELGL 731
            EFLGREP+N+ FLKELGL
Sbjct: 722 LEFLGREPSNKPFLKELGL 740

>Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to
           Ashbya gossypii AGR406C/ AGR405C
          Length = 716

 Score =  886 bits (2289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/731 (58%), Positives = 553/731 (75%), Gaps = 20/731 (2%)

Query: 3   ILKRANKF-CSTTTSLLAIPALAFGAYSLLHSTNRTLRIPKSNYSTMSATMSATLVPPQA 61
            LKR N    S T S L +PALA      +H+  R +               ++L+ P+ 
Sbjct: 4   FLKRFNILKNSATVSFLLLPALAIAGNRSVHNQERNM---------------SSLLSPKL 48

Query: 62  APSWKYSPEDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPLINQLTF 121
           APSW ++ ++I+ L  + I   +  +D++A +E P +E+ V   ++HE+ T   ++QLTF
Sbjct: 49  APSWDFAADEIVSLAQKAIDEGTKFYDSVASLETPDLENFVVAVIDHEDETDGYMSQLTF 108

Query: 122 LQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDDAKFKKEHFELYK 181
           LQHVSADKEVRDAS +AT+L+Q++ IE S R+DL+ QF KVW+  KDD   KK   ELY 
Sbjct: 109 LQHVSADKEVRDASIEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDENLKKNDPELYW 168

Query: 182 FVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFTTEELDGVS 241
           ++E  +KDY+ AG+ LPEE RN++KE++KK++NNSL FS NLGEQ +++AFT +EL GVS
Sbjct: 169 YMENVNKDYIHAGMGLPEESRNKIKEIKKKLANNSLAFSNNLGEQNDYIAFTKDELVGVS 228

Query: 242 ASVMDQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLFL 301
            + + QFEK  + DGVEK+K++FKYPDI PVL TAKNPETRKRA+ GDQNKVPQNE + +
Sbjct: 229 ETTLGQFEKVIE-DGVEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQILI 287

Query: 302 ETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSLK 361
           ETL+LR+ELA + G+ TYA+Y L++KMAKKQETV  FL DLK+KL P G K++E LKSLK
Sbjct: 288 ETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYDLKDKLLPGGKKDLENLKSLK 347

Query: 362 EKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGMLKIYETVL 421
           E++ KEL +P++  +  WD RYYD+KYLKEN++VDEE++++YFPL+ TI GML IY+ + 
Sbjct: 348 EQEYKELGLPYNGSFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDGMLNIYQKLF 407

Query: 422 KLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAANFGIA 481
            LKFVEET    K VWHEDVKQ AVW +DK  +PEFVGWIYFDLHPR+GKYGHAANFG+ 
Sbjct: 408 NLKFVEETRECGKNVWHEDVKQFAVWDLDKC-NPEFVGWIYFDLHPREGKYGHAANFGLY 466

Query: 482 SSYV-RDGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLVGGNHIGRF 540
           S YV  +G R +PVT LVCNFSKPS+ +PALLKH E+ TFFHELGHGIH LVG + IG  
Sbjct: 467 SPYVTEEGTRHYPVTVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHL 526

Query: 541 NGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHVNGALF 600
           NGP + PWDFVEAPSQMLEFW WNK+++  LS+HYETGE+IP++L+DSLI TKHVN  L 
Sbjct: 527 NGPSSIPWDFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLS 586

Query: 601 ALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMXXXX 660
            LRQL F LFDMTVHT K+L+ LD+ SLWN+LR+EV+L+ NGD +TKG++SF HIM    
Sbjct: 587 NLRQLHFSLFDMTVHTDKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIM-SGY 645

Query: 661 XXXXXXXMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNLREFLGREP 720
                  MW+EVFAADMYHT FA +PL+  VG RYRDI+L++GGL +I+D+L EFLGREP
Sbjct: 646 SAGYYGYMWSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGREP 705

Query: 721 NNEAFLKELGL 731
           NN+AFLKELGL
Sbjct: 706 NNKAFLKELGL 716

>YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc
           metalloendopeptidase, found in the cytoplasm and
           intermembrane space of mitochondria; with Cym1p,
           involved in degradation of mitochondrial proteins and of
           presequence peptides cleaved from imported proteins
          Length = 712

 Score =  883 bits (2281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/685 (61%), Positives = 533/685 (77%), Gaps = 5/685 (0%)

Query: 50  ATMSATLVPPQAAPSWKYSPEDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHE 109
           A  ++  + PQA P+W ++P DI   TNE I +++  +D+++ VE+P+V + V+PF++ E
Sbjct: 28  ANTTSFPIAPQAPPNWSFTPSDISGKTNEIINNSNNFYDSMSKVESPSVSNFVEPFMKFE 87

Query: 110 NTTQPLINQLTFLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDD 169
           N   P+INQLTFLQHVS+DKE+RDAS  ++  L +  I+ SLRHD+F+QF +VWQ  +  
Sbjct: 88  NELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIFLQFARVWQDVQSK 147

Query: 170 AKFKKEHFELYKFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEF 229
           A   +   E +K+VEK +KDY+ +GL L E  R ++KE++KKIS NS+ FSKNLGEQKE+
Sbjct: 148 ADSVER--ETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLGEQKEY 205

Query: 230 VAFTTEELDGVSASVMDQFEKF-TDTDGVEK-HKVSFKYPDILPVLKTAKNPETRKRAFG 287
           + FT E+L+GV  S++ QFE   +D D  E  +KV+FKYPDI PV+K A + +TRK+AF 
Sbjct: 206 ITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKVTFKYPDIFPVMKLASSAQTRKQAFL 265

Query: 288 GDQNKVPQNEVLFLETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLK 347
            DQNKVP+NE + L+TL+LRDELA LLGY TYANYNL  KMA+   TV+ FL DLK+KL 
Sbjct: 266 ADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDKLI 325

Query: 348 PLGVKEIEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLE 407
           PLG KE++ L+ +K +D K+L    D +YYIWD+RYYDNKYL EN+NVD EKISEYFPLE
Sbjct: 326 PLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLE 385

Query: 408 PTIGGMLKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHP 467
            TI GML+IYET+  LKF+E  D++ K VWH+DVKQ+AVW +D  +SP FVGWIYFDLHP
Sbjct: 386 ATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNFVGWIYFDLHP 445

Query: 468 RDGKYGHAANFGIASSY-VRDGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGH 526
           RDGKYGHAANFG++SS+ + D  RS+PVTALVCNFSK +  KP+LLKH+EI TFFHELGH
Sbjct: 446 RDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGH 505

Query: 527 GIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLL 586
           GIHDLVG N   RFNGPG+ PWDFVEAPSQMLEFWTWNKNEL  LS HY+TGEKIPE L+
Sbjct: 506 GIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELINLSSHYKTGEKIPESLI 565

Query: 587 DSLIATKHVNGALFALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQVT 646
           +SLI TKHVNGALF LRQL FGLFDM VHTCKDL++L +   WN LRQ++SL+ NG  ++
Sbjct: 566 NSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICDTWNQLRQDISLISNGGTLS 625

Query: 647 KGFNSFGHIMXXXXXXXXXXXMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLY 706
           KG++SFGHIM           +WAEVFA DMYHTKFA DPLN   G++YRDIVL+RGGLY
Sbjct: 626 KGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNAKNGIQYRDIVLARGGLY 685

Query: 707 EIDDNLREFLGREPNNEAFLKELGL 731
           +I+DNL+EFLGREP+ +AFLKELGL
Sbjct: 686 DINDNLKEFLGREPSKDAFLKELGL 710

>Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W
           (REAL)
          Length = 712

 Score =  876 bits (2263), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/689 (61%), Positives = 525/689 (76%), Gaps = 6/689 (0%)

Query: 46  STMSATMSATLVPPQAAPSWKYSPEDILQLTNETIASTSALHDALAGVENPTVESLVKPF 105
           S+M+ T S     PQ  PSW ++P DI   T E I  ++  +D+++ VE+P V + V+PF
Sbjct: 25  SSMTTTASFP-TAPQTPPSWSFTPNDISGRTKEIIEKSNKFYDSMSQVESPAVTNFVEPF 83

Query: 106 LEHENTTQPLINQLTFLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQA 165
           ++ EN   P+INQLTFLQHVS+DKE+RDAS  ++  L +  I+ SLRHD+F+QF +VWQ 
Sbjct: 84  MKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDVFLQFARVWQD 143

Query: 166 CKDDAKFKKEHFELYKFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGE 225
            +  A   +   E ++++EK +KDY+ +GL L E  R +VKE++KKIS NS+ FSKNLGE
Sbjct: 144 AQSQADSIER--ETFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLGE 201

Query: 226 QKEFVAFTTEELDGVSASVMDQFEKF-TDTDGVEK-HKVSFKYPDILPVLKTAKNPETRK 283
           QKEF+ FT E+L+GV  S++ QFE   +  D  E  +KV+FKYPDI PV+K A + +TRK
Sbjct: 202 QKEFITFTKEQLEGVPDSILAQFETIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRK 261

Query: 284 RAFGGDQNKVPQNEVLFLETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLK 343
           +AF  DQNKV +NE + L+TL+LRDE+A LLGY TYANYNL  KMAK   TV+ FL DLK
Sbjct: 262 QAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLK 321

Query: 344 NKLKPLGVKEIEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEY 403
            KL PLG KE++ L+ +K KD K+     D +YYIWD+RYYDNKYL EN+NVD EKISE+
Sbjct: 322 KKLIPLGEKELQILQDMKAKDVKKRNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEF 381

Query: 404 FPLEPTIGGMLKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYF 463
           FPLE TI GML+IYET+  LKF+E  + ++K VWHEDVKQLAVW +D  +SP F+GWIYF
Sbjct: 382 FPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYF 441

Query: 464 DLHPRDGKYGHAANFGIASSY-VRDGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFH 522
           DLHPRDGKYGHAANFG++SS+ V D  RS+PVTALVCNFSK +  KP+LLKH+EI TFFH
Sbjct: 442 DLHPRDGKYGHAANFGLSSSFMVNDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFH 501

Query: 523 ELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIP 582
           ELGHGIHDLVG N   RFNGPG+ PWDFVEAPSQMLEFWTWNKNEL  LS HY+TGEKIP
Sbjct: 502 ELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYKTGEKIP 561

Query: 583 EQLLDSLIATKHVNGALFALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENG 642
           E L+DSLI TKHVNGALF LRQL FGLFDM VH+CKDL++L +   WN LRQ++SL+ NG
Sbjct: 562 EPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCKDLQNLSICDTWNQLRQDISLMSNG 621

Query: 643 DQVTKGFNSFGHIMXXXXXXXXXXXMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSR 702
             ++KG+ SFGHIM           +WAEVFA DMYHTKFA DPLN   G++YRDIVL+R
Sbjct: 622 GTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLAR 681

Query: 703 GGLYEIDDNLREFLGREPNNEAFLKELGL 731
           GGL +I+D+L+EFLGREP+ +AFLKELGL
Sbjct: 682 GGLRDINDSLKEFLGREPSKDAFLKELGL 710

>Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  872 bits (2254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/695 (61%), Positives = 533/695 (76%), Gaps = 11/695 (1%)

Query: 42  KSNYSTMSATMSATLVPPQAAPSWKYSPEDILQLTNETIASTSALHDALAGVENPTVESL 101
           +S YS  +AT  +  + PQA P+W ++P DI   T E I  ++  +++++ VE PTV + 
Sbjct: 22  RSLYSMSNAT--SFPIAPQAPPNWTFTPNDINGKTKEIIDKSNNFYESMSNVETPTVTNF 79

Query: 102 VKPFLEHENTTQPLINQLTFLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDK 161
           V+PF++ EN   P+INQLTFLQHVS+DKE+RDAS  ++  L +  I+ SLRHD+++QF +
Sbjct: 80  VEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIYLQFAR 139

Query: 162 VWQACKDDAKFKKEHFE--LYKFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQF 219
           VWQ    DA+ K +  E   +K++EK +KDY+ +GL L E  R ++K+++KKIS NS+ F
Sbjct: 140 VWQ----DAQSKSDSIERETFKYIEKSYKDYIHSGLELDESNRLKIKDIKKKISVNSINF 195

Query: 220 SKNLGEQKEFVAFTTEELDGVSASVMDQFEKF-TDTDGVEK-HKVSFKYPDILPVLKTAK 277
           SKNLGEQKE++ FT E+L+GV  SV+ QFE   +D D  E  +KV+FKYPDI PV+K A 
Sbjct: 196 SKNLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKVTFKYPDIFPVMKLAS 255

Query: 278 NPETRKRAFGGDQNKVPQNEVLFLETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLA 337
           + +TRK AF  DQNKVP+NE + L+TL LRD+LA LLGY TYANYNL  KMAK   TV+ 
Sbjct: 256 SAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTTVMD 315

Query: 338 FLEDLKNKLKPLGVKEIEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDE 397
           FL DLK+KL PLG KE+E L+ +K KD K+L    D +YYIWD+RYYDNKYL EN+NVD 
Sbjct: 316 FLNDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHRYYDNKYLLENFNVDL 375

Query: 398 EKISEYFPLEPTIGGMLKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEF 457
           EKISEYFPLE TI GML+IYET+  LKF+E  D + K VWH+DVKQLAVW +D  +SP+F
Sbjct: 376 EKISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKF 435

Query: 458 VGWIYFDLHPRDGKYGHAANFGIASSYV-RDGARSHPVTALVCNFSKPSAKKPALLKHSE 516
           VGWIYFDLHPRDGKYGHAANFG++SS++  D  RS+PVTALVCNFSK +  KP+LLKH+E
Sbjct: 436 VGWIYFDLHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALVCNFSKSTKDKPSLLKHNE 495

Query: 517 ITTFFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYE 576
           I TFFHELGHGIHDLVG N   RFNGPG+ PWDFVEAPSQMLEFWTWNKNEL  LS HYE
Sbjct: 496 IVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYE 555

Query: 577 TGEKIPEQLLDSLIATKHVNGALFALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEV 636
           TGEKIPE L+DSLI TKHVNGALF LRQL FGLFDM VHTCKDL++L +   WN LRQ++
Sbjct: 556 TGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICETWNQLRQDI 615

