Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0C00462g1.5ON1177117748210.0
Smik_3.141.5ON11134218263e-92
Suva_3.1521.5ON11404067894e-87
YCL061C (MRC1)1.5ON10964027725e-85
NDAI0A001401.5ON10914007628e-84
Skud_3.31.5ON11524207612e-83
NCAS0B091101.5ON10203947332e-80
KAFR0D001401.5ON10414167245e-79
Kpol_2002.81.5ON9854047172e-78
KNAG0C002201.5ON11613746889e-74
TPHA0E040101.5ON9654036614e-71
KLLA0C00484g1.5ON9253816462e-69
AFR745W1.5ON10184006361e-67
CAGL0B00330g1.5ON11363746301e-66
Ecym_10081.5ON11184036193e-65
ZYRO0F18480g1.5ON9603936021e-63
KLTH0F00484g1.5ON9933905721e-59
TBLA0A075701.5ON12523875529e-57
TDEL0C069701.5ON9413625292e-54
Kwal_33.130051.5ON9703985203e-53
KLLA0E12673g5.342ON266100752.4
ABL013C8.762ON69850763.0
TBLA0H014108.281ON352112743.8
NDAI0A045503.473ON94990729.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0C00462g
         (1177 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {O...  1861   0.0  
Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON} ...   322   3e-92
Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {O...   308   4e-87
YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}  M...   301   5e-85
NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}...   298   8e-84
Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YC...   297   2e-83
NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_...   286   2e-80
KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON...   283   5e-79
Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON...   280   2e-78
KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON...   269   9e-74
TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5...   259   4e-71
KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON...   253   2e-69
AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic...   249   1e-67
CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {O...   247   1e-66
Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON} ...   243   3e-65
ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weak...   236   1e-63
KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON...   224   1e-59
TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_...   217   9e-57
TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1...   208   2e-54
Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON...   204   3e-53
KLLA0E12673g Chr5 complement(1126397..1127197) [801 bp, 266 aa] ...    33   2.4  
ABL013C Chr2 complement(372923..375019) [2097 bp, 698 aa] {ON} S...    34   3.0  
TBLA0H01410 Chr8 (314446..315504) [1059 bp, 352 aa] {ON} Anc_8.2...    33   3.8  
NDAI0A04550 Chr1 complement(1025324..1028173) [2850 bp, 949 aa] ...    32   9.5  

>SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {ON}
            some similarities with uniprot|P25588 Saccharomyces
            cerevisiae YCL061C MRC1 S-phase checkpoint protein found
            at replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 1177

 Score = 1861 bits (4821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 948/1177 (80%), Positives = 948/1177 (80%)

Query: 1    MDFLDALGDLKHPXXXXXXYVKDIEVYATQEENDEEKKQPQLSSASFLFGNSTIVDKVKS 60
            MDFLDALGDLKHP      YVKDIEVYATQEENDEEKKQPQLSSASFLFGNSTIVDKVKS
Sbjct: 1    MDFLDALGDLKHPKKKKTTYVKDIEVYATQEENDEEKKQPQLSSASFLFGNSTIVDKVKS 60

Query: 61   RLNGVSNEETDGERGDALPQTQVIPNYYDGEDLEQDFVSPPKPRRVSNTGHGQDCDCDSE 120
            RLNGVSNEETDGERGDALPQTQVIPNYYDGEDLEQDFVSPPKPRRVSNTGHGQDCDCDSE
Sbjct: 61   RLNGVSNEETDGERGDALPQTQVIPNYYDGEDLEQDFVSPPKPRRVSNTGHGQDCDCDSE 120

Query: 121  EQTQLMPTQETGAYESQVVPVIAPVQVSETIPVSINDGLLGESLFKTSKDEVKGNGGNTT 180
            EQTQLMPTQETGAYESQVVPVIAPVQVSETIPVSINDGLLGESLFKTSKDEVKGNGGNTT
Sbjct: 121  EQTQLMPTQETGAYESQVVPVIAPVQVSETIPVSINDGLLGESLFKTSKDEVKGNGGNTT 180

Query: 181  RNLAEPCYGLTQIIPSPQYKNSQQMQLETQEAGETQEVDKTQRILEATARDPTLSEEDFV 240
            RNLAEPCYGLTQIIPSPQYKNSQQMQLETQEAGETQEVDKTQRILEATARDPTLSEEDFV
Sbjct: 181  RNLAEPCYGLTQIIPSPQYKNSQQMQLETQEAGETQEVDKTQRILEATARDPTLSEEDFV 240

Query: 241  AATVADGSEAVTTQLDTCVPDTSALGDVQPTAPDQSAHRNSQRLLIHEIEKDLDAEEERE 300
            AATVADGSEAVTTQLDTCVPDTSALGDVQPTAPDQSAHRNSQRLLIHEIEKDLDAEEERE
Sbjct: 241  AATVADGSEAVTTQLDTCVPDTSALGDVQPTAPDQSAHRNSQRLLIHEIEKDLDAEEERE 300

Query: 301  KRITEAKPHXXXXXXXXXXXXEAFLNNFDCXXXXXXXXXXXXXXXXXXXXXXPASKRRKL 360
            KRITEAKPH            EAFLNNFDC                      PASKRRKL
Sbjct: 301  KRITEAKPHDVVLVVKKKFDKEAFLNNFDCSSSEGEEQEQEEQEEQTHLESEPASKRRKL 360

Query: 361  FTSVPGNPLDSKDSEAGGSGNFXXXXXXXXXXXXDEGRSTRKDKEEAGWVPLNSYKNQLK 420
            FTSVPGNPLDSKDSEAGGSGNF            DEGRSTRKDKEEAGWVPLNSYKNQLK
Sbjct: 361  FTSVPGNPLDSKDSEAGGSGNFASAIAATIGTTTDEGRSTRKDKEEAGWVPLNSYKNQLK 420

Query: 421  ARLDSKEHIXXXXXXXXXXXXVPASKMSKAAVLEIKARTSKRQGIKKTRQQPSTPRAPSL 480
            ARLDSKEHI            VPASKMSKAAVLEIKARTSKRQGIKKTRQQPSTPRAPSL
Sbjct: 421  ARLDSKEHIDLDSSSDEDENSVPASKMSKAAVLEIKARTSKRQGIKKTRQQPSTPRAPSL 480

Query: 481  KELFSSLKKANKKQILDHRREITEKRGLNLEDIEREKKEVENLLEQEIERNRKIXXXXXX 540
            KELFSSLKKANKKQILDHRREITEKRGLNLEDIEREKKEVENLLEQEIERNRKI      
Sbjct: 481  KELFSSLKKANKKQILDHRREITEKRGLNLEDIEREKKEVENLLEQEIERNRKIRLREKQ 540

Query: 541  XXXXXXXXXXXXGGYPGDFDYSENELDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 600
                        GGYPGDFDYSENELD                                 
Sbjct: 541  REKKKELDEQQDGGYPGDFDYSENELDGEPESEPASGSEDVPDSDAPDSDVLDEDSDDES 600

Query: 601  XXXXXXXXXXXXIVLPKSKKRAKRIANFXXXXXXXXXXXXXXXNEPISRNGPRPGNVIXX 660
                        IVLPKSKKRAKRIANF               NEPISRNGPRPGNVI  
Sbjct: 601  REKDRDDEDDEAIVLPKSKKRAKRIANFGSGPGPDSDSDLGSDNEPISRNGPRPGNVIDL 660

