Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0C00528g1.8ON1101105748e-78
KLTH0F00550g1.8ON82823767e-48
AFR743W1.8ON82823628e-46
Ecym_10101.8ON82823471e-43
Kwal_33.130161.8ON82823445e-43
ZYRO0F18414g1.8ON87763445e-43
KLLA0C00550g1.8ON82823306e-41
Kpol_2002.111.8ON86783316e-41
TPHA0E039801.8ON86843221e-39
TBLA0A049601.8ON96693125e-38
CAGL0B00396g1.8ON88713125e-38
NCAS0B090801.8ON93863064e-37
YCL057C-A (MOS1)1.8ON97943031e-36
Smik_3.171.8ON97942978e-36
Skud_3.61.8ON97942971e-35
Suva_3.1551.8ON97942952e-35
TDEL0C069401.8ON86862891e-34
NDAI0A001701.8ON96932631e-30
KNAG0C002501.8ON94732525e-29
KAFR0D001701.8ON90882491e-28
Kwal_47.167334.378ON33950623.1
YJR142W4.378ON34242623.6
SAKL0H19646g8.163ON155125623.7
ZYRO0E04686g1.401ON26652613.8
Skud_10.3664.378ON34242614.5
Smik_10.4364.378ON34242614.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0C00528g
         (110 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}...   225   8e-78
KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON} ...   149   7e-48
AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic ho...   144   8e-46
Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON} sim...   138   1e-43
Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON} ...   137   5e-43
ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} simila...   137   5e-43
KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON} ...   131   6e-41
Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}...   132   6e-41
TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8 Y...   128   1e-39
TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa] {O...   124   5e-38
CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON} ...   124   5e-38
NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8...   122   4e-37
YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}  MO...   121   1e-36
Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON} YCL...   119   8e-36
Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON} YCL0...   119   1e-35
Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON} ...   118   2e-35
TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8...   115   1e-34
NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON} A...   105   1e-30
KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON} A...   101   5e-29
KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON} A...   100   1e-28
Kwal_47.16733 s47 (87799..88818) [1020 bp, 339 aa] {ON} YJR142W ...    28   3.1  
YJR142W Chr10 (697141..698169) [1029 bp, 342 aa] {ON} Putative p...    28   3.6  
SAKL0H19646g Chr8 complement(1731049..1735704) [4656 bp, 1551 aa...    28   3.7  
ZYRO0E04686g Chr5 (353639..354439) [801 bp, 266 aa] {ON} similar...    28   3.8  
Skud_10.366 Chr10 (655704..656732) [1029 bp, 342 aa] {ON} YJR142...    28   4.5  
Smik_10.436 Chr10 (686200..687228) [1029 bp, 342 aa] {ON} YJR142...    28   4.9  

>SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}
           similar to uniprot|Q96VH5 Saccharomyces cerevisiae
           YCL057C-A
          Length = 110

 Score =  225 bits (574), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 110/110 (100%), Positives = 110/110 (100%)

Query: 1   MRSQELSKEQVRGTHYHQEQRNQFSRYTMSEQLQVSKPNKSILNDKWDVVLSNVVVKTGL 60
           MRSQELSKEQVRGTHYHQEQRNQFSRYTMSEQLQVSKPNKSILNDKWDVVLSNVVVKTGL
Sbjct: 1   MRSQELSKEQVRGTHYHQEQRNQFSRYTMSEQLQVSKPNKSILNDKWDVVLSNVVVKTGL 60

Query: 61  GFGAGIVASVLLFKRRAFPVWLGVGFGLGRGYAEGDAIFRSSAGLRTVNA 110
           GFGAGIVASVLLFKRRAFPVWLGVGFGLGRGYAEGDAIFRSSAGLRTVNA
Sbjct: 61  GFGAGIVASVLLFKRRAFPVWLGVGFGLGRGYAEGDAIFRSSAGLRTVNA 110

>KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON}
           similar to uniprot|Q96VH5 Saccharomyces cerevisiae
           YCL057C-A
          Length = 82

 Score =  149 bits (376), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 72/82 (87%), Positives = 79/82 (96%)