Query: 637 SLVENGDQVTKGFNSFGHIMXXXXXXXXXXXMWAEVFAADMYHTKFAADPLNGDVGVRYR 696
           SL+ NG  ++KG++SFGHIM           +WAEVFA DMYHTKFA DPLN   G++YR
Sbjct: 616 SLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYR 675

Query: 697 DIVLSRGGLYEIDDNLREFLGREPNNEAFLKELGL 731
           DIVL+RGGL +I D+L++FLGREP+ +AFLKELGL
Sbjct: 676 DIVLARGGLNDIGDDLKKFLGREPSKDAFLKELGL 710

>Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  869 bits (2245), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/690 (61%), Positives = 529/690 (76%), Gaps = 9/690 (1%)

Query: 48  MSATMSATLVP--PQAAPSWKYSPEDILQLTNETIASTSALHDALAGVENPTVESLVKPF 105
           +SA  +A   P  PQA P+W ++P DI   T E I  ++  ++ ++ VE+P+V + ++PF
Sbjct: 24  LSAMTNAASFPIAPQAPPTWSFTPTDIGGKTTEIIDKSNKFYELMSQVESPSVTNFIEPF 83

Query: 106 LEHENTTQPLINQLTFLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQA 165
           ++ EN   P+IN+LTFLQHVS+DKE+RDAS  ++  L +  I+ SLRHD+F+QF +VWQ 
Sbjct: 84  MKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDIFLQFARVWQD 143

Query: 166 CKDDA-KFKKEHFELYKFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLG 224
            +  A   KKE F   K++EK +KD++ +GL L E  R ++KE++KKIS NS+ FSKNLG
Sbjct: 144 AQPKADSLKKETF---KYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSINFSKNLG 200

Query: 225 EQKEFVAFTTEELDGVSASVMDQFEKFTDTDGVEK--HKVSFKYPDILPVLKTAKNPETR 282
           EQKE++ FT E+L+GV  S++ QFE      G E   +KV+FKYPDI PV+K A + +TR
Sbjct: 201 EQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIFPVMKLASSAQTR 260

Query: 283 KRAFGGDQNKVPQNEVLFLETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDL 342
           K+AF  DQNKVP+NE + L+TL+LRDELA LLGY+TYA+YNL  KMAK   TV+ FL DL
Sbjct: 261 KQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAKDSRTVMDFLNDL 320

Query: 343 KNKLKPLGVKEIEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISE 402
           K KL PLG KE++ L+ +K KD +      D +YYIWD+RYYDNK+L EN+NVD EKISE
Sbjct: 321 KGKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHRYYDNKHLLENFNVDLEKISE 380

Query: 403 YFPLEPTIGGMLKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIY 462
           YFPLE TI GML+IYET+  LKF+E  + + K VWHEDVKQLAVW +D  +SP F+GWIY
Sbjct: 381 YFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIY 440

Query: 463 FDLHPRDGKYGHAANFGIASSY-VRDGARSHPVTALVCNFSKPSAKKPALLKHSEITTFF 521
           FDLHPRDGKYGHAANFG++SS+ + D  RS+PVTALVCNFSK +  KP+LLKH+EI TFF
Sbjct: 441 FDLHPRDGKYGHAANFGLSSSFMINDSKRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFF 500

Query: 522 HELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKI 581
           HELGHGIHDLVG N   RFNGPG+ PWDFVEAPSQMLEFWTWNKNEL +LS HY+TGE+I
Sbjct: 501 HELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERI 560

Query: 582 PEQLLDSLIATKHVNGALFALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVEN 641
           PE L+DSLI TKHVNGALF LRQL FGLFDM VHTCKDLE+L +   WN LRQE+SL+ N
Sbjct: 561 PESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLENLSICHTWNQLRQEISLMPN 620

Query: 642 GDQVTKGFNSFGHIMXXXXXXXXXXXMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLS 701
           G  ++KG++SFGHIM           +WAEVFA DMYHTKFA DPLN   GV+YRDIVL+
Sbjct: 621 GGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLA 680

Query: 702 RGGLYEIDDNLREFLGREPNNEAFLKELGL 731
           RGGLY+I+DNL+EFLGREP+ +AFLKELGL
Sbjct: 681 RGGLYDINDNLKEFLGREPSKDAFLKELGL 710

>AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 683

 Score =  759 bits (1960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/679 (54%), Positives = 486/679 (71%), Gaps = 4/679 (0%)

Query: 54  ATLVPPQAAPSWKYSPEDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQ 113
           A+LVPPQAAPSW +S +D++ L+++ I  T A++  +   + PT+++ + P + HE  T 
Sbjct: 5   ASLVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEETD 64

Query: 114 PLINQLTFLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDDAKFK 173
            L NQL FL++VS D E+R+AS  AT +L D+ I  + ++DL+  FD+VW   KDD KFK
Sbjct: 65  LLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYKDDEKFK 124

Query: 174 KEHFELYKFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFT 233
           KE+FELY+++EK    Y R+G+ +P E R  + E++ KI+   L+FS NLGE+ E++AFT
Sbjct: 125 KENFELYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYIAFT 184

Query: 234 TEELDGVSASVMDQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKV 293
            EEL+GV  +V++QFEK  +  GVEK KV+FKYPDI PVL+ A NPETR+RA   D+N+V
Sbjct: 185 KEELEGVPDTVLNQFEKIIEG-GVEKFKVTFKYPDIGPVLRLASNPETRRRASMADENRV 243

Query: 294 PQNEVLFLETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKE 353
             NE L  ETL LR ELA LLG+  +A YNLD KMAK +ETVL FL DL  KL P+G  +
Sbjct: 244 AANEPLLFETLELRRELADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKND 303

Query: 354 IEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGM 413
           +E LK  K +D K   + FD  +Y WD  YY NK L+E YNV+ + +++YFP+E  I GM
Sbjct: 304 LEILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAIEGM 363

Query: 414 LKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYG 473
           L IY T+ +LKFVE TD  +K VWHEDVKQ AVW +D  ++P+F GW+YFDLHPRDGKYG
Sbjct: 364 LNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYG 423

Query: 474 HAANFGIASSYV-RDGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLV 532
           HAANFG+ S+Y  RDG++S+PVT LV NFSKP+  +PALLK  E+TTFFHELGHGIHDLV
Sbjct: 424 HAANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIHDLV 483

Query: 533 GGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIAT 592
           G N +   NGPG+ PWDFVEAPSQMLE+WT  ++ L+ LS+HYETGEKIP+ LLD+  + 
Sbjct: 484 GSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWFSV 543

Query: 593 KHVNGALFALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSF 652
             +N  L  L QL  GLFDM VHT +D +  +V  LWNDL +E+ L+   +  + G++SF
Sbjct: 544 GGLNSGLANLGQLKLGLFDMYVHT-RDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYDSF 602

Query: 653 GHIMXXXXXXXXXXXMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNL 712
           GHIM           +W++VFAADMY TKF  +P N  VGV YRD +L+ GGLY++ DNL
Sbjct: 603 GHIM-AGYAAGYYGYLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDNL 661

Query: 713 REFLGREPNNEAFLKELGL 731
           R+FLGR+PNN+AFL+ LGL
Sbjct: 662 RKFLGRDPNNKAFLRGLGL 680

>AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 717

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/680 (49%), Positives = 467/680 (68%), Gaps = 4/680 (0%)

Query: 55  TLVPPQAAPSWKYSPEDILQLTNETIASTSALHDALAGVENP-TVESLVKPFLEHENTTQ 113
           +LVPPQ  P W Y+  +++ L       + A+++++   ++  T+++ + P L ++  T 
Sbjct: 11  SLVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETD 70

Query: 114 PLINQLTFLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDDAKFK 173
            L NQL FL++VS D +VR+AS    ++L  +    S ++DL+  F+ +W   KDD +FK
Sbjct: 71  LLWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEFK 130

Query: 174 KEHFELYKFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFT 233
             ++ELYK++EK    Y R   NL   +  E+ ++ +KIS ++LQFS NLGE+ E++ FT
Sbjct: 131 VTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGEETEYITFT 190

Query: 234 TEELDGVSASVMDQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKV 293
            EEL+GVS  V+DQFE+  +  GV+K KV+FKYPDI PVL+TA NPETR++A+  DQN+V
Sbjct: 191 EEELEGVSPLVLDQFERIIE-GGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVADQNRV 249

Query: 294 PQNEVLFLETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKE 353
             NE L  ETL LR  +A L GY  YA YNL  KMAK +ETV+ FL DL  +L P+G K+
Sbjct: 250 AANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKD 309

Query: 354 IEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGM 413
            E LKS K +D K   + FD   Y WDN YY+NK L+E Y +D E +++YFP+E  I GM
Sbjct: 310 REILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIEGM 369

Query: 414 LKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYG 473
           L  Y+T+ +LKFVE TD  +K VWHEDVKQ AVW +D  + PEF GWIYFDL+PRDGKY 
Sbjct: 370 LDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGKYS 429

Query: 474 HAANFGIASSYV-RDGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLV 532
           HAANFG+AS++  +DG++S+PVT LVCN +KP+  + A+L+  EITT FHELGHGIH LV
Sbjct: 430 HAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHHLV 489

Query: 533 GGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIAT 592
             N +   N  G+ PWDFVEAPSQMLE+WT  ++ L+ LS+HYETGEKIP  LLD+   +
Sbjct: 490 ANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFNS 549

Query: 593 KHVNGALFALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSF 652
             +   L+ L QL  GLFDM VHT ++   L+V  LWND+R+E+SL+ + +  + G+N+F
Sbjct: 550 SGLGSGLYYLGQLRLGLFDMYVHT-REYHGLEVRKLWNDMRREISLINSQNYTSTGYNTF 608

Query: 653 GHIMXXXXXXXXXXXMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNL 712
           GHIM           +W++VFAADMY TKF ++P N  VG +YRD +L+ GGLY+++DNL
Sbjct: 609 GHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMNDNL 668

Query: 713 REFLGREPNNEAFLKELGLS 732
           R+FLGREPNN AFL+ LG +
Sbjct: 669 RKFLGREPNNRAFLRGLGFN 688

>ABR185W Chr2
           (758126..758380,758380..758709,758709..759029,
           759033..759122,759122..759499) [1374 bp, 457 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); 3-intron; artificial frameshift
          Length = 457

 Score =  392 bits (1006), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 203/431 (47%), Positives = 282/431 (65%), Gaps = 9/431 (2%)

Query: 305 RLRDELAGL-LGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSLKEK 363
           R+  ELA + L     A Y L++K AK  + V +FL DL+ KLKP        LK LKE+
Sbjct: 33  RMFAELANVKLPTVETAAYVLEVKTAKNVDNVNSFLNDLREKLKPASADNWRPLKKLKEQ 92

Query: 364 DCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGMLKIYETVLKL 423
           +CKEL   +D   Y  D  YY+ K L++N++VDEE+ ++YFPLE TI  ML  Y T+ + 
Sbjct: 93  ECKELGNFYDGELYSQDLCYYEQKLLRDNFSVDEEETAQYFPLEHTIKFMLDTYNTLFRH 152

Query: 424 KFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAANF-GIAS 482
            FVEET+   + VWHED KQ +VWK+D  ++P+F GW+YFDLHPRDGK+GH A F  + +
Sbjct: 153 NFVEETEPATRNVWHEDDKQYSVWKMDDWDAPQFTGWLYFDLHPRDGKFGHLACFDNVYT 212

Query: 483 SYVRDGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLVGGNHIGRFNG 542
               +G+R +PVT+LVCNFS PS +KPALLKH E+  FFHELGHG H L+    +     
Sbjct: 213 DMSEEGSRVYPVTSLVCNFSNPSKEKPALLKHYEVQAFFHELGHGSHKLLCAPELC--CS 270

Query: 543 PGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHVNGALFAL 602
               P DF+EAPSQMLE+W W K+ ++ LS+H ETGE+IPE L+D ++ +K  N A+  L
Sbjct: 271 SSWVPRDFIEAPSQMLEYWIWRKDVITDLSKH-ETGERIPESLVDCMVKSKRANAAIDNL 329

Query: 603 RQLTFGLFDMTVHT-CKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMXXXXX 661
            Q+   L DM VH      E+LD+ +LWN+L ++V L++N +  T+ + SF HI+     
Sbjct: 330 IQV-LALLDMAVHKHVGSYETLDLNALWNNLCEDVILIKNPEP-TRAYCSFSHIV-EGYA 386

Query: 662 XXXXXXMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNLREFLGREPN 721
                  W++VFAADMY ++F    L+  +G  Y D +++RGGLYE++DNL EFL REPN
Sbjct: 387 AGYYGYQWSKVFAADMYFSRFEKAHLDPTLGKLYGDTIIARGGLYEMEDNLGEFLDREPN 446

Query: 722 NEAFLKELGLS 732
           NEA+L++ GL+
Sbjct: 447 NEAYLRDQGLA 457

 Score = 35.0 bits (79), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 54  ATLVPPQAAPSWKYSPEDILQLTNETIASTSALHDALAGVENPTVES 100
           +T+  PQ APSW  SP  I       + S + +   LA V+ PTVE+
Sbjct: 2   STVKIPQPAPSWDLSPAQINDKVQTALESAARMFAELANVKLPTVET 48

>CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {ON}
           similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134c MIP1
          Length = 761

 Score =  190 bits (483), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 170/632 (26%), Positives = 284/632 (44%), Gaps = 57/632 (9%)

Query: 110 NTTQPLINQLTFLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDD 169
           +T   +I+   FL+    D+   +A+    E +  FE    L  D+ V  +K+ +  +D 
Sbjct: 118 DTLCRVIDLCEFLRSAHPDQSYVEAAQMCHEEM--FEFMNVLNTDV-VLCNKLKEVLEDP 174

Query: 170 AKFKKEHFELYKFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGE-QKE 228
              K    E  K  E    D+ ++G+ +    R +  EL ++IS    +F  N     KE
Sbjct: 175 EILKVLSEEERKVGEILLDDFEKSGIYMKAGIREQFIELSQQISVIGQEFINNTDYVAKE 234

