Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0C00484g1.6ON33932815050.0
Kwal_33.130111.6ON33431813550.0
NCAS0B091001.6ON32732813420.0
Ecym_10091.6ON33632013410.0
Kpol_2002.91.6ON33832013410.0
CAGL0B00352g1.6ON33733113310.0
Smik_3.151.6ON31631213250.0
NDAI0A001501.6ON31731813240.0
YCL059C (KRR1)1.6ON31631213230.0
KLLA0C00506g1.6ON33031113140.0
KLTH0F00506g1.6ON33231813130.0
Skud_3.41.6ON31631413110.0
Suva_3.1531.6ON31631213070.0
KNAG0C002301.6ON34931412891e-179
TPHA0E040001.6ON31631712831e-178
TDEL0C069601.6ON35031512811e-178
TBLA0A049401.6ON31631712611e-175
ZYRO0F18458g1.6ON31431412401e-172
AFR744W1.6ON34331112431e-172
KAFR0D001501.6ON34427212381e-171
NCAS0A119605.482ON270193950.002
SAKL0G03740g5.482ON266146950.002
ZYRO0D11440g5.482ON269146940.002
Kpol_543.135.482ON268146940.002
Suva_8.1975.482ON274148940.003
TDEL0A034605.482ON272146940.003
Ecym_45525.482ON271146940.003
Kwal_47.188645.482ON271146930.003
KLTH0G02574g5.482ON271146930.004
CAGL0K09460g5.482ON261146910.005
KLLA0C06446g5.482ON274146900.009
Skud_15.3105.482ON276148890.010
AAR002W1.420ON178172870.011
TPHA0J028205.482ON268146890.011
YOR145C (PNO1)5.482ON274148890.012
KAFR0E036005.482ON276146880.015
Smik_15.3265.482ON274148880.015
NDAI0A043105.482ON274146860.029
KNAG0C046105.482ON277176850.031
TBLA0D018905.482ON271146800.16
KAFR0B030308.309ON46754712.3
AGL183C8.309ON50724712.6
KLTH0E14014g8.798ON48699702.9
KLLA0D02398g1.290ON120583695.1
KNAG0G023508.309ON49724685.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0C00484g
         (339 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON...   584   0.0  
Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON...   526   0.0  
NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1....   521   0.0  
Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON} s...   521   0.0  
Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON...   521   0.0  
CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON...   517   0.0  
Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON} YC...   514   0.0  
NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON} ...   514   0.0  
YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}  KRR...   514   0.0  
KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}...   510   0.0  
KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}...   510   0.0  
Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON} YCL...   509   0.0  
Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}...   508   0.0  
KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}...   501   e-179
TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6 ...   498   e-178
TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1...   498   e-178
TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {...   490   e-175
ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highl...   482   e-172
AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic ...   483   e-172
KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}...   481   e-171
NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {...    41   0.002
SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {O...    41   0.002
ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {O...    41   0.002
Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON} ...    41   0.002
Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}...    41   0.003
TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON...    41   0.003
Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar ...    41   0.003
Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR14...    40   0.003
KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {O...    40   0.004
CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {...    40   0.005
KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {O...    39   0.009
Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {O...    39   0.010
AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic hom...    38   0.011
TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {O...    39   0.011
YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}  ...    39   0.012
KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.48...    39   0.015
Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {O...    39   0.015
NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.48...    38   0.029
KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.48...    37   0.031
TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.48...    35   0.16 
KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.3...    32   2.3  
AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON} S...    32   2.6  
KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} simi...    32   2.9  
KLLA0D02398g Chr4 complement(202446..206063) [3618 bp, 1205 aa] ...    31   5.1  
KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.3...    31   5.2  

>SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 339

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/328 (88%), Positives = 289/328 (88%)

Query: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60
           MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV
Sbjct: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD
Sbjct: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKA 240

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLXXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKL                   
Sbjct: 241 KAKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLQERRQEQAEKQAQKEEERA 300

Query: 301 XDYVAPEEAEYKSTLKKRSKDNDGDAEE 328
            DYVAPEEAEYKSTLKKRSKDNDGDAEE
Sbjct: 301 KDYVAPEEAEYKSTLKKRSKDNDGDAEE 328

>Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON}
           YCL059C (KRR1) - involved in cell division and spore
           germination [contig 123] FULL
          Length = 334

 Score =  526 bits (1355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/318 (80%), Positives = 267/318 (83%)

Query: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60
           MPSTHNKDKPWDTP+IDKWKIEEFKPEDN SGLPF+EESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRAL+KH I+C LDLVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRP+LAEEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLXXXXXXXXXXXXXXXXXXX 300
                 VYTPFPP Q PRKVDL+IESGEYFLSKKEKE KKL                   
Sbjct: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300

Query: 301 XDYVAPEEAEYKSTLKKR 318
            DYVAP E EY ST K+R
Sbjct: 301 KDYVAPSEKEYGSTAKRR 318

>NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1.6
           YCL059C
          Length = 327

 Score =  521 bits (1342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/328 (77%), Positives = 274/328 (83%), Gaps = 1/328 (0%)

Query: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHN+DKPWDTP++DKW IEEFKPEDNASGLPFAEESSFMTLFPKYRE YLKSVWNDV
Sbjct: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRAL+KH++ C LDLVEGSM+VKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPF+GL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMF-KKRNVARKKPKK 239

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLXXXXXXXXXXXXXXXXXXX 300
                 +YTPFPPAQLPRKVDLEIESGEYFLSK+EKE+KKL                   
Sbjct: 240 VRKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHERREQQAEKQAEKEVERN 299

Query: 301 XDYVAPEEAEYKSTLKKRSKDNDGDAEE 328
            +Y+APEE  YKS+LKK  K    ++EE
Sbjct: 300 KNYIAPEEETYKSSLKKEHKKRKSESEE 327

>Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON}
           similar to Ashbya gossypii AFR744W
          Length = 336

 Score =  521 bits (1341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/320 (79%), Positives = 271/320 (84%), Gaps = 2/320 (0%)

Query: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHNKDKPWDTP+IDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKS WNDV
Sbjct: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60

Query: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRALDKHH+AC L+LVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD
Sbjct: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           VACDVIKIGNF SNK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAK+PELA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMF--KKRNIARKKPK 238

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLXXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQLPRKVDLEIE+GEYFLSK EK++KKL                   
Sbjct: 239 KIKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERA 298

Query: 301 XDYVAPEEAEYKSTLKKRSK 320
            DY+AP+E EYK+ L  + +
Sbjct: 299 EDYIAPDEKEYKNALNSQKR 318

>Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON}
           complement(17681..18697) [1017 nt, 339 aa]
          Length = 338

 Score =  521 bits (1341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/320 (80%), Positives = 269/320 (84%), Gaps = 1/320 (0%)

Query: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHNKDKPWDT +IDKWK+EEFKPEDNASGLPFAEESSFMTLFPKYRE YLKSVWNDV
Sbjct: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60

Query: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           T+ALDK HIACTLDLVEGSM+VKTTRKT+DP  ILKARDLIKLLARSVPFPQA+KILEDD
Sbjct: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCMKNVHPIYHIKELMIKRELAKRPELA+EDWSRFLPMF             
Sbjct: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMF-KKRNVARKKAAK 239

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLXXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQ PRKVDLEIESGEYFLSKKEKEVK+L                   
Sbjct: 240 PKKEKKVYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVKRLQERREEQSQKQIEKEKERS 299

Query: 301 XDYVAPEEAEYKSTLKKRSK 320
            DYVAP E EYKST+ K SK
Sbjct: 300 KDYVAPMEEEYKSTITKSSK 319

>CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059c KRR1
          Length = 337

 Score =  517 bits (1331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/331 (77%), Positives = 274/331 (82%), Gaps = 5/331 (1%)