Query: 29  MSEQLQVSKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVWLGVGFGL 88
           MSEQL+VS  ++S+LNDKWDVVLSN+VVKTGLGFGAG+VASVLLFKRRAFPVW+GVGFGL
Sbjct: 1   MSEQLKVSPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGL 60

Query: 89  GRGYAEGDAIFRSSAGLRTVNA 110
           GRGYAEGDAIFRSSAGLRTV A
Sbjct: 61  GRGYAEGDAIFRSSAGLRTVKA 82

>AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL057C-A
          Length = 82

 Score =  144 bits (362), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 75/82 (91%)

Query: 29  MSEQLQVSKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVWLGVGFGL 88
           MS QL+VS P++SILNDKWDVVLSN+VVKTGLGFGAG+ ASVL FKRRAFPVWLGVGFGL
Sbjct: 1   MSGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGL 60

Query: 89  GRGYAEGDAIFRSSAGLRTVNA 110
           GRGYAEGDAIFRS AGLR V A
Sbjct: 61  GRGYAEGDAIFRSHAGLRAVRA 82

>Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON}
           similar to Ashbya gossypii AFR743W
          Length = 82

 Score =  138 bits (347), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 74/82 (90%)

Query: 29  MSEQLQVSKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVWLGVGFGL 88
           M E+L+V+ P++SILNDKWDVVLSN+VVK GLGF  G++ASVL FKRRAFPVWLG+GFGL
Sbjct: 1   MGEKLEVAAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGL 60

Query: 89  GRGYAEGDAIFRSSAGLRTVNA 110
           GRGYAEGDAIFRS AGLRT+ A
Sbjct: 61  GRGYAEGDAIFRSHAGLRTMKA 82

>Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON}
           YCL057C-A - Hypothetical ORF, has similarity to proteins
           in S. pombe, C. elegans, D. melanogaster. [contig 123]
           FULL
          Length = 82

 Score =  137 bits (344), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 76/82 (92%)

Query: 29  MSEQLQVSKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVWLGVGFGL 88
           MS+Q +++  ++S+LNDKWDVVLSN+VVK GLGFGAG+VASVLLFKRRA PVW+GVGFGL
Sbjct: 1   MSDQAKIAPVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGL 60

Query: 89  GRGYAEGDAIFRSSAGLRTVNA 110
           GRGY+EGDAIFRSSAGLRTV A
Sbjct: 61  GRGYSEGDAIFRSSAGLRTVKA 82

>ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} similar
           to uniprot|Q96VH5 Saccharomyces cerevisiae YCL057C-A
          Length = 87

 Score =  137 bits (344), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 72/76 (94%)

Query: 35  VSKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVWLGVGFGLGRGYAE 94
           V+ PNKSILNDKWDVVLSN++VK+GLGFG G+VASVL+FKRRAFPVWLG+GFGLGRGYAE
Sbjct: 12  VTAPNKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAE 71

Query: 95  GDAIFRSSAGLRTVNA 110
           GDAIFRS+AGLRT  A
Sbjct: 72  GDAIFRSAAGLRTSKA 87

>KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON}
           similar to uniprot|Q96VH5 Saccharomyces cerevisiae
           YCL057C-A
          Length = 82

 Score =  131 bits (330), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 71/82 (86%)

Query: 29  MSEQLQVSKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVWLGVGFGL 88
           MSEQ+Q +K   SIL+ +WDVVLSNVV KT LG G GIVASVL FKRRAFPVW+GVGFGL
Sbjct: 1   MSEQVQTTKAVPSILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGL 60

Query: 89  GRGYAEGDAIFRSSAGLRTVNA 110
           GRGYAEGDAIFR++AGLR VNA
Sbjct: 61  GRGYAEGDAIFRTNAGLRKVNA 82

>Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}
           complement(19864..20124) [261 nt, 87 aa]
          Length = 86

 Score =  132 bits (331), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 73/78 (93%), Gaps = 1/78 (1%)

Query: 30  SEQLQV-SKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVWLGVGFGL 88
           S++LQ+ S P +SILNDKWDVVLSN +VKT LGFGAG++ASV+LFKRRAFPVWLG+GFG+
Sbjct: 5   SQELQITSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGIGFGI 64

Query: 89  GRGYAEGDAIFRSSAGLR 106
           GRGY+EGDAIFRS+AGLR
Sbjct: 65  GRGYSEGDAIFRSAAGLR 82

>TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8
           YCL057C-A
          Length = 86