Query: 661  XXXXXXXXXXXXXXXXXVDGLTSRIKQIPGIRTPETLPSKPTLQADATSKSRARKNLLLV 720
                             VDGLTSRIKQIPGIRTPETLPSKPTLQADATSKSRARKNLLLV
Sbjct: 661  GAYGGNLANADAGLGHGVDGLTSRIKQIPGIRTPETLPSKPTLQADATSKSRARKNLLLV 720

Query: 721  GEVSXXXXXXXXXXXXNVQNRVAREEAEGNGSNGDRXXXXXXXXXXXXXXXXXXXXXSGD 780
            GEVS            NVQNRVAREEAEGNGSNGDR                     SGD
Sbjct: 721  GEVSDDDDDDDDDDDDNVQNRVAREEAEGNGSNGDREEEEEEEEEEEEEEEEEEEEESGD 780

Query: 781  DKEEYEKAMRQVLARKREQEHKIRQKRKEMKRKGVSKMFXXXXXXXXXXWHGVGGADGEL 840
            DKEEYEKAMRQVLARKREQEHKIRQKRKEMKRKGVSKMF          WHGVGGADGEL
Sbjct: 781  DKEEYEKAMRQVLARKREQEHKIRQKRKEMKRKGVSKMFEMEAEESEDEWHGVGGADGEL 840

Query: 841  SDEYDSELEKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFRRRGKGA 900
            SDEYDSELEKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFRRRGKGA
Sbjct: 841  SDEYDSELEKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFRRRGKGA 900

Query: 901  XXXXXXXXXXXXXQRYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVEDLVESKNP 960
                         QRYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVEDLVESKNP
Sbjct: 901  LDIELSDDEDDELQRYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVEDLVESKNP 960

Query: 961  FSIGETADPDSGAISENDKVDNASEHGTQPDAGGQPVRTERKRIKISQEFVQRSLSFLNS 1020
            FSIGETADPDSGAISENDKVDNASEHGTQPDAGGQPVRTERKRIKISQEFVQRSLSFLNS
Sbjct: 961  FSIGETADPDSGAISENDKVDNASEHGTQPDAGGQPVRTERKRIKISQEFVQRSLSFLNS 1020

Query: 1021 KDELDNEFELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTPARTSSRTVDLEVD 1080
            KDELDNEFELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTPARTSSRTVDLEVD
Sbjct: 1021 KDELDNEFELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTPARTSSRTVDLEVD 1080

Query: 1081 GNSPANGFKLPSVISSFSSRIDINEKFKEGXXXXXXXXXXXXIGGSRASITYLGKVRKLN 1140
            GNSPANGFKLPSVISSFSSRIDINEKFKEG            IGGSRASITYLGKVRKLN
Sbjct: 1081 GNSPANGFKLPSVISSFSSRIDINEKFKEGTKTVKVSKSYKTIGGSRASITYLGKVRKLN 1140

Query: 1141 APKRKESGRKPVFGHRHPEAAPKRAGLFADNDDSFEA 1177
            APKRKESGRKPVFGHRHPEAAPKRAGLFADNDDSFEA
Sbjct: 1141 APKRKESGRKPVFGHRHPEAAPKRAGLFADNDDSFEA 1177

>Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON}
            YCL061C (REAL)
          Length = 1113

 Score =  322 bits (826), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 192/421 (45%), Positives = 264/421 (62%), Gaps = 34/421 (8%)

Query: 783  EEYEKAMRQVLARK-----REQEHKIRQKRKEMKRKGVSKMFXXXXXXXXXXWHGVGGAD 837
            EE ++A+R+ L  K     R++E +   K KE+K KGV+  F          WHG+GGAD
Sbjct: 701  EEADEAIRRELIDKEKLQLRQKELEKAIKLKELKHKGVTNFFEMEAEESDDEWHGIGGAD 760

Query: 838  GELSDEYDSELEKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFR-RR 896
            GE SDEYDS++EKM+DDY+K  F+  EIR+MLAAE+KE D K++NKIL+DIKNGGFR +R
Sbjct: 761  GEGSDEYDSDVEKMIDDYSKNNFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKR 820

Query: 897  GKGAXXXXXXXXXXXXXQRYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVEDLVE 956
             K +             Q+Y  KRREL+R++ LE G+ +KLV NPKS AFFESMVED++E
Sbjct: 821  AKNSLELELSDDEDDVLQQYRLKRRELMRKRRLEIGDGTKLVKNPKSKAFFESMVEDIME 880

Query: 957  SKNPFSIGETADPD-SGAISENDKVDNASEH---GTQPDAGGQPVRTERKRIKISQEFVQ 1012
             KNPF   E ++ D +   ++ D +DN S +    T+ +  G PV  + K+I IS++FVQ
Sbjct: 881  YKNPFRAEEESNQDITSTATDLDTLDNNSLNVRDSTRNNEKG-PVDDKSKKIIISEDFVQ 939

Query: 1013 RSLSFLNSKDELDNEFELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTP----- 1067
            +SLSFL S +   NEFE+D+ LAK QH   G+D++ +EDLFTLKQ+S IK+         
Sbjct: 940  KSLSFLKSNNY--NEFEMDKELAKMQH---GNDDEPIEDLFTLKQHSSIKSFTNSQTDSF 994

Query: 1068 -ARTSSRTVDLEV---------DGNSP-ANGFKLPSVISSFSSRIDINEKFKEGXXXXXX 1116
             +RT +  +DLE          +G+S   +GFK PS++ SF+SR DIN+KFKEG      
Sbjct: 995  TSRTVTTMIDLEKRTEDEDEMENGDSSLVSGFKHPSIVKSFASRTDINDKFKEGNKTVKI 1054

Query: 1117 XXXXXXIGGSRASITYLGKVRKLNAPKRKESGRKPVFGHRHPEAAPKRAGLFADNDDSFE 1176
                  +G S+ASITY+GK RKL APKRK    +    HRH +   K + LF    +SF+
Sbjct: 1055 SKSYKMVGSSKASITYMGKTRKLMAPKRKAGTDQN--HHRHKKTKTKTSKLFESGQNSFD 1112

Query: 1177 A 1177
            +
Sbjct: 1113 S 1113

 Score = 89.0 bits (219), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 83/143 (58%), Gaps = 20/143 (13%)

Query: 410 VPL-NSYKNQLKARLDSKEHIXXXXXXXXXXX---------------XVPASKMSKAAVL 453
           VPL +SY N LK  +DS + I                           +P S++SKA +L
Sbjct: 399 VPLLSSYANNLKREIDSSKCITLDLDSGSDDDDNIVVDDRKLIKDEGALPISQLSKATIL 458

Query: 454 EIKARTSKRQGIKKTRQQPSTPRAPSL--KELFSSLKKANKKQILDHRREITEKRGLNLE 511
            +KAR SK+   +   Q+P   R   L   +LF++L+KA++KQILDH+RE+ E +G  LE
Sbjct: 459 NLKARLSKQN--QDISQRPLEGRDARLDHNKLFNTLRKASRKQILDHQREVIETKGFKLE 516

Query: 512 DIEREKKEVENLLEQEIERNRKI 534
           D+ +EK+ VENLLEQEI RN+KI
Sbjct: 517 DMVKEKELVENLLEQEIIRNKKI 539

>Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {ON}
            YCL061C (REAL)
          Length = 1140

 Score =  308 bits (789), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 183/406 (45%), Positives = 250/406 (61%), Gaps = 30/406 (7%)