Query: 229 FVAFTTEELD--GVSASVMDQFEKFTDTDGVEKHKVSFKYPDI-LPVLKTAKNPETRKRA 285
           F+    +E+D  G+S  +  +  +    D   K+     Y  I L +LK+  + + RK  
Sbjct: 235 FIKVKRDEMDKSGISPLLTARLNR----DLTGKYYKIPTYGQIPLQILKSCPDEDIRKEV 290

Query: 286 FGGDQNKVPQNEVLFLETL-RLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKN 344
           +    N  P+ ++  L  L RLR  L+ LLG  +Y++Y LD KMA   E V  F++ L N
Sbjct: 291 WAALHN-CPKAQIQRLNQLVRLRVILSNLLGKQSYSDYQLDNKMAGSPENVKGFIKTLMN 349

Query: 345 KLKPLGVKEIE--ALKSLKEKDCKELAIPFDNHYYI----WDNRYYDNKYLKEN--YNVD 396
             KPL  +E+E  A   L   D + ++   DN        WD  Y+ +KY  +N    + 
Sbjct: 350 VTKPLAARELEFIARDKLNAPDSRHMS---DNEILSIVKPWDKNYFSSKYDSDNEMAMIR 406

Query: 397 EEKISEYFPLEPTIGGMLKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPE 456
           +E++  YF L   I G+ ++++ +  +  ++ +  E  + W  DV++L V     +E   
Sbjct: 407 DEQLRYYFSLGNVINGLSELFKRIYGIT-LQPSRTENGETWSPDVRRLDVI----SEEEG 461

Query: 457 FVGWIYFDLHPRDGKYGHAANFGIASSY-----------VRDGARSH------PVTALVC 499
            VG IY DL  R GK  + A+F +  S            ++ G  S       PV +LVC
Sbjct: 462 LVGVIYCDLFERVGKISNPAHFTVCCSRQVYPDENDFTTIQTGQNSDGTVFQLPVISLVC 521

Query: 500 NFSK---PSAKKPALLKHSEITTFFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQ 556
           NFS    P+  +   L  +EI T FHE+GH +H ++G   +   +G      DFVE PS 
Sbjct: 522 NFSTVALPNGNRTCFLHMNEIETLFHEMGHAMHSMLGRTRLQNISGTRCAT-DFVELPSI 580

Query: 557 MLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHVNGALFALRQLTFGLFDMTVH- 615
           ++E +  +   L T+  HYET E  PE LL+  +             Q    + D  +H 
Sbjct: 581 LMEHFARDIRVLRTIGSHYETSEPAPEALLNDYLDKTQFLQHCETYSQAKMAMLDQKLHG 640

Query: 616 --TCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMXXXXXXXXXXXMWAEVF 673
             +  D+E +D   ++  L   + ++   D  +     FGH+            ++    
Sbjct: 641 SFSLSDIERIDSAKIYQKLETRLQVL--ADDESNWCGRFGHLF--GYGATYYSYLFDRAI 696

Query: 674 AADMYHTKFAADPLNGDVGVRYRDIVLSRGGL 705
           A+ ++ + F  DP N   G ++++ VL  GGL
Sbjct: 697 ASKVWDSLFKDDPFNRTGGEKFKERVLKWGGL 728

>KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {ON}
           Anc_2.432 YKL134C
          Length = 789

 Score =  180 bits (456), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 169/681 (24%), Positives = 308/681 (45%), Gaps = 64/681 (9%)

Query: 65  WKYSPEDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPLINQLTFLQH 124
           + +SP+ + Q T  +++  ++L + L   + P  + L+K  +  +  +  L   +   + 
Sbjct: 100 YLHSPKGLKQFTKRSLSIANSLVETLRTDKTP--DGLLKFIVRLDQLSDTLCRVIDLCEF 157

Query: 125 VSADKEVRDASTKATELLQD-FEIEASLRHD--LFVQFDKVWQACKDDAKFKKEHFELYK 181
           + +        + A E  ++ FE    L  D  L     +V    +  +K  +E  ++ K
Sbjct: 158 IRSAHPSEAYISVAQECHEEMFEFMNILNTDVNLCNTLKQVLSTKEIVSKLTQEELKVGK 217

Query: 182 FVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLG-EQKEFVAFTTEELD-- 238
            +    +D+ ++G+ +  + R+   E+ + IS     F  N    + EF+   +EELD  
Sbjct: 218 IL---LEDFEKSGIYMSTDTRDRFIEMSQDISLVGQDFINNTNWLRSEFIEIASEELDNS 274

Query: 239 GVSASVMDQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEV 298
           GVS  ++ Q    T T     +KV         +L++ KN   RK  +    +  P  ++
Sbjct: 275 GVSPILLRQL---TTTVRGTHYKVPAYGTAPYIILRSCKNENARKAVWTA-LHSCPDKQI 330

Query: 299 LFL-ETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEAL 357
             L   +++R  L+ ++G   +A Y L  KMAK  E VL F+  L    KP+  +E++ L
Sbjct: 331 NRLTHMVKMRSVLSNIMGKVGFAVYQLQGKMAKSPENVLNFITRLMEHTKPMAAEELKLL 390

Query: 358 KSLK-----------EKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPL 406
            ++K           EK+  E   P+D  YY+  ++        +N   + E I+ YF L
Sbjct: 391 ANMKLNDLGLPEANSEKEILETVRPWDRDYYVAKSQQTRKA---KNQLTNHEPINAYFTL 447

Query: 407 EPTIGGMLKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLH 466
              + G+  +++++  +  +E   +   + W  +V+++ V    K E+   +G +Y DL 
Sbjct: 448 GSVLEGLSNLFKSIYGIS-LEVVASIPGETWSSEVRRVNV----KTENNNIIGVVYCDLF 502

Query: 467 PRDGKYGHAANFGIASS-----------YVRDGARSH------PVTALVCNFSKPSAKKP 509
            R  K    A+F +  S            ++ G  S       P+ +LVCNF++ S  + 
Sbjct: 503 ERKAKTSSPAHFTVCCSRELYAEENDPSILQSGVNSRGEKFQLPIISLVCNFARTSDNEL 562

Query: 510 ALLKHSEITTFFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELS 569
            LL+ SEI T FHE+GH +H ++G   +   +G   T  DFVE PS ++E +  +   L 
Sbjct: 563 CLLQLSEIETLFHEMGHAMHSMLGQTKLQNISGTRCTT-DFVELPSIIMEHFARDPRVLK 621

Query: 570 TLSQHYETGEKIPEQLL-DSLIATKHV-NGALFALRQLTFGLFDMTVHTCK---DLESLD 624
            + +HY T EK+PE LL + L +T+++ N   FA  Q    + D  ++       +  LD
Sbjct: 622 GIGRHYITKEKVPEDLLAEELNSTRYLQNCETFA--QAKMAMLDQRLYDNNIIFHVRDLD 679

Query: 625 VTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMXXXXXXXXXXXMWAEVFAADMYHTKFAA 684
           V  L++DL + + ++   D  T     FGH+            +     AA ++   F  
Sbjct: 680 VVELYHDLERNLEVLV--DDQTNWCGKFGHLF--GYGATYYSYLLDRAIAAKIWDCLFVN 735

Query: 685 DPLNGDVGVRYRDIVLSRGGL 705
           DP +   G  +++ VL  GGL
Sbjct: 736 DPFSRTGGENFKNAVLKWGGL 756

>SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 767

 Score =  177 bits (449), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 141/552 (25%), Positives = 259/552 (46%), Gaps = 51/552 (9%)

Query: 188 KDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGE-QKEFVAFTTEELD--GVSASV 244
           +D+ ++G+++  E R +   L ++IS     F  N    +  ++    EEL+  G++  V
Sbjct: 198 EDFEKSGIHMNPEVREQFIALSQQISVVGQDFINNTEYVRSNYIKVEVEELNKSGINKIV 257

Query: 245 MDQFEKFTDTDGVEKHKVSFKYPDILP--VLKTAKNPETRKRAFGGDQNKVPQNEVLFLE 302
           ++Q  K  D  G      +F Y   +P  +L++  +   R + +    +   +      +
Sbjct: 258 LNQLSK--DIKGRHYKIPTFGY---IPYSILRSCPDDNIRMKVWSALHSCSEKQIARLDQ 312

Query: 303 TLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSLKE 362
            ++LR  LA ++G  ++A+Y L+ KMAK  E V  F++ L +  KP   +E++ +  LK 
Sbjct: 313 LIKLRSVLANIMGKKSFAHYQLEGKMAKTPEYVRGFMQSLIDATKPKAAEELKFIADLKA 372

Query: 363 KDCKELAIPFDNHYYI------WDNRYYDNKY-LKENYNVDEEKISEYFPLEPTIGGMLK 415
           K       P ++ + I      WD  +Y + + L++    + E+IS YF L   I G+  
Sbjct: 373 KHVPGNK-PAESMHEILEMVKPWDRDFYGSVHALQQRRPFNNEQISSYFSLGVVIQGLSN 431

Query: 416 IYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHA 475
           +++ +  + ++E    +  + W  +V+++ V     +E    +G +Y DL  R GK  + 
Sbjct: 432 LFKQIYGI-YLEPVVPKTGETWSPEVRRINVV----SEKEGVIGVVYCDLFERQGKTANP 486

Query: 476 ANFGIASSY-----------VRDGARSH------PVTALVCNFSKPSAKKP---ALLKHS 515
           A+F +  S            ++ G  S       PV +LVCNFS  +  +     LL+ S
Sbjct: 487 AHFTVCCSRQIYDGETDLSTIQVGQNSKGEQFQLPVISLVCNFSPTTISQEQSICLLQLS 546

Query: 516 EITTFFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHY 575
           EI T FHE+GH +H ++G   +   +G      DFVE PS ++E +  +   L  ++ HY
Sbjct: 547 EIETLFHEMGHAMHSMLGRTKLQNISGTRCAT-DFVELPSILMEHFARDHRVLQRMASHY 605

Query: 576 ETGEKIPEQLLDSLIATKHVNGALFALRQLTFGLFDMTVH---TCKDLESLDVTSLWNDL 632
            TGE IPEQLL S  +         A  Q    + D  +H     K+++ LD+  L+++L
Sbjct: 606 STGESIPEQLLFSYQSEVKFLQHAEAFSQAKMAILDQELHGESIMKEMQYLDIVKLYHNL 665

Query: 633 RQEVSLVENGDQVTKGFNSFGHIMXXXXXXXXXXXMWAEVFAADMYHTKFAADPLNGDVG 692
            +++ ++   D  +     FGH+            ++    A+ ++   FA DP     G
Sbjct: 666 ERQLEVL--SDDKSNWCGRFGHLF--GYGATYYSYLFDRAIASKIWQHLFANDPFCRRSG 721

Query: 693 VRYRDIVLSRGG 704
            ++++ VL  GG
Sbjct: 722 EKFKNSVLKWGG 733

>NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {ON}
           Anc_1.9 YCL057W
          Length = 778

 Score =  177 bits (448), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 147/557 (26%), Positives = 256/557 (45%), Gaps = 55/557 (9%)

Query: 188 KDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGE-QKEFVAFTTEELD--GVSASV 244
           +D++++G+ +   K+++   L + IS    ++  N+ +  +  +     ELD  G+   V
Sbjct: 209 QDFIKSGIYMDSGKKDQFITLSQDISVIGQEYINNINQLARNHIKVKRSELDNAGIEFDV 268

Query: 245 MDQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLFLETL 304
             Q  K  D  G      ++ +   L +LK   +PE RK+ +    +   Q        +
Sbjct: 269 ACQLGK--DITGKYYKIPTYGHLPFL-ILKACTDPEIRKKIWVAMHDCSKQQIERLTNLV 325

Query: 305 RLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSL--KE 362
           ++R  LA  +G   YA Y +D KMAK  + V  FL+ L + LKP   KE++ +  L   E
Sbjct: 326 KIRAFLAHTMGRECYAAYAIDGKMAKNPKDVDEFLKSLMDFLKPKAAKELKFISDLIHNE 385

Query: 363 K------DCKELAI---PFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGM 413
           K      D  E+     P+D  YY   +R      L ++Y +D      Y+PL   I G+
Sbjct: 386 KGEKPSDDVDEILTAVRPWDREYYTAIHRNKQKHLLLDDYALD-----VYYPLGNVIQGL 440

Query: 414 LKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYG 473
             I+E++  ++F E   A K + W  DV++L V     +E    +G IY DL  R GK  
Sbjct: 441 SDIFESIYGIRF-EPAVAGKGETWSSDVRRLNV----VSEKEGLIGIIYCDLFRRQGKTN 495

Query: 474 HAANFGIASSYV----------------RDGARSH-PVTALVCNFSKP---SAKKPALLK 513
           +AA+F I  S                   DG +   P+ +L+CNF+     S +   LL 
Sbjct: 496 NAAHFTICCSRQIYPHEDDFSTIQLGTNVDGTKFQLPIISLLCNFNTRCLNSGETICLLA 555

Query: 514 HSEITTFFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQ 573
            +EI T FHE+GH IH ++G   +   +G   +  DFVE PS ++E +  +   L  +  
Sbjct: 556 LNEIETLFHEMGHAIHSMLGRTRLQNVSGTRCST-DFVELPSVLMEHFARDTRVLKRIGH 614

Query: 574 HYETGEKIPEQLLDSLIATKHVNGALFALRQLTFGLFDMTVH---TCKDLESLDVTSLWN 630
           HY+TG+++P  LL+  +             Q    + D  ++     ++++S+DV  +++
Sbjct: 615 HYKTGDRVPATLLNRYLEKARFLKDCETFSQAKMAMLDQRLYDKNIVQNIDSVDVVKIYH 674

Query: 631 DLRQEVSLVENGDQVTKGFNSFGHIMXXXXXXXXXXXMWAEVFAADMYHTKFAADPLNGD 690
           +L +E+ ++   D  +     FGH+            ++    A+ ++   F  DP +  
Sbjct: 675 ELEKELEVLV--DDESNWCAKFGHLF--GYGATYYCYLFDRAIASKVWKKLFEKDPYSRS 730