Query: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M ST+NKDKPWDT +IDKWKIEEFKPEDN SG PFAEESSFMTLFPKYREAYLKS+WNDV
Sbjct: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRALDKHHI CTLDLVEGSM+VKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V+NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVV DCMKNVHPIYHIKELMIKRELAKRPELA EDWSRFLPMF             
Sbjct: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMF-KKRNVARKKPSK 239

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLXXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQLPRKVDL+IESGEYFLSKKEKE+KKL                   
Sbjct: 240 VKAEKKVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERR 299

Query: 301 XDYVAPEEAEY----KSTLKKRSKDNDGDAE 327
            DY+AP+E EY    KST K+ S ++ GD +
Sbjct: 300 KDYIAPKEDEYKSSHKSTKKRTSNEDKGDKD 330

>Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  514 bits (1325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/312 (80%), Positives = 265/312 (84%)

Query: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHN+DKPWDT +IDKWKIEEFK EDNASG PFAEESSFMTLFPKYRE+YLK++WNDV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRALDKH+IAC LDLVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLXXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQLPRKVDLEIESGEYFLSK+EK++KKL                   
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLSEQKEKQMEREIERQEERA 300

Query: 301 XDYVAPEEAEYK 312
            D++APEE  YK
Sbjct: 301 KDFIAPEEETYK 312

>NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON}
           Anc_1.6 YCL059C
          Length = 317

 Score =  514 bits (1324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/318 (79%), Positives = 267/318 (83%), Gaps = 1/318 (0%)

Query: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHN+DKPWDT EI+KWKIEEFKPEDNASGLPFAEESSFMTLFPKYRE YLKSVWNDV
Sbjct: 1   MVSTHNRDKPWDTEEINKWKIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRAL+ H++AC LDLVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD
Sbjct: 61  TRALNTHNLACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKKPELANEDWSRFLPMF-KKRNVARKKPKK 239

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLXXXXXXXXXXXXXXXXXXX 300
                 +YTPFPPAQLPRKVDLEIESGEYFLSK+EKE+KKL                   
Sbjct: 240 VKKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLNERREQQAEKQVEKETERN 299

Query: 301 XDYVAPEEAEYKSTLKKR 318
            DYVAP E  YKS+ K +
Sbjct: 300 KDYVAPSEPTYKSSNKSK 317

>YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}
           KRR1Essential nucleolar protein required for the
           synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 316

 Score =  514 bits (1323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/312 (79%), Positives = 265/312 (84%)

Query: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHN+DKPWDT +IDKWKIEEFK EDNASG PFAEESSFMTLFPKYRE+YLK++WNDV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRALDKH+IAC LDLVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAKRPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLXXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQLPRKVDLEIESGEYFLSK+EK++KKL                   
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA 300

Query: 301 XDYVAPEEAEYK 312
            D++APEE  YK
Sbjct: 301 KDFIAPEEEAYK 312

>KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 330

 Score =  510 bits (1314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/311 (80%), Positives = 263/311 (84%), Gaps = 2/311 (0%)

Query: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHNKDKPWDT E+DKW IEEFKPEDN SGLPFAEESSFMTLFPKYREAYLKSVW DV
Sbjct: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60

Query: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TR+LD HHIAC L+LVEGSM+VKTTRKTYDPA+ILKARDLIKLLARSVPFPQAVKILEDD
Sbjct: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAK+PELAEEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMF--KKRNVARKKPK 238

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLXXXXXXXXXXXXXXXXXXX 300
                 +YTPFPPAQLPRKVDLEIESGEYFLSK+EKEVKKL                   
Sbjct: 239 KIKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERA 298

Query: 301 XDYVAPEEAEY 311
            D++AP+E +Y
Sbjct: 299 KDFIAPKETDY 309

>KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 332

 Score =  510 bits (1313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/318 (80%), Positives = 269/318 (84%)