Query: 794  ARKREQEHKIRQKRKEMKRKGVSKMFXXXXXXXXXXWHGVGGADGELSDEYDSELEKMVD 853
            + +R++E +   K KE+K KGV+  F          WHGVGGADGE SDEYDSE+EKM+D
Sbjct: 743  SERRQKEKEQATKLKELKSKGVTNFFEMEAEESEDEWHGVGGADGEGSDEYDSEVEKMID 802

Query: 854  DYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFR-RRGKGAXXXXXXXXXXXX 912
            DY+K  F+  EIR+MLAAE+KE D K++NKIL+DIKNGGFR +R K +            
Sbjct: 803  DYSKNKFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNSLELELSDDEDDV 862

Query: 913  XQRYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVEDLVESKNPFSIGETADPD-S 971
             Q+Y  KRREL+R++ LE G+ +KLV NPKS AFFESMVED++E KNPF   + +D D +
Sbjct: 863  LQQYRLKRRELMRKRRLEIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFGAEKESDQDVT 922

Query: 972  GAISENDKVDNASEH---GTQPDAGGQPVRTERKRIKISQEFVQRSLSFLNSKDELDNEF 1028
               ++ D  DN +      T  +   + V  + K++ IS++FVQ+SLSFL S +   +EF
Sbjct: 923  STATDLDTQDNDNTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQKSLSFLKSNNY--DEF 980

Query: 1029 ELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHT------PARTSSRTVDLE--VD 1080
            E+DR LA+ QH   G+   D+ DLFTLKQ+S IK+          +RT +  ++LE   +
Sbjct: 981  EMDRELARIQH---GNGEGDVVDLFTLKQHSSIKSFTNSQTNSLSSRTMNTVINLEEHTE 1037

Query: 1081 GN--------SPANGFKLPSVISSFSSRIDINEKFKEGXXXXXXXXXXXXIGGSRASITY 1132
            GN        S   GFK PSVI SF+SR DIN+KFKEG            +G S+ASITY
Sbjct: 1038 GNDEGENGDQSLIGGFKHPSVIKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKASITY 1097

Query: 1133 LGKVRKLNAPKRK-ESGRKPVFGHRHPEAAPKRAGLFADNDDSFEA 1177
            +GK RKL APKRK E    P   +   ++  +++ LF +  DSF++
Sbjct: 1098 MGKTRKLMAPKRKTEENHHP---NHIKKSKTQKSKLFENGQDSFDS 1140

 Score = 77.4 bits (189), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/155 (36%), Positives = 83/155 (53%), Gaps = 30/155 (19%)

Query: 398 RSTRKDKEEAGWVPL-NSYKNQLKARLDSKEHIX---------------XXXXXXXXXXX 441
           +  +KDK+    VPL ++Y N LK  +DS + I                           
Sbjct: 404 KENKKDKK----VPLLSTYANNLKREIDSSKCITLDLDSGSDKDNDNHMDTDKLNEDESA 459

Query: 442 VPASKMSKAAVLEIKARTSKR-----QGIKKTRQQPSTPRAPSLKELFSSLKKANKKQIL 496
           +P S++SKA +  +KAR SK+     QG  K +   S        +L ++L+KA++KQIL
Sbjct: 460 LPISQLSKATIFNLKARLSKQNQKLAQGSNKNKDFKSDHN-----KLINTLRKASRKQIL 514

Query: 497 DHRREITEKRGLNLEDIEREKKEVENLLEQEIERN 531
           DH+REI E +G  LED+ +EK+ VE+LLEQEI RN
Sbjct: 515 DHQREIVETKGFKLEDMVKEKEIVEDLLEQEILRN 549

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 82/309 (26%), Positives = 129/309 (41%), Gaps = 52/309 (16%)

Query: 40  PQLSSASFLFGNSTIVDKVKSRLNGVSNEETDGE----RGDALPQTQVIPNYYD-GEDLE 94
           P L+   FLFGN+T+ ++VK+RL G +    DG+      + +  TQ+I N YD GE+LE
Sbjct: 90  PALTGNGFLFGNATL-NRVKNRLEGRNELGQDGQDKENEDEDVFSTQLIANLYDGGEELE 148

Query: 95  QDFVSPPKPRRVSNTGHGQDCDCDSEEQTQLMPTQETGAYESQVVPVIAPVQVSETIPVS 154
                     + +   + Q  +  S  QTQ +P   T       VP+            S
Sbjct: 149 S---------KSNGDKNNQKVNVSSFTQTQRIPVSITQQNNEINVPI-----------HS 188

Query: 155 INDGLLGESLFKTSKDEVKGNGGNTTRNLAEPCYGLTQIIPSPQYKNSQQMQLETQEAGE 214
           IN+G        T K + +G+   T++  A P         + Q  N+     +TQ+   
Sbjct: 189 INEGE------PTQKAKNRGSVITTSQTQAIPFTTAQITQKTTQCLNNHGATSQTQQIPP 242

Query: 215 TQEVDKTQRILEATARD-------PTLSEEDF-VAATVADGSEAVTTQLDTCVP----DT 262
           T+  +   +   ATA D       P L+ E   +  TV D S +  TQ++T  P    D 
Sbjct: 243 TKPSEAQTQADVATANDSDTQQKVPMLTTETSPLFQTVPDQSPS--TQMNTPPPTVHDDR 300

Query: 263 SALGDVQPTAPDQSAHRNSQRLLIHEIEKDLDAEEEREKRI--TEAKPHXXXXXXXXXXX 320
           + +  V  T  D+        L IHE++ +L  E+   K+   TE +             
Sbjct: 301 TQMDTVAQTMQDKVP----PTLKIHELQSELALEDFNRKKAQNTEYRKLQKTIPIVKRFS 356

Query: 321 XEAFLNNFD 329
            E+FL +FD
Sbjct: 357 KESFLADFD 365

>YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}
            MRC1S-phase checkpoint protein required for DNA
            replication; interacts with and stabilizes Pol2p at
            stalled replication forks during stress, where it forms a
            pausing complex with Tof1p and is phosphorylated by
            Mec1p; protects uncapped telomeres
          Length = 1096

 Score =  301 bits (772), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 183/402 (45%), Positives = 249/402 (61%), Gaps = 36/402 (8%)

Query: 783  EEYEKAMRQVLA-------RKREQEHKIRQKRKEMKRKGVSKMFXXXXXXXXXXWHGVGG 835
            EE ++A+R+ L        +++E+EH+   K KE+K++GV+  F          WHG+GG
Sbjct: 678  EEADEAIRRQLIDKEKLQLKQKEKEHE--AKIKELKKRGVTNFFEMEAEESEDEWHGIGG 735

Query: 836  ADGELSDEYDSELEKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFR- 894
            ADGE SD+YDS+LEKM+DDY+K  F+P EIR+MLAAE+KE D K++NKIL+DIKNGGFR 
Sbjct: 736  ADGEGSDDYDSDLEKMIDDYSKNNFNPHEIREMLAAENKEMDIKMINKILYDIKNGGFRN 795

Query: 895  RRGKGAXXXXXXXXXXXXX-QRYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVED 953
            +R K +              Q+Y  KRREL+R++ LE G+ +KLV NPKS AFFESMVED
Sbjct: 796  KRAKNSLELELSDDDEDDVLQQYRLKRRELMRKRRLEIGDDAKLVKNPKSSAFFESMVED 855