Query: 691 VGVRYRDIVLSRGGLYE 707
            G ++++ VL  GGL E
Sbjct: 731 GGEKFKNDVLKWGGLRE 747

>KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {ON}
           Anc_2.432 YKL134C
          Length = 777

 Score =  177 bits (448), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 171/675 (25%), Positives = 301/675 (44%), Gaps = 58/675 (8%)

Query: 68  SPEDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPL---INQLTFLQH 124
           +PE +L  +  ++   + L   +    + T + L+K  +  +  +  L   I+   F++ 
Sbjct: 89  TPEGLLTFSKASLWKANELVKIMKN--DNTKQGLLKYIVRLDQLSDTLCRVIDLCEFIRS 146

Query: 125 VSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDDAKFKKEHFELYKFVE 184
           V  DKE   A+ +  E +  FE   +L  D+ +  DK+     D+    K   E  K   
Sbjct: 147 VHPDKEFLSAAQQCHEEM--FEFMNTLNTDVEL-CDKLKTLLHDNEILSKLSEEEIKVGR 203

Query: 185 KCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQK-EFVAFTTEELD--GVS 241
              +D+ ++G+ +    R +  EL ++IS     F  N  + K  ++     +L+  G++
Sbjct: 204 ILLEDFEKSGIYMNPRIREQFIELSQEISLIGQDFINNANQPKTNYIKVNASKLESAGLN 263

Query: 242 ASVMDQFEKFTDTDGV-EKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLF 300
             +++  +K    D + E +K+    P    VLK  KN E R   +    +   +  +  
Sbjct: 264 RLLLNSLKK----DAIRENYKIPTYGPTPYAVLKDCKNEEVRADIWTALHSCSSEQILRL 319

Query: 301 LETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSL 360
              ++LR  LA L+G  +++ Y L  K+AK  + V  F+E L   ++P   KE++ +  L
Sbjct: 320 SHLVKLRAMLANLMGAESFSQYQLKGKLAKAPKDVKNFIETLIKYVRPNTEKELKFIADL 379

Query: 361 KEKD-----CKELAIPFDNHYYIWDNRYYDNKYLKENYNVDE---EKISEYFPLEPTIGG 412
           K +D     C E+          WD  YY + Y K     +    E +S YF L     G
Sbjct: 380 KREDQGKINCGEMDGVLST-VRPWDRDYYSSIYFKGKEKTEHEFTEPLSSYFTLGGVFEG 438

Query: 413 MLKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKY 472
           +  +   +  +K +E       + W  DV+++ V     +E    +G IYFDL  R GK 
Sbjct: 439 LSDLLTQIYGIK-LEPAIPVSGETWFNDVRKINVI----SEEEGIIGIIYFDLFERYGKT 493

Query: 473 GHAANFGI-----------ASSYVRDGARSH------PVTALVCNFSK---PSAKKPALL 512
            + A+F +           A S ++ G++        P+ +LVCNFS+    S K   LL
Sbjct: 494 SNPAHFTVCCSREMYPEENADSIIQLGSKKDGTIFQLPIISLVCNFSRRTFQSDKTICLL 553

Query: 513 KHSEITTFFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLS 572
             SEI T FHE+GH IH ++G   +   +G      DFVE PS ++E +  +   L  +S
Sbjct: 554 TLSEIETLFHEMGHAIHSMLGRTTLQNVSGTRCAT-DFVELPSILMEHFASDTRVLKKMS 612

Query: 573 QHYETGEKIPEQLLDSLIATKHVNGALFALRQLTFGLFDMTVHTCK---DLESLDVTSLW 629
            HYETGEKI E+ L   +       +     Q    + D  +H+ K   +L++L+V  ++
Sbjct: 613 CHYETGEKIAEKKLQFHLKEGEFLRSCETFSQAKMAMLDQELHSDKIIHNLDNLNVVEIY 672

Query: 630 NDLRQEVSLVENGDQVTKGFNSFGHIMXXXXXXXXXXXMWAEVFAADMYHTKFAADPLNG 689
            +L + + ++   D  +     FGH+            ++    A  +++  FA DP N 
Sbjct: 673 QNLERRLQVLV--DDRSNWCGKFGHLF--GYGATYYSYLFDRAIARKVWNHLFANDPFNK 728

Query: 690 DVGVRYRDIVLSRGG 704
             G ++++ +L  GG
Sbjct: 729 TNGEKFKESLLKWGG 743

>AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL134C (OCT1)
          Length = 776

 Score =  172 bits (437), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 173/675 (25%), Positives = 297/675 (44%), Gaps = 66/675 (9%)

Query: 68  SPEDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPL---INQLTFLQH 124
           SPE + +  N+++   +AL   L   E+ + E LV+  +  +  +  L   I+   FL+ 
Sbjct: 96  SPEGLRKFANKSLTEATALVRNLR--EDSSQEGLVRYIIRLDQLSDILCRVIDLCEFLRA 153

Query: 125 VSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDDAKFKKEHFELYKFVE 184
              D++   A+ +  E  Q FEI   L  D+ V   ++ Q   D+    K   E  +   
Sbjct: 154 AHPDEQFVAAAQECHE--QMFEIMNILNTDV-VLCKRLKQVLSDENISSKLSSEEIRVGH 210

Query: 185 KCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGE-QKEFVAFTTEELD--GVS 241
              +D+ +AG     E R +  +L + IS     F  N       ++    ++L+  G S
Sbjct: 211 ILLEDFEKAGAYASPEVRKQFIQLSQNISIIGQDFINNTESLSSSYIKIPCKDLESSGTS 270

Query: 242 ASVMDQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRA----FGGDQNKVPQNE 297
             V+ Q  K  DT G   +K+         +L    +   R++     F   + +V + +
Sbjct: 271 HLVLRQLTK--DTMG-NNYKIPTSGYAPYTLLNACPSEAIRRQVWTAMFSCSEKQVKRLK 327

Query: 298 VLFLETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEAL 357
            L    L+LR +LA ++G + Y +Y L+ KMAK  E V  FL  L +  KPL   E+E L
Sbjct: 328 SL----LQLRRKLANIMGATDYVSYQLEGKMAKSPENVKNFLNTLVDHTKPLAAGELEEL 383

Query: 358 KSLK-------EKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDE-EKISEYFPLEPT 409
             LK       E +  +L  P+D  YY          + + N+ VD    I+ YF L   
Sbjct: 384 AKLKRNVENLSETNTLKLMRPWDRDYY----SSLSPNFTRPNHRVDGFTSINTYFSLGVV 439

Query: 410 IGGMLKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRD 469
           + G+  ++  +  +  ++   A+  + W  DV++L V     +E+   +G IY DL  R 
Sbjct: 440 MQGISDLFRDIYGIS-LKPVVAQAGETWAPDVRKLQVI----SETEGIIGLIYCDLLERP 494

Query: 470 GKYGHAANFGIASSYV----------------RDGAR-SHPVTALVCNFSKP---SAKKP 509
           GK    ++F +  S                   DG+R   PV +L+CNF        K  
Sbjct: 495 GKTTSPSHFTVCCSRQIYPEENDFSTIQVGENPDGSRFQMPVISLICNFRATRHGKNKSL 554

Query: 510 ALLKHSEITTFFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELS 569
            LL+ S++ T FHE+GH +H ++G   +   +G      DFVE PS ++E +  ++  L 
Sbjct: 555 CLLELSDVETLFHEMGHALHSMLGRTQLQNLSGTRCVT-DFVELPSILMEHFAKDRRVLL 613

Query: 570 TLSQHYETGEKIPEQLLDSLIATKHVNGALFALRQLTFGLFDMTVHTCKDLESLDVTSLW 629
            +S +Y TGE IPE+LL +     +         Q+   + D  +H+  D +  D+ +++
Sbjct: 614 RISSNYATGEPIPEELLSAFQEQNNFLKNTETFSQIKMSMLDQRLHSITDQD--DIIAVY 671

Query: 630 NDLRQEVSLVENGDQVTKGFNSFGHIMXXXXXXXXXXXMWAEVFAADMYHTKFAADPLNG 689
           + L +E+ ++   D  T     FGH+            +     AA ++   F  DP + 
Sbjct: 672 HGLEREMEVLV--DDQTNWCGRFGHLF--GYGASYYSYLMDRAIAAKIWDHLFKKDPFSR 727

Query: 690 DVGVRYRDIVLSRGG 704
             G ++++ VL  GG
Sbjct: 728 SSGEKFKEGVLKWGG 742

>Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}
           similar to Ashbya gossypii AFR198W
          Length = 773

 Score =  169 bits (429), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 147/549 (26%), Positives = 259/549 (47%), Gaps = 52/549 (9%)

Query: 188 KDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKN---LGEQKEFVAFTTEELD--GVSA 242
           +D+ ++G+ +  + R    EL + IS    +F  N   +G    FV   T+ L+  GVS 
Sbjct: 211 EDFEKSGIYMNPKVRERFIELSQVISIVGQEFITNTEYVG--TSFVEIETDVLEASGVSQ 268

Query: 243 SVMDQFEKFTDTDGVEKHKVSFKYPDILP--VLKTAKNPETRKRAFGGDQNKVPQNEVLF 300
            V+ Q  K  D  G      ++ Y   LP  +++T  +   RK+ +       P+ ++  
Sbjct: 269 MVLQQLSK--DLSGKFYKIPTYGY---LPYSIIRTCPSEYIRKKVWTA-MYSCPEKQIKR 322

Query: 301 LETL-RLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKS 359
           L+ L RLR +LA ++G   YA Y L+ KMAK  + V  F+  L    KPL ++E++ L  
Sbjct: 323 LKKLVRLRQQLAHIMGKPDYATYQLEGKMAKSPKNVKNFMNTLIEYTKPLAMEELKPLAD 382

Query: 360 LKEKD-CKELAIPFDNHYYIWDNRYYDNKYL----KENYNVDEEKISEYFPLEPTIGGML 414
           +K  + CK+ A    +    WD  Y+ +  L    +    +  + ++ YF L   I G+ 
Sbjct: 383 MKHDNHCKD-ASEILSSVRPWDRDYFGSMSLLAQPRSVKTMSFQSLNCYFSLGVVIQGLS 441

Query: 415 KIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGH 474
            +++++  ++ +E   A+  + W  +V+++ V     +E+   +G IY DL  R GK  +
Sbjct: 442 DLFQSIYGIR-LEPVVAKTGETWDPEVRKIQVI----SEANGVIGVIYCDLFERQGKTPN 496

Query: 475 AANFGIASS---------YVRDGARSH--------PVTALVCNFSKPSAKKPA--LLKHS 515
            A+F +  S         Y      SH        PV +LVCNFS   A   +  LL+ S
Sbjct: 497 PAHFTVCCSRQIYPNETDYSTIQVGSHPDKSKFQMPVISLVCNFSHTQADDDSICLLQLS 556

Query: 516 EITTFFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHY 575
           E+ T FHE+GH +H ++G   +   +G      DFVE PS ++E +  +   LS +S HY
Sbjct: 557 EVETLFHEMGHAMHSMLGRTQLQNISGTRCAT-DFVELPSILMEHFAKDLRVLSRISSHY 615

Query: 576 ETGEKIPEQLLDSLIATKHVNGALFALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQE 635
            TGE++P+++L +               Q+   + D  +H+  D  S D+ ++++ L +E
Sbjct: 616 ATGERVPKEMLVNYQQENRFLEHTETFSQIKMAMLDQRLHSLTD-NSEDIVTVYHGLEKE 674

Query: 636 VSLVENGDQVTKGFNSFGHIMXXXXXXXXXXXMWAEVFAADMYHTKFAADPLNGDVGVRY 695
           + ++   D  +     FGH+            +     AA +++  F  DP +   G ++
Sbjct: 675 LQVLV--DDRSNWCGRFGHLF--GYGASYYSYLMDRAIAAKVWNHLFQHDPFSRAGGEKF 730

Query: 696 RDIVLSRGG 704
           ++ VL  GG
Sbjct: 731 KNSVLKWGG 739

>KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 772

 Score =  169 bits (428), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 138/557 (24%), Positives = 266/557 (47%), Gaps = 62/557 (11%)

Query: 188 KDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLG-EQKEFVAFTTEELD--GVSASV 244
           +D+ ++G+++  E   +   L ++IS    +F  N    + E+V  +  EL+  G+S  +
Sbjct: 204 EDFEKSGIDMAPEVGEQFINLSQQISIVGQEFISNTDFPKSEYVKVSCNELETSGISPLL 263

Query: 245 MDQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLFLETL 304
           ++   +  DT G + +KV         +L++  +   R + +    +  P+ ++  L+ L
Sbjct: 264 LNHLSR--DTKG-QNYKVPTYGYIAFSILRSCPSENIRMKVWTA-VHSCPEKQITRLKHL 319

Query: 305 -RLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSLKEK 363
            +LR  LA ++G ++Y++Y L+ KMAK    V  F+E L   +KPL ++E+ AL +LK  
Sbjct: 320 VKLRGLLAQIMGKNSYSDYQLEGKMAKSPVYVRGFVESLAEAIKPLAMRELRALANLKSS 379

Query: 364 DCKELAIPFDNHYYI-----WDNRYYDN--KYLKENYNVDEEKISEYFPLEPTIGGMLKI 416
              +L IP  +   +     WD  +Y       ++   ++ E+I+ YF L   + G+  +
Sbjct: 380 HL-DLPIPKTDEEVLKFVRPWDRDFYSTLISLQQQRKTLENEQINSYFSLGTVMQGLSSL 438

Query: 417 YETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAA 476
            E +  ++ +E   A+  + W  +V+++ V     ++    +G +Y DL  R GK  + A
Sbjct: 439 LEDIYGIR-LEPAVAKVGETWSPEVRRINVV----SDQEGVIGVVYCDLFERQGKTSNPA 493

Query: 477 NFGIASSY-----------VRDGARSH-------PVTALVCNFSKPSAKKP--ALLKHSE 516
           +F +  S            ++ G +         PV +LVC+FS+ S  K    LL+ SE
Sbjct: 494 HFTVCCSRQIYPEETDLSTIQVGQQPSSGQIFQLPVISLVCSFSQNSGSKKDVCLLQLSE 553