 Score =  128 bits (322), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 62/84 (73%), Positives = 75/84 (89%), Gaps = 6/84 (7%)

Query: 29  MSEQ-----LQVSKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVWLG 83
           MSEQ     L+++ P KSILNDKWDVVLSN++VKTGLGFG G+V S+LLFKRRAFPVWLG
Sbjct: 1   MSEQKNNNNLELTSP-KSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLG 59

Query: 84  VGFGLGRGYAEGDAIFRSSAGLRT 107
           +GFG+GRGY++GDAIFRS+AGLR+
Sbjct: 60  IGFGVGRGYSDGDAIFRSAAGLRS 83

>TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa] {ON}
           Anc_1.8 YCL057C-A
          Length = 96

 Score =  124 bits (312), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 55/69 (79%), Positives = 66/69 (95%)

Query: 39  NKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVWLGVGFGLGRGYAEGDAI 98
           N+SILNDKWD+V+SN++VKT  GFGAG++ASV+ FKRRAFPVWLGVGFGLGRGY+EGDAI
Sbjct: 25  NRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGDAI 84

Query: 99  FRSSAGLRT 107
           FRS+AGLR+
Sbjct: 85  FRSTAGLRS 93

>CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON}
           highly similar to uniprot|Q96VH5 Saccharomyces
           cerevisiae YCL057ca
          Length = 88

 Score =  124 bits (312), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 65/71 (91%)

Query: 38  PNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVWLGVGFGLGRGYAEGDA 97
           P +SILNDKWDVVLSN++VK GLGFG G+V SVL FKRR+FPVWLGVGFG GRGY+EGDA
Sbjct: 16  PVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGAGRGYSEGDA 75

Query: 98  IFRSSAGLRTV 108
           IFRS+AGLR+V
Sbjct: 76  IFRSTAGLRSV 86

>NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8
           YCL057C-A
          Length = 93

 Score =  122 bits (306), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%)

Query: 22  NQFSRYTMSEQLQVSKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVW 81
           N  ++ T +        ++SILNDKWDVVLSN++VK GLGF  G+VASV+ FKRR FPVW
Sbjct: 5   NNPNQSTPTSTAVTPTIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVW 64

Query: 82  LGVGFGLGRGYAEGDAIFRSSAGLRT 107
           LG+GFG+GRGYAEGDAIFRS AGLRT
Sbjct: 65  LGIGFGVGRGYAEGDAIFRSPAGLRT 90

>YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}
           MOS1Mitochondrial protein essential for proper inner
           membrane organization; conserved component of the
           mitochondrial inner membrane organizing system (MICOS,
           MINOS, or MitOS), a scaffold-like structure on the
           intermembrane space side of the inner membrane which has
           a role in the maintenance of crista junctions and inner
           membrane architecture; ortholog of human MINOS1
          Length = 97

 Score =  121 bits (303), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 59/94 (62%), Positives = 69/94 (73%), Gaps = 15/94 (15%)

Query: 29  MSEQLQVSKPNKS---------------ILNDKWDVVLSNVVVKTGLGFGAGIVASVLLF 73
           MSEQ Q  +P KS               IL+ KWD+VLSN++VKT +GFG G+  SVL F
Sbjct: 1   MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60

Query: 74  KRRAFPVWLGVGFGLGRGYAEGDAIFRSSAGLRT 107
           KRRAFPVWLG+GFG+GRGYAEGDAIFRSSAGLR+
Sbjct: 61  KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRS 94

>Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON}
           YCL057C-A (REAL)
          Length = 97

 Score =  119 bits (297), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 57/94 (60%), Positives = 69/94 (73%), Gaps = 15/94 (15%)

Query: 29  MSEQLQVSKPNK---------------SILNDKWDVVLSNVVVKTGLGFGAGIVASVLLF 73
           MSEQ Q  +P K               ++L+ KWD+VLSN++VKT +GFG G+  SVL F
Sbjct: 1   MSEQAQAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60

Query: 74  KRRAFPVWLGVGFGLGRGYAEGDAIFRSSAGLRT 107
           KRRAFPVWLG+GFG+GRGYAEGDAIFRSSAGLR+
Sbjct: 61  KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRS 94

>Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON}
           YCL057C-A (REAL)
          Length = 97

 Score =  119 bits (297), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 57/94 (60%), Positives = 70/94 (74%), Gaps = 15/94 (15%)

Query: 29  MSEQLQVSKPNKS---------------ILNDKWDVVLSNVVVKTGLGFGAGIVASVLLF 73
           MSEQ ++ +P KS               IL+ KWD+V+SN++VKT +GFG G+  SVL F
Sbjct: 1   MSEQAKLQEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFF 60

Query: 74  KRRAFPVWLGVGFGLGRGYAEGDAIFRSSAGLRT 107
           KRRAFPVWLG+GFG+GRGYAEGDAIFRSSAGLR+
Sbjct: 61  KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRS 94

>Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON}
           YCL057C-A (REAL)
          Length = 97

 Score =  118 bits (295), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 57/94 (60%), Positives = 67/94 (71%), Gaps = 15/94 (15%)

Query: 29  MSEQLQVSKPNKS---------------ILNDKWDVVLSNVVVKTGLGFGAGIVASVLLF 73
           MSEQ Q   P KS               +L+ KWD+VLSN++VKT +GFG G+  SVL F
Sbjct: 1   MSEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFF 60

Query: 74  KRRAFPVWLGVGFGLGRGYAEGDAIFRSSAGLRT 107
           KRRAFP WLG+GFG+GRGYAEGDAIFRSSAGLR+
Sbjct: 61  KRRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRS 94

>TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8
           YCL057C-A
          Length = 86

 Score =  115 bits (289), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 77/86 (89%), Gaps = 4/86 (4%)

Query: 29  MSE----QLQVSKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVWLGV 84
           MSE    QLQV+ P++SILNDKWDVVLSN++VKTGLGFG G+V SVL FKRRAFPVWLG+
Sbjct: 1   MSEKSQAQLQVAAPSRSILNDKWDVVLSNMLVKTGLGFGVGVVGSVLFFKRRAFPVWLGI 60

Query: 85  GFGLGRGYAEGDAIFRSSAGLRTVNA 110
           GFGLGRGYAEGDAIFRS+AGLR+V A
Sbjct: 61  GFGLGRGYAEGDAIFRSAAGLRSVKA 86

>NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON}
           Anc_1.8 YCL057C-A
          Length = 96

 Score =  105 bits (263), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%)

Query: 17  HQEQRNQFSRYTMSEQLQVSKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRR 76
            Q  + +        Q Q++  +KSILNDKWD+VLSN +VK GLGFG G+V SV+ FKRR
Sbjct: 3   EQVNKTEHQNAVAPPQQQLATIDKSILNDKWDIVLSNTLVKVGLGFGVGVVTSVIFFKRR 62

Query: 77  AFPVWLGVGFGLGRGYAEGDAIFRSSAGLRTVN 109
            FPVWLG+GFG GRGYAEGDAIFRSSAG+R+VN
Sbjct: 63  TFPVWLGIGFGAGRGYAEGDAIFRSSAGIRSVN 95

>KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON}
           Anc_1.8 YCL057C-A
          Length = 94

 Score =  101 bits (252), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 54/73 (73%), Positives = 69/73 (94%)

Query: 36  SKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVWLGVGFGLGRGYAEG 95
           +K ++S+LNDKWDVVLSN++VK G+GFG G+V SVLLF+RRAFPVWLG+GFG+GRGY+EG
Sbjct: 20  TKIDRSLLNDKWDVVLSNMLVKVGMGFGVGVVTSVLLFRRRAFPVWLGIGFGVGRGYSEG 79

Query: 96  DAIFRSSAGLRTV 108
           DAIFRS++G+RTV
Sbjct: 80  DAIFRSTSGIRTV 92

>KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON}
           Anc_1.8 YCL057C-A
          Length = 90

 Score =  100 bits (249), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 58/88 (65%), Positives = 72/88 (81%), Gaps = 8/88 (9%)

Query: 29  MSEQLQVSKP--------NKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPV 80
           MSE+ +V KP        ++SILNDKWD+VLSN++VK GLGFG G+V SV+ FKRRAFPV
Sbjct: 1   MSEEDKVGKPAEYSNNSIDRSILNDKWDLVLSNMLVKVGLGFGVGVVTSVIFFKRRAFPV 60