Query: 954  LVESKNPFSIGETADPD-SGAISENDKVDNASEHGTQPDAGGQ-PVRTERKRIKISQEFV 1011
            ++E KNPF   E  + D +   ++ D  DN+   G       Q PV  + K++ IS++FV
Sbjct: 856  IIEYKNPFGAEEEYNLDITSTATDLDTQDNSINVGDNTGNNEQKPVDQKNKKVIISEDFV 915

Query: 1012 QRSLSFLNSKDELDNEFELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTL------H 1065
            Q+SLSFL S +  D  FE D+ L++ QH   G+D + +EDL+TLKQNS IK+        
Sbjct: 916  QKSLSFLKSNNYED--FETDKELSRIQH---GND-EAIEDLYTLKQNSSIKSFTNSQTDS 969

Query: 1066 TPARTSSRTVDLEV---DGNSPANG-------FKLPSVISSFSSRIDINEKFKEGXXXXX 1115
            T ++T +  +DLE    D +   NG       FK PS+I SF+SR DIN+KFKEG     
Sbjct: 970  TTSKTVNTIIDLEKRPEDEDEVENGDTSLVGVFKHPSIIKSFASRTDINDKFKEGNKTVK 1029

Query: 1116 XXXXXXXIGGSRASITYLGKVRKLNAPKRKESGRKPVFGHRH 1157
                   +G S+ASITY+GK RKL APKRK  G    + H H
Sbjct: 1030 ILKSYKTVGSSKASITYMGKTRKLIAPKRKTEGSHR-YHHDH 1070

 Score = 90.1 bits (222), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 85/143 (59%), Gaps = 20/143 (13%)

Query: 410 VPL-NSYKNQLKARLDSKEHIX---------------XXXXXXXXXXXVPASKMSKAAVL 453
           VPL +SY N LK  +DS + I                           +P S++SKA +L
Sbjct: 383 VPLLSSYANNLKREIDSSKCITLDLDSDSDEYGDDDMDSIKLSKDESVLPISQLSKATIL 442

Query: 454 EIKARTSKRQGIKKTRQQPSTPRAPSLKE--LFSSLKKANKKQILDHRREITEKRGLNLE 511
            +KAR SK+   +K  Q+P+  + P +    L ++L+KA++KQILDH++E+ E +GL LE
Sbjct: 443 NLKARLSKQN--QKLSQRPNKSKDPKVDHNVLLNTLRKASRKQILDHQKEVIETKGLKLE 500

Query: 512 DIEREKKEVENLLEQEIERNRKI 534
           D+ +EK+ VENLLEQEI RN++I
Sbjct: 501 DMAKEKEIVENLLEQEILRNKRI 523

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 67/134 (50%), Gaps = 26/134 (19%)

Query: 40  PQLSSASFLFGNSTIVDKVKSRLNGVSNEETDGERG-----DALPQTQVIPNYYD-GEDL 93
           P+L+   FLF N+T+ ++VK+RL G    E +   G     ++LP TQ+I N YD GE+L
Sbjct: 46  PELTGNGFLFANATL-NRVKNRLEGKKAPEQNHNNGKDRSENSLP-TQLISNLYDGGEEL 103

Query: 94  EQDFVSPPKPRRVSNTGHGQDCDCDSEEQTQLMPT--QETGAYESQVVPVIAPVQVSETI 151
           E+          V +  + +     S  QTQ +P   Q+   +    VP+ +   V++  
Sbjct: 104 EK--------SEVKDNSYSEKNVSSSFTQTQRIPVSIQQDKVFN---VPIHS---VNDGK 149

Query: 152 PVSI--NDGLLGES 163
           P  +   DGL+ E+
Sbjct: 150 PTQLIKEDGLVNET 163

>NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1091

 Score =  298 bits (762), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 178/400 (44%), Positives = 237/400 (59%), Gaps = 40/400 (10%)

Query: 799  QEHKIRQKRKEMKRKGVSKMFXXXXXXXXXXWHGVGGADGELSDEYDSELEKMVDDYTKT 858
            Q+ K+R K KEM +KGV+K F          WHG+GG DGE+SDEYDS++EKM+DDY+K 
Sbjct: 709  QQEKMRHKEKEMMKKGVTKFFEMEAEESEDEWHGIGGIDGEMSDEYDSDVEKMIDDYSKA 768

Query: 859  TFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFRRRGKGAXXXXXXXXXXXXXQR-YH 917
             FDP EIR+MLAAE+KE D  ++NKIL+DIKNGGFR+R +G               R YH
Sbjct: 769  NFDPNEIREMLAAENKEMDLNMINKILYDIKNGGFRKRKRGGLELELSEDEDDDALREYH 828

Query: 918  AKRRELLRQKVLENG-EASKLVSNPKSHAFFESMVEDLVESKNPFS---IGETADPDSGA 973
             KR+EL+R++ LE G +  KLV NPKS AFFESMVED+ + KN F+   +GET+  +   
Sbjct: 829  LKRKELMRKRRLELGDDEKKLVKNPKSKAFFESMVEDITDDKNAFNDEPLGETSTQE--- 885

Query: 974  ISENDKVDNASEHGTQPDAG-----GQPVRTERKRIKISQEFVQRSLSFLNSKDELDNEF 1028
                  ++N  +   + DA      G   R ++K+  IS+EFVQR+LSFL S  E D EF
Sbjct: 886  ------INNTQDDMKEEDAAVVKENGDSKRIKKKKTIISEEFVQRTLSFLKSSRE-DEEF 938

Query: 1029 ELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTPARTSSRTVDL-------EVDG 1081
             ++  LAK QH T       +E+L +LKQ S IK   +P+  SS+ + L       + D 
Sbjct: 939  AMNENLAKEQHGT------KVENLLSLKQQSSIKVFQSPSNNSSKVIKLDDINNDDDDDE 992

Query: 1082 NSPANGFKLPSVISSFSSRIDINEKFKEGXXXXXXXXXXXXIGGSRASITYLGKVRKLNA 1141
            +SP   FK+PS++ SF S+ DINEKF++G            +G S+ASITYLGK RKL A
Sbjct: 993  DSPIALFKVPSILKSFGSKTDINEKFQDGNKTVTISKSYRTVGSSKASITYLGKSRKLMA 1052

Query: 1142 PKRKESGRKP----VFGHRHPEAAPKRAG-LFADNDDSFE 1176
            P    S  KP    V  +       +  G LF+  DDSFE
Sbjct: 1053 PTH--SKMKPLRSRVTDNNKITKGERNIGSLFSTGDDSFE 1090

 Score = 98.6 bits (244), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 59/126 (46%), Positives = 84/126 (66%), Gaps = 5/126 (3%)

Query: 412 LNSYKNQLKARLDSKEHI---XXXXXXXXXXXXVPASKMSKAAVLEIKARTSKRQGIKKT 468
           L+ Y+N+LK  L+SK  +               +P S+ SKA +L IKAR SK++  KK 
Sbjct: 411 LSRYENKLKTVLNSKNQLQLGSDDESSDDTENSLPVSRTSKATILTIKARLSKQKS-KKN 469

Query: 469 RQQPSTPRAPSLKELFSSLKKANKKQILDHRREITEKRGLNLEDIEREKKEVENLLEQEI 528
            Q+  T    +L +LF +LKK+++KQIL+++RE+ E +GLN EDIE EK+ VENLLEQEI
Sbjct: 470 VQKDGTVNT-NLNKLFENLKKSSRKQILENQRELIENKGLNFEDIEMEKELVENLLEQEI 528

