Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0C00506g1.7ON1051053579e-45
Kwal_YGOB_YCL058W-A1.7ON105791181e-08
Kwal_33.13015singletonOFF105791181e-08
TBLA0A049501.7ON113781163e-08
KLTH0F00528g1.7ON104781111e-07
Skud_3.51.7ON113801093e-07
Smik_3.161.7ON113801023e-06
TPHA0E039901.7ON11679962e-05
Suva_3.1541.7ON11383963e-05
Kpol_2002.101.7ON11182954e-05
ZYRO0F18436g1.7ON11229921e-04
YCL058W-A (ADF1)1.7ON11382902e-04
KNAG0C002401.7ON12626830.002
KAFR0D001601.7ON11129820.003
CAGL0B00374g1.7ON12128780.011
NDAI0A001601.7ON12327770.016
NCAS0B090901.7ON11982760.023
KLLA0C00528g1.7ON11679700.14
TDEL0C069501.7ON11180641.1
NOTE: 1 genes in the same pillar as SAKL0C00506g were not hit in these BLAST results
LIST: AFR743CA

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0C00506g
         (105 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly si...   142   9e-45
Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON} ANN...    50   1e-08
Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig ...    50   1e-08
TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1....    49   3e-08
KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved...    47   1e-07
Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)    47   3e-07
Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A (R...    44   3e-06
TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON...    42   2e-05
Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A...    42   3e-05
Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON} (19162.....    41   4e-05
ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa] ...    40   1e-04
YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}  ADF1Transcr...    39   2e-04
KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7 YC...    37   0.002
KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7 YC...    36   0.003
CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar t...    35   0.011
NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7 YC...    34   0.016
NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {...    34   0.023
KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no simila...    32   0.14 
TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {...    29   1.1  

>SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly
           similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 105

 Score =  142 bits (357), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 76/105 (72%)

Query: 1   MAKPLSKTKKDNXXXXXXXXXXXXXXXRTRIQVEQLNKQEFLLSDLNMTNAGSTKTKEKP 60
           MAKPLSKTKKDN               RTRIQVEQLNKQEFLLSDLNMTNAGSTKTKEKP
Sbjct: 1   MAKPLSKTKKDNGSKKPSGGIKKSQKKRTRIQVEQLNKQEFLLSDLNMTNAGSTKTKEKP 60

Query: 61  KTXXXXXXXXXXXXXXETRDKLEKQRKDTNDNMLAQLEMISGFSL 105
           KT              ETRDKLEKQRKDTNDNMLAQLEMISGFSL
Sbjct: 61  KTLQAKALAQDQKKDKETRDKLEKQRKDTNDNMLAQLEMISGFSL 105

>Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 105

 Score = 50.1 bits (118), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 47/79 (59%), Gaps = 3/79 (3%)

Query: 28  RTRIQVEQLNKQEFLLSDLNMTNAGSTKTKEKP-KTXXXXXXXXXXXXXXETRDKLEKQR 86
           RT+++VEQ NK+ FL+S+LN      TK +  P ++                + +LE QR
Sbjct: 29  RTKLKVEQANKEVFLISELNKRE--DTKRQSSPLESLKPSRLVKDIKKDQNAQKQLESQR 86

Query: 87  KDTNDNMLAQLEMISGFSL 105
           K T++N+L QLE+ISGFSL
Sbjct: 87  KATDENVLRQLELISGFSL 105

>Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig
           123] FULL
          Length = 105

 Score = 50.1 bits (118), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 47/79 (59%), Gaps = 3/79 (3%)

Query: 28  RTRIQVEQLNKQEFLLSDLNMTNAGSTKTKEKP-KTXXXXXXXXXXXXXXETRDKLEKQR 86
           RT+++VEQ NK+ FL+S+LN      TK +  P ++                + +LE QR
Sbjct: 29  RTKLKVEQANKEVFLISELNKRE--DTKRQSSPLESLKPSRLVKDIKKDQNAQKQLESQR 86

Query: 87  KDTNDNMLAQLEMISGFSL 105
           K T++N+L QLE+ISGFSL
Sbjct: 87  KATDENVLRQLELISGFSL 105

>TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 113

 Score = 49.3 bits (116), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 45/78 (57%)

Query: 28  RTRIQVEQLNKQEFLLSDLNMTNAGSTKTKEKPKTXXXXXXXXXXXXXXETRDKLEKQRK 87
           R ++QVE++NKQ+ LLSD+   N  S +  +   T                  +++ ++K
Sbjct: 36  RAKLQVEKMNKQDSLLSDIINLNGKSKELAKNVNTLSSKQLKKDQEKDRLLNVEIKNKKK 95