Query: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60
           MPSTHNKDKPWDTP+IDKWKIEEFKPEDN SG+PFAEESSFMTLFPKYREAYLKSVWNDV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRALDKH+IAC LDLVEGSM+VKTTR+TYDPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAKRP+LAEEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLXXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQ PRK+DL+IESGEYFL+KKEKE KKL                   
Sbjct: 241 KPKENKVYTPFPPAQQPRKIDLQIESGEYFLTKKEKEAKKLEERKREQAEKQVEKNKERA 300

Query: 301 XDYVAPEEAEYKSTLKKR 318
            DYVAP E  Y+ + KKR
Sbjct: 301 KDYVAPIEKGYEGSSKKR 318

>Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  509 bits (1311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/314 (78%), Positives = 263/314 (83%)

Query: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHN++KPWDT +IDKWKIEEFK EDN SG PFAEESSFMTLFPKYRE YLK++WNDV
Sbjct: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60

Query: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRALDKH+IAC LDLVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAKRPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLXXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQLPRKVDLEIESGEYFLSK++K+VKKL                   
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNEQKEKQMERELERQEERA 300

Query: 301 XDYVAPEEAEYKST 314
            D+ APEE  YK +
Sbjct: 301 KDFTAPEEESYKPS 314

>Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  508 bits (1307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/312 (78%), Positives = 263/312 (84%)

Query: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHN+DKPWDT ++DKW IEEFK EDNASG PFAEESSFMTLFPKYRE YLK++WNDV
Sbjct: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60

Query: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRALDKH+I+C LDLVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLXXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQLPRKVDLEIESGEYFLSK+EK++KKL                   
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREVERQEERA 300

Query: 301 XDYVAPEEAEYK 312
            ++VAP+E  YK
Sbjct: 301 KNFVAPQEEAYK 312

>KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}
           Anc_1.6 YCL059C
          Length = 349

 Score =  501 bits (1289), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 245/314 (78%), Positives = 259/314 (82%), Gaps = 1/314 (0%)

Query: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHNKDKPWDT +IDKW IEEFKPEDNASG PFAEESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60

Query: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           T+ALD HHIACTLDLVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKIL++D
Sbjct: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGN V+NKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCM NVHPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMF-KKRNVARKKPKK 239

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLXXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQLPRKVDLEIESGEYFL+KKEK+ KKL                   
Sbjct: 240 IKKEKKVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERR 299

Query: 301 XDYVAPEEAEYKST 314
            DY AP+E  Y +T
Sbjct: 300 KDYTAPKEKAYGTT 313

>TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6
           YCL059C
          Length = 316

 Score =  498 bits (1283), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 241/317 (76%), Positives = 267/317 (84%), Gaps = 1/317 (0%)

Query: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHNK+KPWDT +IDKWK+E+FKPEDNASG+PF+EESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           T+ALDKHH+ACTL+LV+GSM+V TTRKTYDP IILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVED M+NVHPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMF-KKRNVARKKSKK 239

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLXXXXXXXXXXXXXXXXXXX 300
                 VYTPFPP+QLPRKVDLEIESGEYFLSKKEKEVK+L                   
Sbjct: 240 PKREKKVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERS 299

Query: 301 XDYVAPEEAEYKSTLKK 317
            +Y+AP+E +Y S+++K
Sbjct: 300 KNYIAPKEEKYVSSIEK 316

>TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1.6
           YCL059C
          Length = 350

 Score =  498 bits (1281), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 243/315 (77%), Positives = 262/315 (83%), Gaps = 1/315 (0%)

Query: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHN+DKPWDT +IDKW++EEFKPEDNASGLPFAEESSFMTLFPKYRE YLKS+WNDV
Sbjct: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60

Query: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRAL+ HHIAC LDL+EGSM+VKTTRKT+DPAIIL+ARDLIKLLARSVPF QAVKILE+D
Sbjct: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           VACDVIKIGN V+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVED M+NVHPIY IKELMIKRELAKRPELAEEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMF-KKRNVARKKPKK 239

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLXXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQ PRK+DLEIESGEYFLSKKEKE+ KL                   
Sbjct: 240 IRAEKKVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLKERREKQAEKQEEKEEARS 299

Query: 301 XDYVAPEEAEYKSTL 315
            DY+AP+E  YKS+L
Sbjct: 300 KDYIAPKEDVYKSSL 314

>TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {ON}
           Anc_1.6 YCL059C
          Length = 316

 Score =  490 bits (1261), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 245/317 (77%), Positives = 269/317 (84%), Gaps = 1/317 (0%)

Query: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHN+DKPWDTP+I+KW+I+EFKPEDNASGLPF EESSFMTLFPKYRE YL+ VW DV
Sbjct: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60

Query: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           T++LDK+H+ACTLDL+EGSM+VKTTRKTYDPAIILKARDLIKLLARSVP+PQA++IL+DD
Sbjct: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKREL+KRPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMF-KKRNVARKKSKK 239

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLXXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQLPRKVDLEIESGEYFLSKKEKE+KKL                   
Sbjct: 240 PKKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEIKKLKERREKQEEKQVEKEKERR 299

Query: 301 XDYVAPEEAEYKSTLKK 317
            D++AP E EYKS+L+K
Sbjct: 300 KDFIAPSEKEYKSSLQK 316

>ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highly
           similar to uniprot|P25586 Saccharomyces cerevisiae
           YCL059C KRR1 Essential nucleolar protein required for
           the synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 314

 Score =  482 bits (1240), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 237/314 (75%), Positives = 256/314 (81%), Gaps = 1/314 (0%)

Query: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M STHNKDKPWDT EIDKW  +EFK EDNASGLPFAEESSFMTLFPKYREAYLKS+WNDV
Sbjct: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           T+AL+K+H+AC LDLVEGSM+VKTTRKT DPAIILKARDLIKLLARSVPFPQAVKILED+
Sbjct: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGN V+NKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+AMG +KGL
Sbjct: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVED MKN+HPIYHIKELMIKRELAKRPELA EDWSRFLP F             
Sbjct: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNF-KKRNVARKKPMK 239

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLXXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQ PRKVDLEIESGEYFL+K+EKE KKL                   
Sbjct: 240 IRKEKKVYTPFPPAQTPRKVDLEIESGEYFLNKREKEAKKLEERREKQAEKQEERQKERR 299

Query: 301 XDYVAPEEAEYKST 314
            D++ P+E +YK +
Sbjct: 300 KDFLPPKEEDYKKS 313

>AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL059C (KRR1)
          Length = 343

 Score =  483 bits (1243), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 243/311 (78%), Positives = 260/311 (83%), Gaps = 2/311 (0%)

Query: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M ST NKDKPWDTP++DKW IEEF PED+ASGLPFAEESSFMTLFPKYRE YLKS+W +V
Sbjct: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60

Query: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           TRAL+KHHIAC L+LVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVP PQA+KIL+DD
Sbjct: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V++KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAKRPELAEEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMF--KKRNVARKKPK 238

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLXXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQLPRKVDLEIE+GEYFLSKKEKE KKL                   
Sbjct: 239 KIKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKKEKEAKKLEARRAQQAEKQSEKEKERA 298

Query: 301 XDYVAPEEAEY 311
            DY+AP E EY
Sbjct: 299 KDYIAPAEPEY 309

>KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}
           Anc_1.6 YCL059C
          Length = 344

 Score =  481 bits (1238), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 233/272 (85%), Positives = 245/272 (90%), Gaps = 1/272 (0%)

Query: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60
           M ST+NK+KPWDT +IDKW+ EEFKPEDNASGLPFAEESSFMTLFPKYRE+YLKSVW DV
Sbjct: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60

Query: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120
           T+AL+KHHIAC LDLVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVPFPQA+KILED+
Sbjct: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120

Query: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCM NVHPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMF-KKRNVARKKPKK 239

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLS 272
                 VYTPFPP QLPRKVDLEIESGEYFLS
Sbjct: 240 IRKEKKVYTPFPPTQLPRKVDLEIESGEYFLS 271

>NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {ON}
           Anc_5.482 YOR145C
          Length = 270