Query: 529 ERNRKI 534
           +RN+KI
Sbjct: 529 KRNQKI 534

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 71/277 (25%), Positives = 118/277 (42%), Gaps = 39/277 (14%)

Query: 40  PQLSSASFLFGNSTIVDKVKSRLNG---VSNEETDGERGDALPQTQVIPNYY-DGEDLEQ 95
           P +    FLF NSTI DKV++RL+G   +  E+T      +  +TQ+I N Y +GEDLE+
Sbjct: 48  PTILGTGFLFKNSTI-DKVRARLSGKNYIEQEKT--PLASSEQETQIITNLYTNGEDLEK 104

Query: 96  DF-----VSPPKPRRVSNTGH----GQDCDCDSEEQTQLMPTQETGAYE--------SQV 138
           D      VS  +P  ++NTG      Q+     +  +  MPTQ  G+ E        +Q+
Sbjct: 105 DLIKHIPVSQTQP--ITNTGERTQLEQEIKVTIDNDSNEMPTQVIGSTERDDETAERTQI 162

Query: 139 VPVIAPVQVSETIPVSINDGLLGESLFKTSKDEVKGNGGNTTRNLAEPCYGLTQIIPSPQ 198
             V   +   +T   +       E L KT +        +   N+    +G      + +
Sbjct: 163 GEVATQLIPGDTYDRTSTMQKTQEQLLKTQRIPQNSRDNHNQTNIINESFGSVPFTFTQK 222

Query: 199 YKNSQQMQLETQEAGETQEV---DKTQRILEATARDPTLSEEDFVAATVADGSEAVTTQL 255
            KN      ET    E  +     K+Q +L +T  D   +E    ++++   +    T  
Sbjct: 223 IKN-----FETNITNENDDFTNGSKSQTVLISTNVDNVRAEYVDASSSLLQATAIAATVR 277

Query: 256 DTCVPDTSALGDVQPTAPDQSAHRNSQRLLIHEIEKD 292
           D     T+ +G V   A D+ +  +   L IH+ +K+
Sbjct: 278 DDGPSSTALVGTV---ADDKLS--SGSNLAIHKFQKE 309

>Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YCL061C
            (REAL)
          Length = 1152

 Score =  297 bits (761), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 182/420 (43%), Positives = 254/420 (60%), Gaps = 31/420 (7%)

Query: 783  EEYEKAMRQVLARKREQEHKIRQKR-----KEMKRKGVSKMFXXXXXXXXXXWHGVGGAD 837
            EE  +A+R+ L  K++ + + ++K+     KE K KG++  F          WHGVGGAD
Sbjct: 739  EEVSEAIRRELIDKKKSQLRQKEKKHVAELKEFKSKGITNFFEMEAEESEDEWHGVGGAD 798

Query: 838  GELSDEYDSELEKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFR-RR 896
            GE S+EYDSE+EKM+DDY+K +F+  EIR+MLAAE+KE D K++N+IL+DIKNGGFR +R
Sbjct: 799  GEGSEEYDSEVEKMIDDYSKNSFNSHEIREMLAAENKEMDVKMINRILYDIKNGGFRNKR 858

Query: 897  GKGAXXXXXXXXXXXXXQRYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVEDLVE 956
             K +             Q+Y  KRREL+R++ LE G+ +KLV NPKS AFFESMVED++E
Sbjct: 859  AKNSLELELSDDEDDVLQQYRLKRRELMRKRRLEIGDDTKLVKNPKSKAFFESMVEDIME 918

Query: 957  SKNPFSIGETADPD-SGAISENDKVDNASEHGTQPDAGGQPVRTE--RKRIKISQEFVQR 1013
             KNPF   E +  D +   ++ D  DN S          +  R +   K+  IS++FVQ+
Sbjct: 919  FKNPFKAEEESHQDLTSTATDLDTQDNDSIQIGDSTRNNEHRRVDDRSKKTIISEDFVQK 978

Query: 1014 SLSFLNSKDELDNEFELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLH---TPART 1070
            SLSFL S +   +EFE+D+  A+ QH  +GD+   +EDLFTLKQ+S IK+     T + +
Sbjct: 979  SLSFLRSNNY--DEFEMDKERARIQHD-IGDEG--VEDLFTLKQHSSIKSFTNSPTDSLS 1033

Query: 1071 SSRT---VDL--------EVDGNSPA--NGFKLPSVISSFSSRIDINEKFKEGXXXXXXX 1117
            S R    +DL        EV+   P+   GFK PS+I SF+SR DIN+KFKEG       
Sbjct: 1034 SKRVNSMIDLEQPTEDNNEVENEDPSLIGGFKHPSIIKSFASRTDINDKFKEGNKTVKIS 1093

Query: 1118 XXXXXIGGSRASITYLGKVRKLNAPKRKESGRKPVFGHRHPEAAPKRAGLFADNDDSFEA 1177
                 +G S+ASITY+GK RKL APK+K + R     H       +++ LF    DSF++
Sbjct: 1094 KTYKTVGSSKASITYMGKTRKLMAPKKK-ADRDHHHNHHSKAWKTQKSKLFESGQDSFDS 1152

 Score = 92.4 bits (228), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 61/157 (38%), Positives = 88/157 (56%), Gaps = 20/157 (12%)

Query: 396 EGRSTRKDKEEAGWVPL-NSYKNQLKARLDSKEHIXXX---------------XXXXXXX 439
           E  S +  +E    VPL +SY N LK  +DS + I                         
Sbjct: 427 EPNSVKNSRESYKNVPLLSSYANNLKREIDSSKCIILDLDSDSDDDGDDYMGGNMSIKDE 486

Query: 440 XXVPASKMSKAAVLEIKARTSKRQGIKKTRQQPSTPRAPSL--KELFSSLKKANKKQILD 497
             +P S++SKAA+L +KAR SK+   +   Q P+  +   +   +LF+ L+KA++KQILD
Sbjct: 487 SALPISRLSKAAILNLKARLSKQS--QNLTQMPNKNKGAKVDHNKLFNILRKASRKQILD 544

Query: 498 HRREITEKRGLNLEDIEREKKEVENLLEQEIERNRKI 534
           H+RE+ E +G  LED+ +EK+ VENLLEQEI RNR+I
Sbjct: 545 HQREVIETKGFKLEDMAKEKEIVENLLEQEILRNRRI 581

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 89/323 (27%), Positives = 137/323 (42%), Gaps = 63/323 (19%)

Query: 40  PQLSSASFLFGNSTIVDKVKSRLNGVSNEE-----TDGERGDALPQTQVIPNYYD-GEDL 93
           P L+   FLFGN+T+ ++VK+RL G+   E      D E  DA+  TQ+I N YD GEDL
Sbjct: 102 PALTGNGFLFGNATL-NRVKNRLEGIDVPEDDRQIKDNENEDAVS-TQLIANLYDGGEDL 159

Query: 94  EQDFVSPPKPRRVSNTGHGQDCDCDSEEQTQLMPTQETGAYESQVVPVIAPVQVSETIPV 153
           E+        + + +    +D    +  QTQ +P     + +S+ V V  P+        
Sbjct: 160 EE-------TKSMGDNASLKDG-IAAFTQTQRIPV----SIQSENV-VDVPIH------- 199