Query: 81  WLGVGFGLGRGYAEGDAIFRSSAGLRTV 108
           WLG+G+G GR Y+EGDAIFRS+AGLR+V
Sbjct: 61  WLGIGYGFGRAYSEGDAIFRSNAGLRSV 88

>Kwal_47.16733 s47 (87799..88818) [1020 bp, 339 aa] {ON} YJR142W -
           Hypothetical ORF [contig 376] FULL
          Length = 339

 Score = 28.5 bits (62), Expect = 3.1,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 22  NQFSRYTMSEQLQVSKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVL 71
           N F R  ++ ++++  P +S     W ++  N++   GLG  +GI  +V+
Sbjct: 158 NGFVRDQLTGEIKIWVPRRSATKPTWPLMFDNIIAG-GLGHPSGIYETVI 206

>YJR142W Chr10 (697141..698169) [1029 bp, 342 aa] {ON} Putative
           protein of unknown function; GST fusion protein is a
           Dbf2-Mob1 phosphoylation target in a proteome chip
           analysis; synthetic lethal with PH085 deletion; plays a
           role in restricting Ty1 transposition
          Length = 342

 Score = 28.5 bits (62), Expect = 3.6,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 30  SEQLQVSKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVL 71
           S+++Q   P +S     W ++L N++   GLG+  GI  +VL
Sbjct: 169 SKKVQFWVPRRSKTKQTWPLMLDNIIAG-GLGYPYGIYETVL 209

>SAKL0H19646g Chr8 complement(1731049..1735704) [4656 bp, 1551 aa]
            {ON} similar to uniprot|P32319 Saccharomyces cerevisiae
            YBL017C PEP1 Type I transmembrane sorting receptor for
            multiple vacuolar hydrolases cycles between the
            late-Golgi and prevacuolar endosome-like compartments
          Length = 1551

 Score = 28.5 bits (62), Expect = 3.7,   Method: Composition-based stats.
 Identities = 11/25 (44%), Positives = 20/25 (80%)

Query: 53   NVVVKTGLGFGAGIVASVLLFKRRA 77
            N +VK+G+ F +G+ A++ LFKR++
Sbjct: 1430 NSIVKSGVIFVSGVFAALQLFKRKS 1454

>ZYRO0E04686g Chr5 (353639..354439) [801 bp, 266 aa] {ON} similar
          to uniprot|P40693 Saccharomyces cerevisiae YNL002C
          Length = 266

 Score = 28.1 bits (61), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 9/52 (17%)

Query: 6  LSKEQVRGTHYHQEQRNQFSR---------YTMSEQLQVSKPNKSILNDKWD 48
          L+K+Q+ G   H+E++N+F R          T  E+ +V + NKS+ N   D
Sbjct: 21 LAKQQLAGQRKHREKKNRFVRAESIVAKTLATQREKERVKRINKSVKNHHGD 72

>Skud_10.366 Chr10 (655704..656732) [1029 bp, 342 aa] {ON} YJR142W
           (REAL)
          Length = 342

 Score = 28.1 bits (61), Expect = 4.5,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 30  SEQLQVSKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVL 71
           S+++Q   P +S     W ++L N++   GLG+  GI  +VL
Sbjct: 169 SKRIQFWIPRRSETKQTWPLMLDNIIAG-GLGYPYGIYETVL 209

>Smik_10.436 Chr10 (686200..687228) [1029 bp, 342 aa] {ON} YJR142W
           (REAL)
          Length = 342

 Score = 28.1 bits (61), Expect = 4.9,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 30  SEQLQVSKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVL 71
           S+++Q   P +S     W ++L N++   G+G+  GI  +VL
Sbjct: 169 SKKIQFWVPRRSATKQTWPLMLDNIIAG-GVGYPYGIYETVL 209

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,244,665
Number of extensions: 363245
Number of successful extensions: 1380
Number of sequences better than 10.0: 32
Number of HSP's gapped: 1380
Number of HSP's successfully gapped: 32
Length of query: 110
Length of database: 53,481,399
Length adjustment: 80
Effective length of query: 30
Effective length of database: 44,308,119
Effective search space: 1329243570
Effective search space used: 1329243570
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)