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 81/193 (41%), Gaps = 10/193 (5%)

Query: 4   THNKDKPWDTPEIDKWKIEE-----FKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWN 58
           TH+  +P    E     ++E     F   + A G     ES  + + P +R   L++ W 
Sbjct: 52  THDDTQPTQKKEAKGVVLDEEGKPRFSSANKAEGAKVKLESRKVPV-PPHRMTPLRNSWT 110

Query: 59  DVTRALDKH-HIACTLDLVEGSMSVKTTRK-TYDPAIILKARDLIKLLARSVPFPQAVKI 116
            +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK          ++ +
Sbjct: 111 KIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIAL 170

Query: 117 LE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAM 174
           L  DD+  +  +I +  +   +   +   R+ G +G T  A+E  T+  I++    +  +
Sbjct: 171 LRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADTKIHIL 230

Query: 175 GPFKGLKEVRRVV 187
           G F  ++  R  V
Sbjct: 231 GGFTHIRMAREAV 243

>SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 266

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-HIACTLDLVEGSMSVKTTRK-TYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 94  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 153

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
            A       A+ +L  DD+  +  ++ +  +   +   +   R+ G +G T  A+E  T+
Sbjct: 154 FALGFDLDDAIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 213

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 214 TRIVLADSKIHILGGFTHIRMAREAV 239

>ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability
          Length = 269

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-HIACTLDLVEGSMSVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L +H  +   ++L   S+ +++  R+T DP  + K  D IK 
Sbjct: 97  PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRSHPRQTTDPGALQKGADFIKA 156

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  ++ +  + N +   +   R+ G +G T  A+E  T+
Sbjct: 157 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 216

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++    +  +G F  ++  R  V
Sbjct: 217 TRIVLADAKIHILGGFTHIRMAREAV 242

>Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON}
           complement(30976..31782) [807 nt, 269 aa]
          Length = 268

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-HIACTLDLVEGSMSVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  +I +  + N +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 216 TRIVLADSKIHILGGFTHIRMAREAV 241

>Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 68/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREAYLKSVWNDVTRALDKH-HIACTLDLVEGSMSVKTTRK-TYDPAIILKARDLI 101
           + P +R   L++ W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRLTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELL 159
           K  A       ++ +L  DD+  +  ++ +  +   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFALGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           T+  I++  + +  +G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMAREFV 247

>TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON}
           Anc_5.482 YOR145C
          Length = 272

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-HIACTLDLVEGSMSVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L +H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 100 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 159

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  +I +  + N +   +   R+ G +G T  A+E  T+
Sbjct: 160 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 219

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 220 TRIVLADSKIHILGGFTHIRMAREAV 245

>Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii AFR390C
          Length = 271

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-HIACTLDLVEGSMSVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTVDPGALQKGADFIKT 158

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  +I +  + N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARETI 244

>Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR145C
           - Protein required for cell viability [contig 189] FULL
          Length = 271

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-HIACTLDLVEGSMSVKTTRK-TYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   ++ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRLTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    A+ +L  DD+  +  +I +  + N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESV 244

>KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 271

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-HIACTLDLVEGSMSVKTTRK-TYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   ++ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    A+ +L  DD+  +  +I +  + N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESV 244

>CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {ON}
           highly similar to uniprot|Q99216 Saccharomyces
           cerevisiae YOR145c
          Length = 261

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-HIACTLDLVEGSMSVKTTRK-TYDPAIILKARDLIKL 103
           P +R   L++ WN +   L  H  +   ++L   ++ ++T  K T DP  + K  D IK 
Sbjct: 89  PPHRMTPLRNSWNKIYPPLVDHLKLQVRMNLKTRTVELRTHPKHTTDPGALQKGADFIKA 148

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  ++ +  +   +   +   R+ G +G T  A+E  T+
Sbjct: 149 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 208

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 209 TRIVLADSKIHILGGFTHIRMAREAV 234

>KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability,
          Length = 274