Query: 517 ITTFFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYE 576
           + T FHE+GH IH ++G   +   +G      DFVE PS ++E +  +   LS + +HY 
Sbjct: 554 VDTLFHEMGHAIHSMLGRTSLQNISGTRCAT-DFVELPSILMEHFAHDSRVLSRIGKHYI 612

Query: 577 TGEKIPEQLLDSLIATKHVNGALF-------ALRQLTFGLFDMTVHTCKDLES--LDVTS 627
           T E +P++LL       H+N              Q    + D  +H+ + L    +DV  
Sbjct: 613 TNEPVPDELL-------HLNQNELKYLQNTETFSQAKMAMLDQEMHSPRMLTDGPVDVVE 665

Query: 628 LWNDLRQEVSLVENGDQVTKGFNSFGHIMXXXXXXXXXXXMWAEVFAADMYHTKFAADPL 687
           +++++ +++ ++   D  +     FGH++           ++    A+ ++   FA DP 
Sbjct: 666 IYHEVEKQMGVLT--DDKSNWCGRFGHLL--GYGASYYSYLFDRAIASKVWQHLFANDPF 721

Query: 688 NGDVGVRYRDIVLSRGG 704
           +   G ++++ VL  GG
Sbjct: 722 SRKSGEKFKNSVLRWGG 738

>ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 786

 Score =  169 bits (428), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 159/684 (23%), Positives = 298/684 (43%), Gaps = 75/684 (10%)

Query: 68  SPEDILQLTNETIASTSALHDALAGVENPT-VESLVKPFLEHENTTQPLINQLTFLQHVS 126
           SP+ + + + +++     L + +   E P  +++ +    +  +T   +I+   F++   
Sbjct: 97  SPDGLRKFSRQSLNQAYELLEDMKNDETPQGLQNYILRLDQLSDTLCRVIDLCEFIRSSH 156

Query: 127 ADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDDAKFKKEHFELYKFVEKC 186
            D    DA+    E + +F    +   +L  +   V    +   K   E  ++ K +   
Sbjct: 157 PDSHFVDAAQDCHEEMFEFMNVLNTDVNLCNKLRTVLNTPEVVCKLSSEEVKVGKIL--- 213

Query: 187 HKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLG-EQKEFVAFTTEEL--DGVSAS 243
            +D+ ++G+ +  E R +   L ++IS     F  N    +  ++    E +   G++  
Sbjct: 214 LEDFEKSGIYMNPEIREQFIALSQEISIVGQDFINNTDFVRTNYITVDCETIHNSGINQL 273

Query: 244 VMDQFEKFTDTDGVEKHKVSFKYPD----ILPVLKTAKNPETRKRAFGGDQNKVPQNEVL 299
           ++ Q  K  D  G  KH   +K P        VL+   +   RK+ +    +  P  +++
Sbjct: 274 ILSQLSK--DIKG--KH---YKIPTHGYIAYSVLRACPDEIVRKKLWTA-MHSCPDKQIV 325

Query: 300 FLETL-RLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALK 358
            L+ L RLR  LA L+G  +YA Y L+ KMAK  E V  F++ L    +P   +E+  + 
Sbjct: 326 RLDQLVRLRAVLAFLMGKKSYAEYQLEGKMAKSPEEVTDFIDSLIKVTQPKAKQELGFIS 385

Query: 359 SLKEK------------DCKELAIPFDNHYYIWDNRYYDNKY---LKENYNVDEEKISEY 403
            LK K            D  ++  P       WD  +Y   Y    +    +D+++IS Y
Sbjct: 386 DLKRKHMDLPPSETSNLDTLDIVRP-------WDRDFYHTIYSIQQRRQSPIDDQQISMY 438

Query: 404 FPLEPTIGGMLKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYF 463
           F L   + G+  ++  +  ++ +E   A+K + W  +V++L V     ++    +G +Y 
Sbjct: 439 FTLGNVMQGLSDLFHQIYGIR-LEPVIAQKGETWSPEVRRLNV----VSDEEGVIGVVYC 493

Query: 464 DLHPRDGKYGHAANFGIASSYV----------------RDGARSH-PVTALVCNFSKPS- 505
           DL  RDGK  + ++F +  S                  +DG +   P+ +LVCNF+    
Sbjct: 494 DLFERDGKTSNPSHFTVCCSRQIYPKENDLSTIQIGTNKDGTKFQLPIISLVCNFASSVV 553

Query: 506 --AKKPALLKHSEITTFFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTW 563
              +   LL  SEI T FHE+GH +H ++G   +   +G      DFVE PS ++E +  
Sbjct: 554 SFGQSLCLLHISEIETLFHEMGHAMHSMLGRTRLQNLSGTRCAT-DFVELPSILMEHFAR 612

Query: 564 NKNELSTLSQHYETGEKIPEQLLDSLIATKHVNGALFALRQLTFGLFDMTVH---TCKDL 620
           +   L  + +H  TGE +PE LL + +             Q    + D  +H       +
Sbjct: 613 DTRVLRQIGKHCNTGEPVPESLLTNYLQDLQYMQYCETFSQAKMAMLDQRLHGKEIITGM 672

Query: 621 ESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMXXXXXXXXXXXMWAEVFAADMYHT 680
           ++LDV +L+ +L +E+ ++ +      G   FGH+            ++    A+ ++ +
Sbjct: 673 DTLDVVALYQNLERELRVLVDDQSTWCG--RFGHLF--GYGATYYSYLFDRAIASKVWES 728

Query: 681 KFAADPLNGDVGVRYRDIVLSRGG 704
            F  DP +   G R+++ VL  GG
Sbjct: 729 LFQEDPFSRAGGQRFKEYVLKWGG 752

>TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {ON}
           Anc_2.432 YKL134C
          Length = 787

 Score =  167 bits (424), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 162/677 (23%), Positives = 301/677 (44%), Gaps = 61/677 (9%)

Query: 68  SPEDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPL---INQLTFLQH 124
           SPE + + +  ++     L D +    N + E L    +  +  +  L   I+   F++ 
Sbjct: 98  SPEGLRKFSRRSLTHAQGLLDDMRN--NKSFEGLTAYVMRLDQLSDTLCRVIDLCEFIRS 155

Query: 125 VSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKD---DAKFKKEHFELYK 181
              D    +A+    E +  FE    L  D+ +  D + Q   D     K   E   + K
Sbjct: 156 SHPDSSFIEAAQACHEEM--FEFMNILNTDVEL-CDTLRQVLTDPEIKGKLSNEEITVGK 212

Query: 182 FVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGE-QKEFVAFTTEELD-- 238
            +    +D+ ++G+ +  E R++   L ++IS    +F  N    +  ++    EE+D  
Sbjct: 213 IL---LEDFEKSGIYMNPEVRDQFIALSQEISLVGQEFINNTDYVRSNYIKIKCEEVDNS 269

Query: 239 GVSASVMDQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEV 298
           G++  ++ Q  K  D  G + +K+         +L++  + E R   +        +   
Sbjct: 270 GINKLLISQLPK--DVRG-KYYKIPTHGYIAYSILRSCPDEEIRMNLWTAMHRCSDKQIN 326

Query: 299 LFLETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALK 358
              + LRLR  LA L+G  ++A Y L+ KMA+  + V  F+  L N ++P  ++E++ + 
Sbjct: 327 RLDQLLRLRAILAKLMGKESFAQYQLEGKMAQTPQQVRDFIGTLVNYMRPKTIEELKFIY 386

Query: 359 SLKEKDCKELAIPFDNHYYI------WDNRYYDNKY-LKENYN-VDEEKISEYFPLEPTI 410
            LK K  K    P  +   I      WD  YY + Y L++  + +D+E+IS YF L   I
Sbjct: 387 ELKSKQEKREIQPSPSEQDIASMVRPWDREYYTSMYSLQQRRDAIDDEQISSYFTLGNVI 446

Query: 411 GGMLKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDG 470
            G+  ++E++  ++ +E    +  + +  +V++L V      E    +G +Y DL  R G
Sbjct: 447 QGLSDLFESIYGIR-LEPVVPKTGETFSPEVRRLNVV----CEQEGVIGVVYCDLFERAG 501

Query: 471 KYGHAANFGIASSY-----------VRDGARSH------PVTALVCNFSKPS---AKKPA 510
           K  + ++F +  S            ++ G  S       PV ALVCNFS  +    K   
Sbjct: 502 KTSNPSHFTVCCSRQIYPKETEFSTIQTGFNSEGLMFQLPVIALVCNFSSSTDSEGKSIC 561

Query: 511 LLKHSEITTFFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELST 570
           LL+ +E+ T FHE+GH +H ++G   +   +G      DFVE PS ++E +  +   L  
Sbjct: 562 LLQLNEVETLFHEMGHAMHSMLGRTRLQNISGTRCAT-DFVELPSILMEHFARDVRVLER 620

Query: 571 LSQHYETGEKIPEQLLDSLIATKHVNGALFALRQLTFGLFDMTVH---TCKDLESLDVTS 627
           + +H+ TG  I E+LL + +             Q    + D  +H     KD +  DVT+
Sbjct: 621 IGKHHRTGAPISEKLLLNYLEETKFMQHCETFSQAKMAMLDQDLHGEKVIKDFDHFDVTA 680

Query: 628 LWNDLRQEVSLVENGDQVTKGFNSFGHIMXXXXXXXXXXXMWAEVFAADMYHTKFAADPL 687
            +  L +++ ++   D  +     FGH+            ++    A+ ++ + F++DP 
Sbjct: 681 AYQQLERDMKVLV--DDKSNWCGKFGHLF--GYGATYYSYLFDRAIASKVWDSLFSSDPY 736

Query: 688 NGDVGVRYRDIVLSRGG 704
           +   G ++++ VL  GG
Sbjct: 737 SRVNGEKFKECVLKWGG 753

>Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  167 bits (422), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 149/549 (27%), Positives = 253/549 (46%), Gaps = 45/549 (8%)

Query: 189 DYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLG-EQKEFVAFTTEELDG--VSASVM 245
           D+ ++G+ +  + R +  EL ++IS    +F  +        V    ++LD   VSA ++
Sbjct: 204 DFEKSGIYMNPDVREKFIELSQEISLIGQEFINHTDYPGSNSVKIPCKDLDNGNVSAFLL 263

Query: 246 DQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLFLETLR 305
            Q  K  D  G      +F Y     +LK+ +  E RK+ +    +   +        ++
Sbjct: 264 KQLNK--DVKGQNYKIPTFGYA-AYALLKSCEKEEVRKKLWTALHSCSDKQIKRLSHLIK 320

Query: 306 LRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSLKEKDC 365
           LR  LA L+   +YA Y L+ KMAK  + V  F+  L N        E++ +  LK KD 
Sbjct: 321 LRAILANLMNKESYAEYQLEGKMAKNPKDVQDFILTLMNGTIDKTANELKFIAELKTKDL 380

Query: 366 KE-LAIPFDNHYYI---WDNRYYDNKYLKENYN--VDEEKISEYFPLEPTIGGMLKIYET 419
           K+ LA   D+   +   WD  YY  KYL+ N +   + ++IS YF L   I G+  +++ 
Sbjct: 381 KKPLATKTDDILRLVRPWDRDYYTGKYLQLNPSDAPNAKEISYYFTLGNVIEGLSDLFQH 440

Query: 420 VLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAANFG 479
           +  ++   E  A++ + W  DV++L V     +E    +G IY DL  R+GK  + A+F 
Sbjct: 441 IYGIRLEPEI-ADEGETWSPDVRRLNVI----SEEEGIIGIIYCDLFERNGKTSNPAHFT 495

Query: 480 IASSYV----------------RDGARSH-PVTALVCNFSK-PSAKKPAL--LKHSEITT 519
           +  S                   DG+    PV +LVCNF+  P A K  L  L+ SE+ T
Sbjct: 496 VCCSRQIYPNETDFSTIQVGENPDGSYFQLPVISLVCNFAPIPIASKKTLCFLQLSEVET 555

Query: 520 FFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGE 579
            FHE+GH +H ++G  H+   +G      DFVE PS ++E +  +   L+ +S+HYETGE
Sbjct: 556 LFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTKISKHYETGE 614

Query: 580 KIPEQLLDSLIATKHVNGALFALRQLTFGLFDMTVH---TCKDLESLDVTSLWNDLRQEV 636
            I   +L S + T +         Q    + D + H      D+++ D+   +  L + +
Sbjct: 615 TIQAGMLQSFMRTTNFLQNCETYSQAKMAMLDQSFHDEEIISDIDNFDIVKNYQALERRL 674

Query: 637 SLVENGDQVTKGFNSFGHIMXXXXXXXXXXXMWAEVFAADMYHTKFAADPLNGDVGVRYR 696
            ++   D  +     FGH+            ++    A+ +++  F  DP +   G +++
Sbjct: 675 KVLV--DDQSNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSRKNGDKFK 730

Query: 697 DIVLSRGGL 705
             +L  GGL
Sbjct: 731 KHLLKWGGL 739

>Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C
           (OCT1) - 1:1 [contig 55] FULL
          Length = 770

 Score =  166 bits (421), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 135/549 (24%), Positives = 255/549 (46%), Gaps = 47/549 (8%)

Query: 188 KDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLG-EQKEFVAFTTEELD--GVSASV 244
           +D+ ++G+++  +   +   + ++IS    +F  N    + ++V    +ELD  GVS  +
Sbjct: 203 EDFEKSGIDMEPKVGEQFINISQQISIVGQEFINNTDFPRSDYVKIPCKELDSSGVSTLL 262

Query: 245 MDQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLFLETL 304
           ++Q  +       + +KV         +L++  N   R + +    +  P+ ++  L+ L
Sbjct: 263 LNQLSRDLKN---QNYKVPAYGYAAFSILRSCPNENVRMKIWTA-MHSCPEKQISRLKQL 318