Query: 154 SINDGLLGESLFKTSKDEVKGNGGNTTRNLAEPCYGLT-QIIP-SPQYKNSQQMQLETQE 211
           SIN G         S   ++ +G  +T    +     T +IIP + Q  +S+    +TQ+
Sbjct: 200 SINQG--------KSARIIRDDGFFSTAAQTQKIIPATARIIPVATQRIHSRDTASQTQQ 251

Query: 212 AGETQEVDKTQRILEATARD--------PTLS-EEDFVAATVADGSEAV----------- 251
              T+ ++   +I+  TA D        P L+ E   +  T  D    +           
Sbjct: 252 VPFTKPIEPQTQIIGTTANDSDTQPLRIPVLTAEASLLFQTTPDCVPTIRMDPPSQIEHD 311

Query: 252 --TTQLDTCVPDTSALGDVQPTAPDQSAHRN-SQRLLIHEIEKDLDAEE-EREK-RITEA 306
              TQLDT        G  Q     Q+ H + S  L I E++ +L  E+ +REK R  E 
Sbjct: 312 KYKTQLDTMTQTAHDEGKTQVDTMPQTIHDDVSHTLKIRELQSELALEDSKREKARNVEY 371

Query: 307 KPHXXXXXXXXXXXXEAFLNNFD 329
           K              E+FL +FD
Sbjct: 372 KKSRRNIPTMINFSKESFLADFD 394

>NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_1.5
            YCL061C
          Length = 1020

 Score =  286 bits (733), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 178/394 (45%), Positives = 241/394 (61%), Gaps = 34/394 (8%)

Query: 792  VLA-RKREQ--EHKIRQKRKEMKRKGVSKMFXXXXXXXXXXWHGVGGADGELSDEYDSEL 848
            +LA +KR Q  E K   + KEMK+KGV+K+F          WHG+GGADGE+SDEYDSE+
Sbjct: 650  ILAEKKRIQLIEKKNAARTKEMKKKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEV 709

Query: 849  EKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKN--GGFRRRGKGAXXXXXX 906
            EKM+DDY+K+ F+P EIRQMLA E+KE D  ++ KIL+DIKN     RRRG         
Sbjct: 710  EKMIDDYSKSNFNPDEIRQMLALENKEMDLNMITKILYDIKNGGFRKRRRGGLDLELSDD 769

Query: 907  XXXXXXXQRYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVEDLVESKNPFSIGET 966
                   + YH ++REL+++++LE G+  KL+ NPKS AFFESMVED+V+ KN F   E+
Sbjct: 770  DEDDEELREYHKRKRELMKKRMLEIGDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIES 829

Query: 967  ADPDSGAISENDKVDNASEHGTQPDAGGQPVRTERKRIKISQEFVQRSLSFLNSKDELDN 1026
             +  S  +       +  E   Q    G     ++K+  IS+EFVQ++LSFL S  +L+ 
Sbjct: 830  IEKSSTEL-------DTQEEKEQDVTPG----VDKKKNVISEEFVQKTLSFLRSGRDLE- 877

Query: 1027 EFELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTPARTSSRTVDL----EVDGN 1082
            EF ++  LAK QH       +++EDLF+LKQ S IK    P++T+  T+DL    E   +
Sbjct: 878  EFNIEEDLAKEQHG------ENVEDLFSLKQRSTIKEFRNPSQTN--TIDLINNVENVES 929

Query: 1083 SPANGFKLPSVISSFSSRIDINEKFKEGXXXXXXXXXXXXIGGSRASITYLGKVRKLNAP 1142
            SP  GFK PSVI SFSSR DINEKFK+G            +G S+ASITYLGK RKL  P
Sbjct: 930  SPLGGFKPPSVIKSFSSRTDINEKFKDGNKTVTISKVYKTVGSSKASITYLGKSRKLMPP 989

Query: 1143 KRKESGRKPVFGHRHPEAAPKRAGLFADNDDSFE 1176
            K+ ++  K   G +     P R+ LF+ +D+SFE
Sbjct: 990  KKNKNREK--IGSK---IKPTRSSLFSSHDESFE 1018

 Score = 94.7 bits (234), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 65/159 (40%), Positives = 91/159 (57%), Gaps = 14/159 (8%)

Query: 412 LNSYKNQLKARLDSKEHIXXXXXXXXX---XXXVPASKMSKAAVLEIKARTSKRQGIKKT 468
           LN+Y+N+LK +L  K+HI                P S+ SKA +L +KAR SK++ +K  
Sbjct: 362 LNTYENKLKKKLLEKKHIQLDSDSDNDSDIAKRFPISRTSKATLLNLKARLSKKKPVKSN 421

Query: 469 RQQPSTPRAPSLKELFSSLKKANKKQILDHRREITEKRGLNLEDIEREKKEVENLLEQEI 528
           +   +     SL  LF +LK+A++KQILDH+RE+ E RG  LEDIE+EK+ VENLLE+EI
Sbjct: 422 KSTNT-----SLDVLFQNLKQASRKQILDHQRELVENRGFKLEDIEKEKEIVENLLEEEI 476

Query: 529 ERNRKIXXXXXXXXXXXXXXXXXXGGYPGDFDYSENELD 567
           +RN++I                       DFD S NEL+
Sbjct: 477 KRNKRIRMREKQKEKSLSENED------ADFDLSANELE 509

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 77/307 (25%), Positives = 125/307 (40%), Gaps = 86/307 (28%)

Query: 40  PQLSSASFLFGNSTIVDKVKSRLNGVSNEETDGERGDALP-QTQVIPNYY---------- 88
           P +    F+FGN+ ++DK+++RL+G  N+E        +P QTQ+I N Y          
Sbjct: 42  PPVIGNGFIFGNA-LIDKIRNRLDGKENKE-----DTPVPTQTQMIDNLYKDAEELEEET 95

Query: 89  ----------DGEDLEQDFVSPPKPRRVSNTGHGQDCDCDS----EEQTQLMPT-QETGA 133
                     + E ++   ++  K   + N  +  D         EE++ L+ T +E   
Sbjct: 96  IEYEKEAINKEQEVVQTQLIAKEK-EEIENIKNPSDAYLQETQPIEEKSFLLGTNKELET 154

Query: 134 YESQVV-PVIAPVQVSET------IPVSINDGL--LGESLFKTSKDEVKGNGGNTTRNLA 184
            E+QV+ PV++  Q SE       IP +    +    E++   S D         T NL 
Sbjct: 155 QETQVINPVLSESQPSENRSSNEKIPFTFTQKIQDFVETVENYSTDLSLSKDETITINL- 213

Query: 185 EPCYGLTQIIPSPQYKNSQQMQLETQEAGETQEVDKTQR-ILEATARD-PTLSEEDFVAA 242
            P +          ++ SQ++Q  T    +TQ ++ T   ++EAT  D P L+E     +
Sbjct: 214 -PNHATDNSTSKRAHRISQELQ-RTMTDMDTQVINNTNLDVIEATMADLPNLNEP---QS 268

Query: 243 TVADGSEAVTTQLDTCVPDTSALGDVQPTAPDQSAHRNSQRLLIHEIEKDLDAEEEREKR 302
           TVAD            +P T                     L IHEI+K+L    ERE+ 
Sbjct: 269 TVAD------------IPSTG--------------------LKIHEIQKEL----ERERN 292

Query: 303 ITEAKPH 309
             E K +
Sbjct: 293 SKELKEY 299

>KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1041

 Score =  283 bits (724), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 175/416 (42%), Positives = 244/416 (58%), Gaps = 37/416 (8%)