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-HIACTLDLVEGSMSVKTT-RKTYDPAIILKARDLIKL 103
           P +R   LK+ W+ +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 102 PPHRMTPLKNNWSKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVSNKERFVKRR-QRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  +I +  + +   + R   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLQGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 222 TRIVLADSKIHILGGFTHIRMARESV 247

>Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {ON}
           YOR145C (REAL)
          Length = 276

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/148 (21%), Positives = 67/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREAYLKSVWNDVTRALDKH-HIACTLDLVEGSMSVKTTRK-TYDPAIILKARDLI 101
           + P +R   L++ W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 102 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 161

Query: 102 KLLARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L  DD+  +  ++ +  +   +   +   R+ G +G T  A+E  
Sbjct: 162 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 221

Query: 160 TKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           T+  I++  + +  +G F  ++  R  V
Sbjct: 222 TRTRIVLADSKIHILGGFTHIRMARESV 249

>AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR003W (MRPL32)
          Length = 178

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 71/172 (41%), Gaps = 37/172 (21%)

Query: 54  KSVWNDVTRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQA 113
           ++VW +V RAL +   A    L  GS SV            +  R L++LL R+    QA
Sbjct: 4   QAVWGNVGRALSECTAALFPRLELGSGSV------------IAPRTLLELLRRAGGSQQA 51

Query: 114 --VKILEDDVACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTV 171
               +  D +   V K       K    KRRQ+L GP    L+ +  L KC         
Sbjct: 52  GTAAVGADGLVLAVPK------KKVSHQKRRQKLYGPGKKQLQMVHHLGKC--------- 96

Query: 172 SAMGPFKGLKEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRF 223
            + G +K L  +      CM  V  I HI ++  + + A+ P+  E+D S  
Sbjct: 97  PSCGHYKRLNTL------CMYCVGEIRHIWKVYTQTKPAEPPQ--EQDLSEL 140

>TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {ON}
           Anc_5.482 YOR145C
          Length = 268

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-HIACTLDLVEGSMSVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L++ W+ +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNSWSKIYPPLVDHLKLQVRMNLKSKSVELRTHPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  +I +  + + +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLHGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++    +  +G F  ++  R  V
Sbjct: 216 TRIVLADTKIHILGGFTHIRMAREAV 241

>YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}
           PNO1Essential nucleolar protein required for pre-18S
           rRNA processing, interacts with Dim1p, an 18S rRNA
           dimethyltransferase, and also with Nob1p, which is
           involved in proteasome biogenesis; contains a KH domain
          Length = 274

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 32/148 (21%), Positives = 67/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREAYLKSVWNDVTRALDKH-HIACTLDLVEGSMSVKTTRK-TYDPAIILKARDLI 101
           + P +R   L++ W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L  DD+  +  ++ +  +   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           T+  I++  + +  +G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESV 247

>KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.482
           YOR145C
          Length = 276

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-HIACTLDLVEGSMSVKTTRK-TYDPAIILKARDLIKL 103
           P +R   L++ W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 104 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 163

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  ++ +  +   +   +   R+ G +G T  A+E  T+
Sbjct: 164 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 223

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 224 TRIVLADSKIHILGGFTHIRMAREAV 249

>Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 32/148 (21%), Positives = 67/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREAYLKSVWNDVTRALDKH-HIACTLDLVEGSMSVKTTRK-TYDPAIILKARDLI 101
           + P +R   L++ W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L  DD+  +  ++ +  +   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           T+  I++  + +  +G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESV 247

>NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.482
           YOR145C
          Length = 274

 Score = 37.7 bits (86), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 64/146 (43%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-HIACTLDLVEGSMSVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 102 PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  +I +  +   +   +   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++    +  +G F  ++  R  V
Sbjct: 222 TRIVLADTKIHILGGFTHIRMARESV 247

>KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.482
           YOR145C
          Length = 277

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 37/176 (21%), Positives = 77/176 (43%), Gaps = 5/176 (2%)