Query: 305 -RLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSLKEK 363
             LR  LA ++G  +YA Y L  KMAK    V  F++ L +  KPL  +E+  L  LK  
Sbjct: 319 VMLRGLLASIMGKKSYAEYQLSGKMAKSPVYVRGFVQSLVDVTKPLAAEELRVLAKLKSG 378

Query: 364 DCKELAIPFDNHYYI-----WDNRYYD--NKYLKENYNVDEEKISEYFPLEPTIGGMLKI 416
               + +P  +   +     WD  +Y   N   ++   ++ E IS YF L   + G+ ++
Sbjct: 379 HLG-VNVPQSDADVLRFVRPWDRDFYSTLNALQQQRKTLENEHISSYFSLGTVMQGLSRL 437

Query: 417 YETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAA 476
           +E +  ++ +E   A+  + W  +V+++ V     +E    +G +Y DL  R GK  + A
Sbjct: 438 FEDIYGIR-LEPVVAKAGETWSPEVRRINVV----SEKEGIIGVVYCDLFERQGKTSNPA 492

Query: 477 NFGIASSY----------------VRDGARSH-PVTALVCNFSKPSAKKP--ALLKHSEI 517
           +F +  S                 +  G +   PV +LVC+F++ SA +    LL+ S++
Sbjct: 493 HFTVCCSRTIYPGETDLSTIQVGQLPSGEKFQLPVISLVCSFAQNSASRQGVCLLQLSDV 552

Query: 518 TTFFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYET 577
            T FHE+GH +H ++G   +   +G      DFVE PS ++E +  +   LS + +HY T
Sbjct: 553 DTLFHEMGHAMHSMLGRTSLQNISGTRCAT-DFVELPSILMEHFARDSRVLSRIGRHYAT 611

Query: 578 GEKIPEQLLDSLIATKHVNGALFALRQLTFGLFDMTVHTCKDLE--SLDVTSLWNDLRQE 635
            + IP +LL       +         Q    + D  +H+ K L    LDV  L++ + ++
Sbjct: 612 DQPIPTELLKLNQTEMNYLQHTETFSQAKMAMLDQELHSSKALTDGKLDVVKLYHGVEKD 671

Query: 636 VSLVENGDQVTKGFNSFGHIMXXXXXXXXXXXMWAEVFAADMYHTKFAADPLNGDVGVRY 695
           + ++   D  +     FGH++           ++    A+ ++   FA DP N + G ++
Sbjct: 672 MEVL--ADDQSNWCGRFGHLL--GYGASYYSYLFDRAIASKIWQHLFAEDPFNRENGEKF 727

Query: 696 RDIVLSRGG 704
           ++ VL  GG
Sbjct: 728 KESVLKWGG 736

>Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {ON}
           YKL134C (REAL)
          Length = 775

 Score =  165 bits (417), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 165/630 (26%), Positives = 280/630 (44%), Gaps = 52/630 (8%)

Query: 110 NTTQPLINQLTFLQHVSADKEVRDASTKATELLQDFEIEASLRHD--LFVQFDKVWQACK 167
           +T   +I+   F++    D     A+    E  Q FE    L  D  L      V  + K
Sbjct: 131 DTLCRVIDLCEFIRSTHPDDAFVKAAQDCHE--QMFEFMNVLNTDVSLCNMLKTVLNSPK 188

Query: 168 DDAKFKKEHFELYKFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLG-EQ 226
             +K  +E  ++ K +     D+ ++G+ +  + R +  +L ++IS    +F  +     
Sbjct: 189 ISSKLSEEELKVGKIL---LDDFEKSGIYMNPDVREKFIQLSQEISLVGQEFINHTDYPG 245

Query: 227 KEFVAFTTEELDG--VSASVMDQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKR 284
              V  +  ELD   VSA ++ Q  K  D  G      +F Y     +LK+ +  + RK+
Sbjct: 246 SNSVKISCRELDNSNVSAFLLKQLNK--DVKGQNYKVPTFGYA-AYALLKSCEKEQVRKK 302

Query: 285 AFGGDQNKVPQNEVLFLETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKN 344
            +    +   +        ++LR  LA L+   +YA Y L+ KMAK  + V  F+  L N
Sbjct: 303 IWTALHSCSDKQIKRLNHLIKLRANLADLMHKGSYAEYQLEGKMAKNPKDVQDFILTLMN 362

Query: 345 KLKPLGVKEIEALKSLKEKDCKE-LAIPFDNHYYI---WDNRYYDNKYLKEN-YNVDEEK 399
                   E++ +  LK KD K+ LA   D    +   WD  YY  KYL+ N  N    K
Sbjct: 363 DTIDKTATELKFIAELKAKDLKKPLATKTDEILKLVRPWDRDYYTGKYLQLNPSNAPSAK 422

Query: 400 -ISEYFPLEPTIGGMLKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFV 458
            IS YF L   I G+  +++ +  +K +E   A++ + W  DV++L V     +E    +
Sbjct: 423 EISSYFTLGNVIQGLSDLFQHIYGIK-LEPAIADEGETWSPDVRRLNVI----SEEEGII 477

Query: 459 GWIYFDLHPRDGKYGHAANFGIASSY-----------VRDGARSH------PVTALVCNF 501
           G IY DL  R GK  + A+F +  S            ++ G  +       PV +LVCNF
Sbjct: 478 GIIYCDLFERSGKTSNPAHFTVCCSRQIYPNETDFSTIQLGENADGSFFQLPVISLVCNF 537

Query: 502 SK-PSAKKPAL--LKHSEITTFFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQML 558
           +  P A K +L  L+ SE+ T FHE+GH +H ++G  H+   +G      DFVE PS ++
Sbjct: 538 APIPIASKKSLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILM 596

Query: 559 EFWTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHVNGALFALRQLTFGLFDMTVH--- 615
           E +  +   L+ + +HYETGE +   +L S + T +         Q    + D + H   
Sbjct: 597 EHFAKDIRILTRIGKHYETGETVEPDMLQSFMRTTNFLQNCETYSQAKMAMLDQSFHDEE 656

Query: 616 TCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMXXXXXXXXXXXMWAEVFAA 675
              ++++ DV   +  L + + ++   D  +     FGH+            ++    A+
Sbjct: 657 VISNIDNYDVVKNYQALERRLKVLV--DDQSNWCGRFGHLF--GYGATYYSYLFDRTIAS 712

Query: 676 DMYHTKFAADPLNGDVGVRYRDIVLSRGGL 705
            +++  F  DP +   G +++  +L  GGL
Sbjct: 713 KIWYALFEDDPYSRKNGDKFKKHLLKWGGL 742

>NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {ON}
           Anc_2.432
          Length = 773

 Score =  164 bits (415), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 167/681 (24%), Positives = 308/681 (45%), Gaps = 69/681 (10%)

Query: 68  SPEDILQLTNETIASTSALHDALAGVENPTVE-SLVKPFLEHENTTQPLINQLTFLQHVS 126
           SP+ + + +N+++    +L D +    +   E   +       +T   +I+   F++   
Sbjct: 86  SPKGLKEFSNKSLEKARSLVDTMKNDRSFKGEMGFIMNLDRLSDTLCRVIDLCEFIRSTH 145

Query: 127 ADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKD---DAKFKKEHFELYKFV 183
            D+    A+    E  Q FE    L  D+ V  D +     D   ++K   E  ++ K +
Sbjct: 146 PDEAFVKAAQDCHE--QMFEFMNVLNTDV-VLCDILKHVLNDPNINSKLTPEEIKVGKLL 202

Query: 184 EKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKE-FVAFTTEELD--GV 240
               +D+ ++G+ +    R +   L ++IS     F  N+   K   V     EL+  GV
Sbjct: 203 ---LEDFEKSGIYMDPNIRKQFISLSQEISLTGQDFINNIDLIKSNHVKIKCSELNKSGV 259

Query: 241 SASVMDQFEKFTDTDGVEKHKVSFKYP--DILPVLKTAKNPETRKRA-FGGDQNKVPQNE 297
           ++ ++ Q  K    D   K+   +K P    +P+      P+   RA      +  P ++
Sbjct: 260 NSLLLKQLPK----DITGKY---YKIPTSGYIPISLIRSCPDATIRAKVWASLHSCPNDQ 312

Query: 298 VLFLETL-RLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEA 356
           +  L  L +LR  LA LL   ++A Y L+ KMAK  + V  F++ L + ++P   +E++ 
Sbjct: 313 IRRLTHLVKLRAILAHLLNKCSFAKYQLEGKMAKTPQNVRDFIKTLMDYMRPKAAQELKF 372

Query: 357 LKSLKEKDCKELAIPFDNHYYI-------WDNRYYDNKYLK-ENYNVDE-EKISEYFPLE 407
           +  LK   CKEL IP  +           WD  YY   + K ++ N+ E   I+ YF + 
Sbjct: 373 MADLK---CKELNIPTSDSTTAILDLISPWDREYYTTIHSKAKDVNLYENHPINMYFTMG 429

Query: 408 PTIGGMLKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHP 467
             + G+  I++ +  ++ +E    E+ + W  +V++L V     +E+   +G +Y DL  
Sbjct: 430 NIMKGLSHIFQRIYGIR-LEAVVPEEGETWSPEVRRLNVI----SETEGLIGVVYCDLFE 484

Query: 468 RDGKYGHAANFGIASSY-----------VRDG------ARSHPVTALVCNFSK---PSAK 507
           R GK  + A+F +  S            ++ G      A   PV +LVCNFS     + K
Sbjct: 485 RAGKTSNPAHFTVCCSRQIYPDENDLSTIQIGTNPDGTAFQLPVISLVCNFSSTLTSNDK 544

Query: 508 KPALLKHSEITTFFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNE 567
              LL+ +EI T FHE+GH +H ++G + +   +G      DFVE PS ++E +  +K  
Sbjct: 545 MICLLQLNEIETLFHEMGHAMHSMLGRSRLQNVSGTRCAT-DFVELPSILMEHFARDKRV 603

Query: 568 LSTLSQHYETGEKIPEQLLDSLIATKHVNGALFALRQLTFGLFDMTVHT---CKDLESLD 624
           L  +  HYET E++ E ++++ +             Q    + D  +++    KDL+ +D
Sbjct: 604 LHEIGFHYETNERVSEYVIEAHLKKMKFLQDCETFSQGKMAMLDQELYSENIIKDLDHVD 663

Query: 625 VTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMXXXXXXXXXXXMWAEVFAADMYHTKFAA 684
           V  ++  L +++ ++   D  +     FGH+            ++    A+ ++   FA 
Sbjct: 664 VVKIYQTLEEDLKVLV--DNKSNWCGKFGHLF--GYGASYYSYLFDRAIASKVWDQLFAK 719

Query: 685 DPLNGDVGVRYRDIVLSRGGL 705
           DP + + G ++++ VL  GGL
Sbjct: 720 DPFSREGGEKFKNCVLKWGGL 740

>TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.432
           YKL134C
          Length = 773

 Score =  161 bits (408), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 145/551 (26%), Positives = 247/551 (44%), Gaps = 52/551 (9%)

Query: 188 KDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLG-EQKEFVAFTTEELDGVSASVMD 246
           +D+ ++G+ +  E R+    L + IS     F  N    +K+++    +E D        
Sbjct: 207 EDFEKSGIQMSPEIRDRFISLSQDISLAGQDFLNNTSYTEKDYIKIKCDEFDKACDYPAL 266

Query: 247 QFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKR---AFGGDQNKVPQNEVLFLET 303
           +++   D  G + +K+          L   K+ E RK+   AF    NK  Q E L  + 
Sbjct: 267 KYKLSKDLSG-KYYKIPTYGKIPYTALLKCKDEELRKKLWVAFHSCSNK--QIERL-TKI 322

Query: 304 LRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSLKEK 363
           ++ R ELA LL  S+Y+ Y L+ KMAK  + V  FL  L   + P   KE+E + +   K
Sbjct: 323 IKHRIELAKLLSKSSYSEYTLEGKMAKGPKEVNNFLNALLKSILPEVTKELEPISN---K 379

Query: 364 DCKELAIPFD-------NHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGMLKI 416
            C       +       N+   WD  YY N     +    +  I EYF L   I G+  +
Sbjct: 380 KCLSEGFSLETSEQSILNNIKPWDRDYY-NPIQATSEGAYQMLIMEYFTLGNIIHGLSNL 438

Query: 417 YETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAA 476
           + ++  ++F E    E  + W +DV++L V   D+      +G IY DL  R+GK    +
Sbjct: 439 FNSIYGIRF-EPGKIEDGETWSKDVRKLNVISEDEG----LIGVIYCDLFEREGKSESPS 493

Query: 477 NFGIASSY-----------VRDGARSH-------PVTALVCNFSKPSAK---KPALLKHS 515
           ++ I  S            ++ G  +        P+ +LVCNF   +AK   +   L+H 
Sbjct: 494 HYTICCSREIYSEEHDLSTIQTGVNNKTGKNFQLPIVSLVCNFQVTNAKESRRICFLQHH 553

Query: 516 EITTFFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHY 575
           EI T FHE+GH +H ++G       +G      DFVE PS ++EF+  N   L  +S+HY
Sbjct: 554 EIETLFHEMGHAMHSMLGRTRFQTISGTRCVS-DFVEIPSILMEFFANNPKVLIDISRHY 612

Query: 576 ETGEKIPEQLLDSLIATKHVNGALFALRQLTFGLFDMTVHT--CKDLESLDVTSLWNDLR 633
           ++GE I  ++L+  +       A     Q    L D  +H      L+++DV  ++++L 
Sbjct: 613 DSGESIDIEVLNKYLENTKQFKACETYSQGKMALLDQRLHAENANSLDNIDVVEIYHNLE 672

Query: 634 QEVSLVENGDQVTKGFNSFGHIMXXXXXXXXXXXMWAEVFAADMYHTKFAADPLNGDVGV 693
           +E+S++ + +    G   FGH+            ++    A  ++ + F  DP +   G 
Sbjct: 673 KELSVLPDTESNWCG--RFGHLY--GYGALYYCYLFDRAIATKIWESLFQNDPFSRKGGN 728

Query: 694 RYRDIVLSRGG 704
            +++ +L  GG
Sbjct: 729 IFKEQLLKWGG 739

>Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON}
           complement(11648..14011) [2364 nt, 788 aa]
          Length = 787