Query: 778  SGDDKEEY--EKAMRQVLARKR----EQEHKIRQKRKEMKRKGVSKMFXXXXXXXXXXWH 831
            SGD+++E   EK   +++  K+    E++ K  +KRKEMK KG++             WH
Sbjct: 647  SGDERDEEIPEKDRIRLIEEKKQHELERQRKQMKKRKEMKAKGITNFLEEEAEESEDEWH 706

Query: 832  GVGGADGELSDEYDSELEKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNG 891
            G+GG DGE+SDEYDSE+EKM+DDY+K  F+P EIRQMLA E+KE D K+V KIL+DIKNG
Sbjct: 707  GIGGIDGEMSDEYDSEVEKMIDDYSKANFNPDEIRQMLADENKETDIKMVEKILYDIKNG 766

Query: 892  GFRRRGKGAXXXXXXXXXXXXXQRYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMV 951
            GFR+R KGA             ++Y  KRREL+RQK LE GEA  LV NPKS AFFESMV
Sbjct: 767  GFRKRRKGAMDLELSDEEDDELKQYRLKRRELMRQKRLEVGEAETLVKNPKSKAFFESMV 826

Query: 952  EDLVESKNPFSIGETADPDSGAISENDKVDNASEHGTQPDAG---GQPVRTERKRIKISQ 1008
            +D+VE KNPF++ E     SG I+ +D        GTQ +A    G   +   K++ +S+
Sbjct: 827  DDIVEVKNPFAVFEPQ--RSGTITTDD--------GTQENANSNEGAASQNPSKKVMLSE 876

Query: 1009 EFVQRSLSFLNSKDELDNEFELDRRLAKHQHSTLGDDNDDL-EDLFTLKQNSCIKTLHTP 1067
            EFVQR+LSFLNS  ++D +F   R       S   + ND+L EDL  LK+ S IK+  T 
Sbjct: 877  EFVQRTLSFLNSSKDMD-QFAPAR-------SMRAEANDELIEDLTALKKQSSIKSFKTT 928

Query: 1068 -ARTSSRTVDLEVDGNSPANGF-----KLPSVISSFSSRIDINEKFKEGXXXXXXXXXXX 1121
             A  S    D + + +   +          S++ +FS+ +DIN+KF+EG           
Sbjct: 929  RASVSQEPTDFDKENDDSFDDLLNSRVGTSSIMKTFSATVDINDKFQEGVKTVKVSKAYK 988

Query: 1122 XIGGSRASITYLGKVRKLNAPKRKESGRKPVFGHRHPEAAPKRAGLFADNDDSFEA 1177
             +  S+ASITY+GK+RKL AP++K +    +          + + LF+  D+SFE+
Sbjct: 989  SVSSSKASITYMGKMRKLVAPQKKVAN---LSSSDIKNTNSRTSKLFSRQDESFES 1041

 Score =  106 bits (264), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 68/162 (41%), Positives = 93/162 (57%), Gaps = 12/162 (7%)

Query: 412 LNSYKNQLKARLDSKEHIXXXXXXXXXX------XXVPASKMSKAAVLEIKARTSKRQGI 465
           LN+Y+ +LK +L+S + I                   P S+MSKA V +IKAR SK++ I
Sbjct: 393 LNNYELKLKRQLNSDQQIDLNLDSDDEDGIDRMGEKGPISQMSKATVFDIKARLSKKRPI 452

Query: 466 KKTRQQPSTPRAPSLKELFSSLKKANKKQILDHRREITEKRGLNLEDIEREKKEVENLLE 525
            K      T    +L  LF+ L+KA+++QI++H++E+ EK+GLNLEDIE+EKK VENLLE
Sbjct: 453 VKISNDSKT----TLHTLFNKLQKASRQQIIEHQKEVIEKKGLNLEDIEKEKKIVENLLE 508

Query: 526 QEIERNRKIXXXXXXXXXXXXXXXXXXGGYPGDFDYSENELD 567
           QEI RN+KI                       DFD+S NELD
Sbjct: 509 QEINRNKKIRQREKEREKQLADAQDDENDL--DFDHSANELD 548

>Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON}
            complement(11914..14871) [2958 nt, 986 aa]
          Length = 985

 Score =  280 bits (717), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 170/404 (42%), Positives = 242/404 (59%), Gaps = 30/404 (7%)

Query: 779  GDDKEEYEKAMRQVLARKREQEHKIRQKRKEMKRKGVSKMFXXXXXXXXXXWHGVGGADG 838
             +D+E Y++ +++ + R+R+QE K RQK +E+K KG++ MF          WHG+GG DG
Sbjct: 605  SEDEELYKEMVKKEIDRRRDQERKQRQKLRELKDKGITDMFEVEAEESEDEWHGIGGVDG 664

Query: 839  ELSDEYDSELEKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFRRRGK 898
            ELSDEYDSE+EKM+DDY+K  F+  EIR+ LAAE+K+ D K+VN+IL+DIKNGGFR+R +
Sbjct: 665  ELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAENKDMDLKMVNRILNDIKNGGFRKR-R 723

Query: 899  GAXXXXXXXXXXXXXQRYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVEDLVESK 958
             A             + Y AKRR+L+++K LE     KL++N KSHAF ESMV+D+VE K
Sbjct: 724  NALEIELSDDEDDDLKAYRAKRRQLMKEKRLETDHNKKLMTNKKSHAFLESMVDDIVEVK 783

Query: 959  NPFSIGETADPDSGAISENDKVDNASEHGTQPDAGGQPVRTERKRIKISQEFVQRSLSFL 1018
            NPF      D     I     +D+  E   + D     +  ++K+  +S+ FVQ+SLSFL
Sbjct: 784  NPF------DERDDNI-----MDDTPETDAEGDVNSNELLNKKKKFILSEAFVQKSLSFL 832

Query: 1019 NSKDELDNEFELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTPARTSSRTVDLE 1078
            +S   L+ EFE++  LAK QHS          D+F LK +  IK+L +   + + ++  +
Sbjct: 833  SSSRNLE-EFEMNNNLAKEQHSHAA------TDMFALKSHCSIKSLESLPGSHNNSISSK 885

Query: 1079 VD------GNSPANGFKLPSVISSFSSRIDINEKFKEGXXXXXXXXXXXXIGGSRASITY 1132
            +D       ++P +G K  SVI SFSS IDI+ KFK+G            +G ++ASITY
Sbjct: 886  LDLLHEEIVSTPFSGLKQTSVIKSFSSSIDIDSKFKDGNKTVKVSKSYRTVGSAKASITY 945

Query: 1133 LGKVRKLNAPKRKESGRKPVFGHRHPEAAPKRAGLFADNDDSFE 1176
            LGK RKL  PK+KE   KP   H H       + LF + D+SFE
Sbjct: 946  LGKARKLVPPKKKE--HKP---HSHKSKTASASRLFDEQDNSFE 984

 Score = 79.7 bits (195), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 78/129 (60%), Gaps = 5/129 (3%)

Query: 406 EAGWVPLNSYKNQLKARLDSKEHIXXXXXXXXXXXXVPASKMSKAAVLEIKARTSKRQGI 465
           E+ ++ L++Y+N LK  ++ +  I               S+ SKA +L IKA  S+ +  
Sbjct: 320 ESKFIGLSNYENILKKDINKQNCIEFSDSEDETEVTSKVSRASKATILSIKANLSRHKPA 379