Query: 88  DTNDNMLAQLEMISGFSL 105
            TND+++AQ+EMISGFSL
Sbjct: 96  QTNDDLIAQIEMISGFSL 113

>KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score = 47.4 bits (111), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 28  RTRIQVEQLNKQEFLLSDLNMTNAGSTKTKEKPKTXXXXXXXXXXXXXXETRDKLEKQRK 87
           RT+++VEQ NK+ FL+S+LN     +TK     ++                + K+E+Q++
Sbjct: 28  RTKLKVEQANKESFLISELN-EREHNTKRTPALESLKVSDLIEDREKDKSMQKKMEEQKQ 86

Query: 88  DTNDNMLAQLEMISGFSL 105
            T++N++ QLE+ISGFSL
Sbjct: 87  STDNNIIEQLELISGFSL 104

>Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)
          Length = 113

 Score = 46.6 bits (109), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 46/80 (57%), Gaps = 2/80 (2%)

Query: 28  RTRIQVEQLNKQ-EFLLSDLNMTNAGSTKTKEKPK-TXXXXXXXXXXXXXXETRDKLEKQ 85
           RT++QVE+LNK  E ++  L    A    TK++ K T              + R++++ +
Sbjct: 34  RTKLQVEKLNKSSEIMIPTLLRETATQEPTKKRAKSTLKAEELVKDQAKDCKVREQIQTE 93

Query: 86  RKDTNDNMLAQLEMISGFSL 105
           +  TND+ML Q+EMISGFSL
Sbjct: 94  KSKTNDSMLEQIEMISGFSL 113

>Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 43.9 bits (102), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 28  RTRIQVEQLNKQEFLL--SDLNMTNAGSTKTKEKPKTXXXXXXXXXXXXXXETRDKLEKQ 85
           RT++QVE+LNK   ++  + L  T A     ++   T              + R+ ++ +
Sbjct: 34  RTKLQVEKLNKSSEMMIPTLLRETGAQEPAKRKTESTLKAGDLIKDQEKDSKVREHIQME 93

Query: 86  RKDTNDNMLAQLEMISGFSL 105
           +  TNDNML Q+EMISGFSL
Sbjct: 94  KSKTNDNMLKQIEMISGFSL 113

>TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 116

 Score = 41.6 bits (96), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 2/79 (2%)

Query: 29  TRIQVEQLNKQEFLLSD-LNMTNAGSTKTKEKPKTXXXXXXXXXXX-XXXETRDKLEKQR 86
           T+ +VE+LNK E + SD +N  NA + K +EK  +               +  +K+E ++
Sbjct: 38  TKHKVEKLNKLEVISSDDINALNALNGKKREKQTSVLEAKTLAKDNLKDRQLIEKIESKK 97

Query: 87  KDTNDNMLAQLEMISGFSL 105
           K+TN ++L Q+EM+SGFSL
Sbjct: 98  KETNASLLQQIEMMSGFSL 116

>Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 41.6 bits (96), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 43/83 (51%), Gaps = 8/83 (9%)

Query: 28  RTRIQVEQLNKQE-----FLLSDLNMTNAGSTKTKEKPKTXXXXXXXXXXXXXXETRDKL 82
           RT++QVE+LNK        LL + +  +    KT+    T              + R+ +
Sbjct: 34  RTKLQVERLNKSSETMIPTLLKEASKQDLDKKKTRS---TLEAEELVKDQARDSKVREHI 90

Query: 83  EKQRKDTNDNMLAQLEMISGFSL 105
           E ++  TND+ML Q+EMISGFSL
Sbjct: 91  ETEKSKTNDSMLKQIEMISGFSL 113

>Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON}
           (19162..19497) [336 nt, 112 aa]
          Length = 111

 Score = 41.2 bits (95), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 46/82 (56%), Gaps = 5/82 (6%)

Query: 28  RTRIQVEQLNKQEFLLSDL----NMTNAGSTKTKEKPKTXXXXXXXXXXXXXXETRDKLE 83
           R +I++E++NK+  L SD+    N T  G ++   K +               ET  K+E
Sbjct: 31  RNKIKMEKINKEGILPSDILQLNNETRNGQSEG-NKERALESQKLQQDNVKDRETIAKIE 89

Query: 84  KQRKDTNDNMLAQLEMISGFSL 105
             +K+T+D+ML Q+E+++GFSL
Sbjct: 90  ASKKETDDSMLKQIELMTGFSL 111

>ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa]
           {ON} similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 112

 Score = 40.0 bits (92), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/29 (58%), Positives = 25/29 (86%)

Query: 77  ETRDKLEKQRKDTNDNMLAQLEMISGFSL 105
           +TRDK   ++K+T++N+L Q+EMISGFSL
Sbjct: 84  DTRDKANAKKKETDNNILQQIEMISGFSL 112

>YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}
           ADF1Transcriptional repressor encoded by the antisense
           strand of the FYV5 gene; negatively regulates
           transcription of FYV5 by binding to the promoter on the
           sense strand
          Length = 113

 Score = 39.3 bits (90), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 44/82 (53%), Gaps = 6/82 (7%)

Query: 28  RTRIQVEQLNKQ-EFLLSDLNMTNAGSTKTKEKPK---TXXXXXXXXXXXXXXETRDKLE 83
           RT++QVE+LNK  E ++  L      ST+   K K   T              + R+++ 
Sbjct: 34  RTKLQVEKLNKSSETMIPTL--LREASTQEPAKLKAETTLKAEELIKDQEKDSKVREQIR 91

Query: 84  KQRKDTNDNMLAQLEMISGFSL 105
            ++  TND+ML Q+EMISGFSL
Sbjct: 92  TEKSKTNDSMLKQIEMISGFSL 113

>KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 126

 Score = 36.6 bits (83), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 24/26 (92%)

Query: 80  DKLEKQRKDTNDNMLAQLEMISGFSL 105
           +++ K++K+T+ +MLAQ+EMISGFSL
Sbjct: 101 EQVAKKQKETDQSMLAQIEMISGFSL 126

>KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 111

 Score = 36.2 bits (82), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 22/29 (75%)

Query: 77  ETRDKLEKQRKDTNDNMLAQLEMISGFSL 105
           E +  +E + K+T D+ML Q+EMISGFSL
Sbjct: 83  EVKQNIETKLKETEDSMLKQIEMISGFSL 111

>CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar to
           CA0039|IPF3998 Candida albicans and KLLA0C00528g
           Kluyveromyces lactis
          Length = 121

 Score = 34.7 bits (78), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 21/28 (75%)

Query: 78  TRDKLEKQRKDTNDNMLAQLEMISGFSL 105
            R+ +EK   +TN +ML QLE++SGFSL
Sbjct: 94  VREHIEKINSETNSDMLKQLELMSGFSL 121

>NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 123

 Score = 34.3 bits (77), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 21/27 (77%)

Query: 77  ETRDKLEKQRKDTNDNMLAQLEMISGF 103
           E  ++++ ++K  ND+ML Q+EMISGF
Sbjct: 95  EANNRIQTEKKQVNDDMLRQIEMISGF 121

>NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 119

 Score = 33.9 bits (76), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 4/82 (4%)

Query: 28  RTRIQVEQLNKQEFLLS----DLNMTNAGSTKTKEKPKTXXXXXXXXXXXXXXETRDKLE 83
           + + QVE+LNK+E LL     DL      S K +                   E R+K+ 
Sbjct: 38  KAKHQVEKLNKKENLLPMNVLDLQKKKNLSKKPEPLKSILHARSLLQDQKKDKEIRNKIR 97

Query: 84  KQRKDTNDNMLAQLEMISGFSL 105
            ++K T+D++  Q+EMISGF+ 
Sbjct: 98  AEQKATDDSIEKQIEMISGFTF 119

>KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no
           similarity
          Length = 116

 Score = 31.6 bits (70), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 8/79 (10%)

Query: 30  RIQVEQLNKQEFLLSDLNMTNAGSTKTKEKPKTXXXXXXXXXXXXXXETRD---KLEKQR 86
           ++QV QL+K      DL++ +    K ++KP++              E ++   K +K++
Sbjct: 43  QMQVRQLDK-----LDLSIADIVPNKAQKKPRSSASLEGQKVREHYKEDKEVVKKHDKEK 97

Query: 87  KDTNDNMLAQLEMISGFSL 105
           K T   +  QLE+ISGFSL
Sbjct: 98  KATEKKIEDQLELISGFSL 116

>TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 111

 Score = 29.3 bits (64), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 2/80 (2%)

Query: 28  RTRIQVEQLNKQEFLLSDLNMTNAGST--KTKEKPKTXXXXXXXXXXXXXXETRDKLEKQ 85
           +T+ +VE LN+    LS++   NA +    +  K  T              + R+K + +
Sbjct: 32  KTKFRVENLNRDTASLSEIIKLNASTAVKGSARKANTLENRTLQKDWQKDQKIREKSKAE 91

Query: 86  RKDTNDNMLAQLEMISGFSL 105
           +++  +N+  Q+E ISGFSL
Sbjct: 92  KEEMANNLEKQIEDISGFSL 111

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.122    0.310 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,695,397
Number of extensions: 196765
Number of successful extensions: 336
Number of sequences better than 10.0: 20
Number of HSP's gapped: 326
Number of HSP's successfully gapped: 20
Length of query: 105
Length of database: 53,481,399
Length adjustment: 75
Effective length of query: 30
Effective length of database: 44,881,449
Effective search space: 1346443470
Effective search space used: 1346443470
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 59 (27.3 bits)