 Score =  161 bits (407), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 143/557 (25%), Positives = 247/557 (44%), Gaps = 60/557 (10%)

Query: 188 KDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEF-VAFTTEELD--GVSASV 244
           +D+ ++G+ +  E R +   L + IS    +F  N    K+  V  +  +LD  G+   +
Sbjct: 217 EDFEKSGIYMKPEVREQFITLSQSISVIGQEFISNTDFVKDNNVVVSCNQLDSLGIDPEL 276

Query: 245 MDQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLFLETL 304
           + Q EK  D  G      ++ Y     +LK+  + E R++ +    N   +      + +
Sbjct: 277 LSQIEK--DIAGKNYKIPTYGYIP-FALLKSCPSEEIREKIWVAVHNCSNEQIKRLTDLV 333

Query: 305 RLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEAL------- 357
           +LR  L+ LLG  +YA Y L+ KMAK  + V+ F++ L +  KP+  KE++ +       
Sbjct: 334 KLRAVLSQLLGKKSYAEYQLEGKMAKNPKEVIEFIKTLMDFTKPMAAKELDGIAEKKLTI 393

Query: 358 ----KSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGM 413
                +L   D  +   P+D  YY    R  +    K  Y    E++ +YF L   + G+
Sbjct: 394 KSNGSNLSVCDILKTVRPWDRDYYSAIER--EQTSAKNLYG--SEEVLKYFTLGNVMQGL 449

Query: 414 LKIYETVLKLKFVEETDAEK-KQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKY 472
             +++ +  +K   E D  K  + W  +V+++ V   D+      +G IY DL  R GK 
Sbjct: 450 SNLFQKIYGIKL--ELDVPKIGETWSPEVRKINVISEDEG----LIGIIYCDLFERSGKT 503

Query: 473 GHAANFGIASSYVRD------------------GARSH-PVTALVCNFSKPSAKKP---A 510
            +AA+F I  S  RD                  G R   P+ +LVCNFSK    +     
Sbjct: 504 SNAAHFTICCS--RDISPYETEDSTTQIAIDSKGTRFQLPIISLVCNFSKTMISETDSVC 561

Query: 511 LLKHSEITTFFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELST 570
            L   E+ T FHE+GH +H ++G   +   +G      DFVE PS ++E++  +   L T
Sbjct: 562 FLHLPEVETLFHEMGHAMHSMLGRTKLQNISGTRCAT-DFVELPSILMEYFARDPRVLET 620

Query: 571 LSQHYETGEKIPEQLLDSLIATKHVNGALFALRQLTFGLFDMTVH---TCKDLESLDVTS 627
           + +HY T E +  ++L+  +             Q    + D T+H       L+ LDV  
Sbjct: 621 IGKHYLTKETVKREMLEPHLQDLKYLQHCETYSQAKMAMLDQTLHGETISSHLDHLDVVK 680

Query: 628 LWNDLRQEVSLVENGDQVTKGFNSFGHIMXXXXXXXXXXXMWAEVFAADMYHTKFAADPL 687
           L+ DL +++ ++   D  +     FGH+            ++    A+ ++   F  +P 
Sbjct: 681 LYQDLERQLGVLV--DDKSNWCGKFGHLF--GYSAVYYSYLFDRAIASKIWGALFERNPF 736

Query: 688 NGDVGVRYRDIVLSRGG 704
           +   G +YR+ VL  GG
Sbjct: 737 SRASGDKYRNSVLQWGG 753

>Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  160 bits (406), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 147/549 (26%), Positives = 253/549 (46%), Gaps = 45/549 (8%)

Query: 189 DYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLG-EQKEFVAFTTEELDG--VSASVM 245
           D+ ++G+ +    R +  +L ++IS    +F  ++       V    ++LD   VS  ++
Sbjct: 204 DFEKSGIYMNPGVREKFIQLSQEISLVGQEFINHIDYPGSNSVKIPCKDLDSSKVSTFLL 263

Query: 246 DQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLFLETLR 305
            Q  K  D  G      +F Y     +LK+ +    RK+ +    +   +        ++
Sbjct: 264 KQLNK--DVKGQNYKVPTFGYA-AFALLKSCEIEVVRKKIWTALHSCSDKQIKRLDRLIK 320

Query: 306 LRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSLKEKDC 365
           LR  LA L+   +YA Y L+ KMAK  + V  F+  L N        E++ +  LK KD 
Sbjct: 321 LRAVLANLMHKGSYAEYQLEGKMAKNPKDVQDFILTLMNNTIDKTANELKFIADLKAKDL 380

Query: 366 KE-LAIPFDNHYYI---WDNRYYDNKYLKEN-YNVDEEK-ISEYFPLEPTIGGMLKIYET 419
           K+ L    D    +   WD  YY  KY++ N  NV   K IS YF L   I G+  +++ 
Sbjct: 381 KKPLTTNTDEILKLVRPWDRDYYTGKYIQLNPSNVPSAKEISYYFTLGNVIQGLSDLFQQ 440

Query: 420 VLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAANFG 479
           +  ++ +E   A++ + W  DV++L V     +E    +G IY DL  R+GK  + A+F 
Sbjct: 441 IYGIR-LEPAIADEGETWSPDVRRLNVI----SEEEGIIGIIYCDLFERNGKTSNPAHFT 495

Query: 480 IASSY-----------VRDGARSH------PVTALVCNFSK-PSAKKPAL--LKHSEITT 519
           +  S            ++ G   +      PV +LVCNFS  P A K +L  L+ SE+ T
Sbjct: 496 VCCSRQIYPHETDFSTIQVGENPNGSYFQLPVISLVCNFSPVPIASKKSLCFLQLSEVET 555

Query: 520 FFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGE 579
            FHE+GH +H ++G  H+   +G      DFVE PS ++E +  +   L+ + +HYETGE
Sbjct: 556 LFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRVLTRIGKHYETGE 614

Query: 580 KIPEQLLDSLIATKHVNGALFALRQLTFGLFDMTVHTCK---DLESLDVTSLWNDLRQEV 636
            I + +L   + T +         Q    + D + H  K   D+++ +V   +  L + +
Sbjct: 615 TIQKGMLQCFMKTTNFLQNCETYSQAKMAMLDQSFHDEKIMSDIDNFNVVDNYQALERHL 674

Query: 637 SLVENGDQVTKGFNSFGHIMXXXXXXXXXXXMWAEVFAADMYHTKFAADPLNGDVGVRYR 696
            ++   D  +     FGH+            ++    A+ +++T F  DP + + G +++
Sbjct: 675 KVLV--DDQSNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYTLFDDDPYSRNNGDKFK 730

Query: 697 DIVLSRGGL 705
             +L  GGL
Sbjct: 731 KHLLKWGGL 739

>TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {ON}
           Anc_2.432 YKL134C
          Length = 795

 Score =  156 bits (395), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 160/627 (25%), Positives = 281/627 (44%), Gaps = 49/627 (7%)

Query: 110 NTTQPLINQLTFLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDD 169
           +T   +I+   F++    D E    S +  EL+  FE   +L  D  VQ     +   +D
Sbjct: 149 DTLCRVIDLCEFIRSAHPDDEYLKVSQECYELM--FEFMNTLNTD--VQLCYTLKHILED 204

Query: 170 AKF-KKEHFELYKFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGE-QK 227
            K   K   E YK  +   +D+ ++G+ +    R +  EL ++IS    +F  N     K
Sbjct: 205 EKICSKLTDEEYKVGKILLEDFEKSGIYMEPNTREKFIELSQEISLVGQEFISNTDYVTK 264

Query: 228 EFVAFTTEELDGVSASVMDQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFG 287
             +    E L+     +   ++  TD  G + +K+    P    +L    N   RK+ + 
Sbjct: 265 NNILIDRESLNLSELELPFTYQLKTDITG-KHYKIPTTGPIPYSILTNCSNETIRKKIWT 323

Query: 288 GDQNKVPQNEVLFLETL-RLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKL 346
            + +   Q ++  L+ +  LR +LA LL   ++A Y L  KMAK  E V  F+  L +  
Sbjct: 324 -ELHSCSQEQIERLKKMVTLRYKLAKLLKKKSFAEYQLQGKMAKNPEEVKKFISTLLDFT 382

Query: 347 KPLGVKEIEALKSLKEKDCKELAIPFDNHYYI-----WDNRYYD--NKYLKENYNVDEEK 399
           KPL +KE+ +L  +K  D   LA   D+++ +     WD  YY   N+Y  +    D  +
Sbjct: 383 KPLAIKELTSLAEVKAADLG-LAFKNDSNFIVNLIRPWDRNYYSKINRYENKQTMEDLNE 441

Query: 400 ISEYFPLEPTIGGMLKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVG 459
           +  YF L   I G+  ++  +  ++F E    + ++ W  +V++L V     +ES   +G
Sbjct: 442 LPYYFSLGNVIAGLSNLFHNIYGIRF-ELAVPKLEETWLPEVRKLNVI----SESEGLIG 496

Query: 460 WIYFDLHPRDGKYGHAANFGIASSY----------VRDGARSH------PVTALVCNFSK 503
            +Y DL  R  K  +AA+F I  S           ++ G  S       P+ +L+CNFSK
Sbjct: 497 IVYCDLFERPSKKTNAAHFTICCSREIGKGEDISTMQVGMNSKGNMFQLPIISLICNFSK 556

Query: 504 P---SAKKPALLKHSEITTFFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEF 560
                   P  L+  EI T FHE+GH +H ++G   +   +G      DFVE PS ++E 
Sbjct: 557 SHLFEENGPCFLQLHEIETLFHEMGHAMHSVLGRTRLQNTSGTRCAT-DFVELPSILMEH 615

Query: 561 WTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHVNGALFALRQLTFGLFDMTVHT---C 617
           +  +   + ++S HY + E    +LL + + +      L    Q    + D  +H+    
Sbjct: 616 FAKDVRVMESISSHYISQEPASPELLQTWLHSTDNLQNLELYTQAKMSMLDQILHSNEIF 675

Query: 618 KDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMXXXXXXXXXXXMWAEVFAADM 677
           +D + ++V   +NDL +++ L    D  +     FGH+            ++    A+ +
Sbjct: 676 EDQKDINVVKSYNDLEKKLELF--SDDQSNWCGKFGHLF--GYGASYYSYLFDRAIASKV 731

Query: 678 YHTKFAADPLNGDVGVRYRDIVLSRGG 704
           + + F  +P +   G++++D VL  GG
Sbjct: 732 WESLFKQNPFSRTSGLKFKDSVLRWGG 758

>YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON}
           OCT1Mitochondrial intermediate peptidase, cleaves
           destabilizing N-terminal residues of a subset of
           proteins upon import, after their cleavage by
           mitochondrial processing peptidase (Mas1p-Mas2p); may
           contribute to mitochondrial iron homeostasis
          Length = 772

 Score =  155 bits (391), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 141/549 (25%), Positives = 245/549 (44%), Gaps = 45/549 (8%)

Query: 189 DYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLG-EQKEFVAFTTEELDG--VSASVM 245
           D+ ++G+ +  + R +  +L ++IS    +F  +        V    ++LD   VS  ++
Sbjct: 204 DFEKSGIYMNPDVREKFIQLSQEISLVGQEFINHTDYPGSNSVKIPCKDLDNSKVSTFLL 263

Query: 246 DQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLFLETLR 305
            Q  K  D  G      +F Y     +LK+ +N   RK+ +    +   +        ++
Sbjct: 264 KQLNK--DVKGQNYKVPTFGYA-AYALLKSCENEMVRKKLWTALHSCSDKQVKRLSHLIK 320

Query: 306 LRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSLKEKDC 365
           LR  LA L+  ++YA Y L+ KMAK  + V  F+  L N        E++ +  LK KD 
Sbjct: 321 LRAILANLMHKTSYAEYQLEGKMAKNPKDVQDFILTLMNNTIEKTANELKFIAELKAKDL 380

Query: 366 KE-LAIPFDNHYYI---WDNRYYDNKYLKEN--YNVDEEKISEYFPLEPTIGGMLKIYET 419
           K+ L    D    +   WD  YY  KY + N   + + ++IS YF L   I G+  +++ 
Sbjct: 381 KKPLTTNTDEILKLVRPWDRDYYTGKYFQLNPSNSPNAKEISYYFTLGNVIQGLSDLFQQ 440

Query: 420 VLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAANFG 479
           +  ++ +E    ++ + W  DV++L V     +E    +G IY DL  R+GK  + A+F 
Sbjct: 441 IYGIR-LEPAITDEGETWSPDVRRLNVI----SEEEGIIGIIYCDLFERNGKTSNPAHFT 495

Query: 480 IASSYV----------------RDGARSH-PVTALVCNFSK---PSAKKPALLKHSEITT 519
           +  S                   DG     PV +LVCNFS     S K    L+ SE+ T
Sbjct: 496 VCCSRQIYPSETDFSTIQVGENPDGTYFQLPVISLVCNFSPILIASKKSLCFLQLSEVET 555

Query: 520 FFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGE 579
            FHE+GH +H ++G  H+   +G      DFVE PS ++E +  +   L+ + +HY TGE
Sbjct: 556 LFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTKIGKHYGTGE 614

Query: 580 KIPEQLLDSLIATKHVNGALFALRQLTFGLFDMTVHTCK---DLESLDVTSLWNDLRQEV 636
            I   +L   + + +         Q    + D + H  K   D+++ DV   +  L + +
Sbjct: 615 TIQADMLQRFMKSTNFLQNCETYSQAKMAMLDQSFHDEKIISDIDNFDVVENYQALERRL 674

Query: 637 SLVENGDQVTKGFNSFGHIMXXXXXXXXXXXMWAEVFAADMYHTKFAADPLNGDVGVRYR 696
            ++   D  +     FGH+            ++    A+ +++  F  DP +   G +++
Sbjct: 675 KVLV--DDQSNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSRKNGDKFK 730