Query: 16  IDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDVTRALDKH-HIACTLD 74
           +D+     F   + AS      ES  + + P +R   L++ W  +   L  H  +   ++
Sbjct: 76  LDEQGKPRFSSANKASETKIKAESRKVAV-PPHRMTPLRNNWTKIYPPLVDHLKLQVRMN 134

Query: 75  LVEGSMSVKTT-RKTYDPAIILKARDLIKLLARSVPFPQAVKILE-DDVACDVIKIGNFV 132
           L   S+ ++T  + T DP  + K  D IK          ++ +L  DD+  +  ++ +  
Sbjct: 135 LKTKSVELRTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVK 194

Query: 133 S-NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           + + +   +   R+ G +G T  A+E  T+  I++  + +  +G F  ++  R  V
Sbjct: 195 TLHGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESV 250

>TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.482
           YOR145C
          Length = 271

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 30/146 (20%), Positives = 65/146 (44%), Gaps = 4/146 (2%)

Query: 46  PKYREAYLKSVWNDVTRALDKH-HIACTLDLVEGSMSVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWPKIYPPLVDHLKLQVRMNLRTKSVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILE-DDVACDVIKIGNFVS-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L  DD+  +  ++ +  +   +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESI 244

>KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.309
           YLR116W
          Length = 467

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 5/54 (9%)

Query: 145 LVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNVHPIY 198
           L+GP GNTL+ L+  +KC I ++G      G  K  K    + E  M    P++
Sbjct: 151 LLGPRGNTLRKLQEQSKCKIAIRG-----RGSVKEGKHANDLPEGAMNMEDPLH 199

>AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR116W
           (MSL5)
          Length = 507

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I+++G
Sbjct: 169 LLGPRGNTLKQLQQQSGCKIVIRG 192

>KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} similar
           to uniprot|Q12096 Saccharomyces cerevisiae YOR320C GNT1
           N-acetylglucosaminyltransferase capable of modification
           of N-linked glycans in the Golgi apparatus
          Length = 486

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 40/99 (40%), Gaps = 20/99 (20%)

Query: 137 RFV-KRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNVH 195
           RF+ KRR RLVG  G  +  + L  KC +  Q N        + ++  R        N+H
Sbjct: 2   RFLFKRRLRLVGAIGAVVLLISLTAKCVVQFQLN--------REIEHYRTFFRKHKDNIH 53

Query: 196 PIYH-----------IKELMIKRELAKRPELAEEDWSRF 223
            IY            I+ L   R+    P+ +  DW ++
Sbjct: 54  DIYDPLNIKQIPYETIESLYQLRKTGDVPKKSPIDWGKY 92

>KLLA0D02398g Chr4 complement(202446..206063) [3618 bp, 1205 aa] {ON}
            similar to uniprot|P06105 Saccharomyces cerevisiae
            YJL080C SCP160 May be required during cell division for
            faithful partitioning of the ER-nuclear envelope
            membranes involved in control of mitotic chromsome
            transmission,
          Length = 1205

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 42/83 (50%), Gaps = 9/83 (10%)

Query: 112  QAVKILEDDVA-CDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILV---- 166
            +A K++ED +A   ++    FV +K+   K+   +VGPNG  ++ +   TK  I V    
Sbjct: 1120 KASKLIEDRIAEAKLVNTEGFVWSKD--AKKFNSIVGPNGRNIREIRNATKTVIHVPRKS 1177

Query: 167  --QGNTVSAMGPFKGLKEVRRVV 187
                N +  +G  +G+K+   ++
Sbjct: 1178 DKVNNVIYVLGSEEGVKKAAELI 1200

>KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.309
           YLR116W
          Length = 497

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I ++G
Sbjct: 148 LLGPRGNTLKQLQKQSNCKIAIRG 171

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,669,539
Number of extensions: 1237955
Number of successful extensions: 3242
Number of sequences better than 10.0: 47
Number of HSP's gapped: 3273
Number of HSP's successfully gapped: 47
Length of query: 339
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 229
Effective length of database: 40,868,139
Effective search space: 9358803831
Effective search space used: 9358803831
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)