Query: 697 DIVLSRGGL 705
             +L  GGL
Sbjct: 731 KHLLKWGGL 739

>KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]
           {ON} similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134C OCT1 Mitochondrial intermediate peptidase
           cleaves N-terminal residues of a subset of proteins upon
           import after their cleavage by mitochondrial processing
           peptidase (Mas1p-Mas2p) may contribute to mitochondrial
           iron homeostasis
          Length = 779

 Score =  141 bits (355), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 142/562 (25%), Positives = 250/562 (44%), Gaps = 67/562 (11%)

Query: 188 KDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGE-QKEFVAFTTEELDG-VSASVM 245
           +D+ ++G+ +  E R +  +L ++IS     F  N    +  ++  + E +D  V+  V 
Sbjct: 205 EDFEKSGIYMKPEIREKFIQLSQEISVIGQDFINNTEYVRSNYIKISCELMDAHVNKMVC 264

Query: 246 DQFEKFTDTDGVEKHKV-SFKY-PDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLFLET 303
            Q +K  D  G E +KV ++ Y P  L  L+T  +   R + +    +          + 
Sbjct: 265 SQMKK--DITG-EYYKVPTYGYIPHTL--LRTCSDEVIRMKIWTEMHSCSDAQIERLTKL 319

Query: 304 LRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSLK-- 361
           + LR ELA LLG   +A Y L  KMAK  E V  FLE L +  +     E++ L  LK  
Sbjct: 320 ISLRVELAKLLGSQNFAQYQLHGKMAKTPENVSGFLESLVHSTRIKAASELKPLAVLKSE 379

Query: 362 ---------EKDCKELAIPFDNHYYIWDNRYYDNKYL---KENYNVDE-EKISEYFPLEP 408
                     ++  EL  P       WD  YY +      + + ++D  E IS  F L  
Sbjct: 380 LTGTQTPHTSEEVLELMKP-------WDRDYYGSIQALAQRRSSSLDNGESISSSFSLGV 432

Query: 409 TIGGMLKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPR 468
            + G+  ++E +  +K V  T  +  + W  DV+++ V  VD  E    +G +Y DL  R
Sbjct: 433 VMQGLSDLFEKIYGIKLVPAT-PKTGETWSPDVRRIDV--VD--EHDGLIGVMYCDLFER 487

Query: 469 DGKYGHAANFGIA-----------SSYVRDGARSH------PVTALVCNF-------SKP 504
           +GK  + A+F +            +S ++ G  S+      PV +LVC+F          
Sbjct: 488 EGKTPNPAHFTVCCSRNMYLNEADTSTIQVGVNSNGQKFQLPVISLVCDFRWVEVNMGDG 547

Query: 505 SAKKPALLKHSEITTFFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWN 564
             ++  LL+ +EI T FHE+GH +H ++G   +   +G      DFVE PS ++E +  +
Sbjct: 548 KHQQMCLLQLNEIETLFHEMGHAMHSMLGRTQLQNVSGTRCAT-DFVELPSILMEHFARD 606

Query: 565 KNELSTLSQHYETGEKIPEQLLDSLIATKHVNGALFALRQLTFGLFDMTVHTCKDLE--S 622
              LS++S HY+TG+ +  ++L +               Q+     D  +H        S
Sbjct: 607 TRVLSSISSHYKTGKSLDVEVLKNHQLENQFLQNCETFSQIKMSFLDQELHNLDHTTDGS 666

Query: 623 LDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMXXXXXXXXXXXMWAEVFAADMYHTKF 682
           +DV ++++ L + ++++   D  +     FGH+            ++    A+ ++   F
Sbjct: 667 IDVIAIYHRLERRLAVLP--DDQSNWCGKFGHLF--GYGASYYSYLFDRAIASKIWDHLF 722

Query: 683 AADPLNGDVGVRYRDIVLSRGG 704
             DP N   G ++++ +L  GG
Sbjct: 723 EQDPFNRTNGTKFKEGLLQWGG 744

>ADR312W Chr4 (1253622..1255604) [1983 bp, 660 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL060C (AMI3)
          Length = 660

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 2/66 (3%)

Query: 351 VKEIEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPT- 409
           V  I A+  LK+K  +E+  P +N + I  +R  D K ++E +N    +I  Y P +PT 
Sbjct: 224 VTIISAVLDLKDKQVQEIMTPIENVFTISADRILDEKVVEEIFNSGFSRIPIYLPGQPTN 283

Query: 410 -IGGML 414
            IG +L
Sbjct: 284 FIGMLL 289

>TDEL0D04550 Chr4 (833759..835612) [1854 bp, 617 aa] {ON} Anc_3.168
           YOL060C
          Length = 617

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 351 VKEIEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPT- 409
           V  I A+  LKEK  KE+  P +N + I  +   D K++ E ++    +I  Y P EPT 
Sbjct: 227 VTIISAVLDLKEKKVKEIMTPIENVFTISADTVLDEKHVAEIFDSGFSRIPIYLPNEPTN 286

Query: 410 -IGGML 414
            IG +L
Sbjct: 287 FIGMLL 292

>Ecym_5242 Chr5 complement(498331..500598) [2268 bp, 755 aa] {ON}
           similar to Ashbya gossypii ADR312W
          Length = 755

 Score = 39.7 bits (91), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 2/66 (3%)

Query: 351 VKEIEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPT- 409
           V  I A+  LK+K  +E+  P +N + I  ++  D K ++E +N    ++  Y P +PT 
Sbjct: 252 VTIISAVLDLKDKQVQEIMTPIENVFTISADKILDEKAVEELFNSGFSRVPIYLPGQPTN 311

Query: 410 -IGGML 414
            IG +L
Sbjct: 312 FIGMLL 317

>SAKL0C07480g Chr3 complement(690119..692374) [2256 bp, 751 aa] {ON}
           similar to uniprot|Q12296 Saccharomyces cerevisiae
           YOL060C
          Length = 751

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query: 351 VKEIEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPT- 409
           V  I A+  LKEK   E+  P +N + +  +   D   ++E +N    +I  Y P EPT 
Sbjct: 252 VTIISAVLDLKEKRVSEIMTPIENVFTMSADSVLDKPTVEEIFNAGFSRIPIYLPGEPTN 311

Query: 410 -IGGML 414
            IG +L
Sbjct: 312 FIGMLL 317

>KLLA0C03960g Chr3 complement(361124..363154) [2031 bp, 676 aa] {ON}
           similar to uniprot|Q12296 Saccharomyces cerevisiae
           YOL060C ,
          Length = 676

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 351 VKEIEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPT- 409
           V  I A+  LKEK   E+  P D  + +  ++  D K +++ +N    +I  Y P +PT 
Sbjct: 223 VTIISAVLDLKEKKVSEIMTPIDAVFTLSADKILDEKTVEDIFNSGFSRIPIYLPGQPTN 282

Query: 410 -IGGML 414
            IG +L
Sbjct: 283 YIGMLL 288

>CAGL0C05159g Chr3 (492512..494419) [1908 bp, 635 aa] {ON} highly
           similar to uniprot|Q12296 Saccharomyces cerevisiae
           YOL060c AMI3
          Length = 635

 Score = 35.8 bits (81), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 351 VKEIEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEP-T 409
           V  I A+  LK+K  KE+  P +N + +  ++  D K ++E +N    +I  + P EP  
Sbjct: 222 VTIISAVLDLKDKKVKEIMTPIENVFTLSADKILDEKTIEEIFNSGFSRIPIHLPNEPMN 281

Query: 410 IGGMLKI 416
             GML +
Sbjct: 282 FIGMLIV 288

>NDAI0G02940 Chr7 complement(680031..682148) [2118 bp, 705 aa] {ON}
           Anc_3.168 YOL060C
          Length = 705

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query: 351 VKEIEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPT- 409
           V  I A+  LKEK  KE+  P +N + +      D+K ++  +N    +I  Y P EP  
Sbjct: 240 VTIISAVLDLKEKSVKEIMTPIENVFTMSAATILDDKTVELIFNSGFSRIPIYLPNEPNN 299

Query: 410 -IGGML 414
            IG +L
Sbjct: 300 FIGMLL 305

>Smik_4.586 Chr4 (1043554..1046649) [3096 bp, 1031 aa] {ON} YDR325W
           (REAL)
          Length = 1031

 Score = 35.0 bits (79), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 49/117 (41%), Gaps = 19/117 (16%)

Query: 183 VEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSL--QFSKNLGEQKEFVAFTTEELDGV 240
           V K   D +R  LN   E+ NE    Q K  NN+   Q+S  LGE            + V
Sbjct: 885 VSKNALDKLRKNLNAVLEEINERSGTQTKDENNTTNDQYSSILGES----------FNKV 934

Query: 241 SASVMDQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNE 297
           S   MD     T+ DG E  K + K   +L V    +   +RKR     +++  QNE
Sbjct: 935 SNDTMDHASNITNEDGTESVKTTVK---VLAVDNAIEQSNSRKRT----RSETEQNE 984

>Ecym_6006 Chr6 (14790..16949) [2160 bp, 719 aa] {ON} similar to
           Saccharomyces cerevisiae YGL249W
          Length = 719

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 35/69 (50%), Gaps = 6/69 (8%)

Query: 2   LILKRANKFCSTTTSLLAIPALAFGAYSLLHSTNRTLRIPKSNYSTMSATMSATLVPPQA 61
           LI KR +K  ST  S + IP++     +  H  N T+R   SN S  S T +  L     
Sbjct: 451 LIEKRRSKSQSTPNSTINIPSMELLGITTNHKENETVR---SNVSLSSPTKNRRL---DK 504

Query: 62  APSWKYSPE 70
           APS +Y+PE
Sbjct: 505 APSIEYNPE 513

>SAKL0G15290g Chr7 complement(1316851..1319097) [2247 bp, 748 aa]
           {ON} some similarities with uniprot|P32900 Saccharomyces
           cerevisiae YHR149C SKG6 Protein of unknown function
           found in the bud tip and bud neck potential Cdc28p
           substrate
          Length = 748

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%)

Query: 542 GPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIAT 592
           G G TP++ ++ P       T+  ++ ST+SQ   TG+ +P  L  S++ T
Sbjct: 611 GNGNTPFNPIDHPHMFYNQNTFTDDQQSTVSQQTVTGQVLPHHLRQSIVMT 661

>NCAS0A08040 Chr1 (1586844..1589222) [2379 bp, 792 aa] {ON}
           Anc_5.618
          Length = 792

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 10/81 (12%)

Query: 138 ATELLQDFEIEASLRHDLFVQFDKVWQACK---DDAKFKKEHFELYKF-VEKCHK--DYV 191
           + E  +D E E +L++D   +  K+W+A K   +  K  K   E  +  +EKC +  DY 
Sbjct: 353 SVERREDLEKELNLKNDELSRLTKIWEAEKAEIESIKTAKADLERARIELEKCQREGDYT 412

Query: 192 RAGLNLPEEKRNEVKELQKKI 212
           +A     E + + + EL++K+
Sbjct: 413 KAS----ELRYSRIPELERKV 429

>Suva_2.451 Chr2 (796994..799627) [2634 bp, 877 aa] {ON} YDR285W
           (REAL)
          Length = 877

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 47/88 (53%), Gaps = 5/88 (5%)

Query: 265 KYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLFLETLRLRDELAGLLGYSTYANYNL 324
           +Y D+L  L+ AKN E   + FG +Q+ + +NE L  E  + +D+L  +   +T    N 
Sbjct: 531 QYEDLLKKLE-AKNIEI-SQIFGKEQSLIEKNESLSNELKKAQDQLDKITNLNTTTKSNY 588

Query: 325 DIKMAKKQETVLAFLED---LKNKLKPL 349
           + K++ + E V A   +   LK +++ L
Sbjct: 589 ENKISSQNEIVKALTSENDTLKQRIQQL 616

>NCAS0G01170 Chr7 complement(208047..212561) [4515 bp, 1504 aa] {ON}
            Anc_6.269
          Length = 1504

 Score = 32.0 bits (71), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 83/192 (43%), Gaps = 32/192 (16%)

Query: 84   SALHDALAGVENPTVESLVKPFLEHENTTQPLINQLTFLQHVSADKEVRDASTKATELLQ 143
            S L+D L    +P  E+  + F++    + P+I     LQ +   +E+  +S K   L +
Sbjct: 1224 SNLYDLLMTEVSPVEEAAFQNFVQ----SNPIIAADPMLQQM---RELNYSSLKEITLKK 1276

Query: 144  DFEIEASLRHDLFVQFDKVWQACKDDA--KFKKEHFELYKFVEKCHKDYVRAGLNLPEEK 201
              E+EAS    + +  D   Q   +D     K  ++ L         DYV   L + +E 
Sbjct: 1277 IQELEAS---GIIISSDNKLQNILNDIANTIKNPNYAL---------DYVTEELRVTKET 1324

Query: 202  RNEVKELQKKISNNSLQFS-------KNLGEQKEFVAFTTEELDGVSASVMDQFEKFTDT 254
             NE+ ++  K+ N+S Q         +++   K F A +   L  + ++    ++K    
Sbjct: 1325 LNEINKINGKLVNSSRQLHMTIDKTIQDIQAAKSFEAPSKSTLGNIKSA----YKKVHHK 1380

Query: 255  DGVEKHKVSFKY 266
            +G+E   + FK+
Sbjct: 1381 NGIELQGLKFKW 1392

>Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {ON}
           YHR178W (STB5) - Zinc finger (6-Cys) [contig 1] FULL
          Length = 692

 Score = 31.6 bits (70), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 12/45 (26%), Positives = 24/45 (53%)

Query: 93  VENPTVESLVKPFLEHENTTQPLINQLTFLQHVSADKEVRDASTK 137
           +E P  +  +  + +H + + PLIN++ FL  VS  ++  +   K
Sbjct: 249 IERPLYDRFIAAYFKHNHRSYPLINKIEFLNKVSTIRQFEEMEDK 293

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 81,689,099
Number of extensions: 3803334
Number of successful extensions: 13729
Number of sequences better than 10.0: 133
Number of HSP's gapped: 14120
Number of HSP's successfully gapped: 136
Length of query: 732
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 615
Effective length of database: 40,065,477
Effective search space: 24640268355
Effective search space used: 24640268355
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)