Query: 466 KKTRQQPSTPRAPSLKELFSSLKKANKKQILDHRREITEKRGLNLEDIEREKKEVENLLE 525
                Q S     +L  LFS LKKA K QILDH++EI E++G  +E+IE+EK+ VENLLE
Sbjct: 380 -----QSSINNKNALGNLFSDLKKATKAQILDHKKEIMEQKGYKMEEIEKEKEIVENLLE 434

Query: 526 QEIERNRKI 534
           QEIERNRKI
Sbjct: 435 QEIERNRKI 443

>KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1161

 Score =  269 bits (688), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 148/374 (39%), Positives = 225/374 (60%), Gaps = 29/374 (7%)

Query: 781  DKEEYEKAMRQVLARKREQEHKIRQKRKEMKRKGVSKMFXXXXXXXXXXWHGVGGADGEL 840
            D++E+ +A+ +   +   +E K+  KR E+K KGVS  F          WHG+GG DGE+
Sbjct: 776  DEKEHARAVDKERLKTIMKEKKLMLKRAELKEKGVSNFFEEEAEESEDEWHGIGGIDGEV 835

Query: 841  SDEYDSELEKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFRRRGKGA 900
            SDEYDSE+EKM+DDY++   DP EIR++L +E+KE D K+VNKIL DIKNG FR+RG+  
Sbjct: 836  SDEYDSEVEKMIDDYSRADMDPEEIRKLLVSENKEMDVKMVNKILFDIKNGNFRKRGRDT 895

Query: 901  XXXXXXXXXXXXXQRYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVEDLVESKNP 960
                         ++Y  KR EL++Q++L+ G+  KLV N K+ AFF+S+VED+VE KNP
Sbjct: 896  LELELSDEEDDDLRQYRQKRNELMKQRLLDLGDDKKLVKNVKTKAFFDSLVEDIVEVKNP 955

Query: 961  FSIGETADPDSGAISENDKVDNASEHG-------TQPDAGGQPVRTERKRIKISQEFVQR 1013
            F          G +S+N+  D             +  +   +P + + K+  +S+EFVQR
Sbjct: 956  F----------GVMSDNETQDTDETTTIDTQTRESVSNKEEKPTQEKGKKTVLSEEFVQR 1005

Query: 1014 SLSFLNSKDELDNEFELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTPARTSSR 1073
            SLSFLNS   L  EFE ++ LA+ QH      +DD+ DL+TLK+ S +K+  +   + + 
Sbjct: 1006 SLSFLNSNRNL-TEFEQNQDLARLQH------DDDVSDLYTLKKQSSVKSFKSVG-SKNE 1057

Query: 1074 TVDLEVDGNS----PANGFKLPSVISSFSSRIDINEKFKEGXXXXXXXXXXXXIGGSRAS 1129
             ++++ + NS        F+ PS+I SF+S++++++KF+ G            +GGS+ S
Sbjct: 1058 IINVDANDNSGTAVATATFRPPSIIKSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTS 1117

Query: 1130 ITYLGKVRKLNAPK 1143
            +TY+ KVRKL APK
Sbjct: 1118 VTYMNKVRKLTAPK 1131

 Score = 65.9 bits (159), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 59/88 (67%), Gaps = 4/88 (4%)

Query: 444 ASKMSKAAVLEIKARTSKRQGIKKTRQQPSTPRAPSLKELFSSLKKANKKQILDHRREIT 503
            S+ SKAAVL IKA+  K++ I K      T    +L  LFS LKK N++QIL H+ EI 
Sbjct: 548 VSQASKAAVLNIKAKALKKKAIVKAANTNKT----TLDSLFSDLKKKNRQQILSHQAEII 603

Query: 504 EKRGLNLEDIEREKKEVENLLEQEIERN 531
             +G+N +D+EREK+ VE+LLEQEI RN
Sbjct: 604 GTKGINHKDLEREKEIVEDLLEQEILRN 631

 Score = 39.3 bits (90), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%), Gaps = 9/61 (14%)

Query: 42  LSSASFLFGNSTIVDKVKSRLN-----GVSNEETDGERGDALP--QTQVIPNYYD-GEDL 93
           L+   FLFGN+T VDK+K+RLN       S + T     D +P  Q+Q++   YD GEDL
Sbjct: 41  LAGNGFLFGNAT-VDKIKNRLNNEDHPNSSIDVTKSSSEDQIPVSQSQLLSTLYDGGEDL 99

Query: 94  E 94
           E
Sbjct: 100 E 100

>TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5
            YCL061C
          Length = 965

 Score =  259 bits (661), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 162/403 (40%), Positives = 230/403 (57%), Gaps = 34/403 (8%)

Query: 785  YEKAMRQVLARKREQEHKIRQKRKEMKRKGVSKMFXXXXXXXXXXWHGVGGADGELSDEY 844
            Y   + + + +++E E +  ++ KEMK  GVSKMF          WHG+GG D + SD Y
Sbjct: 586  YNAIISEGIRKQKELEKREAKRLKEMKTSGVSKMFEVEAEESEDEWHGIGGVDSDFSDAY 645

Query: 845  DSELEKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFRRRGKGAXXXX 904
            DSE+EKM+DDY++  F+P+EIR+MLA E+KE D  +VNKIL+DIKNGGFR R +      
Sbjct: 646  DSEVEKMIDDYSRQNFNPSEIREMLAKENKETDLALVNKILYDIKNGGFRTRKRRDRDLE 705

Query: 905  XXXXXXXXXQRYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVEDLVESKNPF--- 961
                     + Y AKRR L+R+K L+     K+V NPKS AFFES+V+D++E+KNPF   
Sbjct: 706  FSDDDDDDLKAYRAKRRALMREKRLDIEGDKKIVKNPKSKAFFESIVDDIIETKNPFDDM 765

Query: 962  --SIGETADPDSGAISENDKVDNASEHGTQPDAGGQPVRTERKRIKISQEFVQRSLSFLN 1019
              SI +  + ++  +     +DN  +  T        V  ++K+I IS+EFVQRSLSFLN
Sbjct: 766  NTSIEQIVEKETPTVD----IDNDEKLATN-------VTKKKKKIVISEEFVQRSLSFLN 814

Query: 1020 SKDELDNEFELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTPARTSSRTVDLEV 1079
            S  E D EFE++     +QH+  G+      DL+TLK+ S IKTL +   + S ++   +
Sbjct: 815  SCREQD-EFEIN-----NQHNG-GEKATSTADLYTLKRYSSIKTLQSVTSSRSSSIASNL 867

Query: 1080 D------GNSPANGFKLPSVISSFSSRIDINEKFKEGXXXXXXXXXXXXIGGSRASITYL 1133
            +        S  N  +  SV++SFSS +DIN KFKEG            +G +RASITY+
Sbjct: 868  NEQPSQSSGSLFNDLRKTSVLNSFSSDVDINSKFKEGTKSVKVSNAYKTVGSARASITYM 927

Query: 1134 GKVRKLNAPKRKESGRKPVFGHRHPEAAPKRAGLFADNDDSFE 1176
            G  R+L APK+    R       +    P R  LF + + SFE
Sbjct: 928  GTSRRLVAPKK---SRLTTSSKANSRTTPSR--LFDNQEGSFE 965

 Score = 66.2 bits (160), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 52/159 (32%), Positives = 88/159 (55%), Gaps = 13/159 (8%)

Query: 412 LNSYKNQLKARLDSKEHIXXXXXXXXXXXXVPASKMSKAAVLEIKARTSKRQGIKKTRQQ 471
           L +Y++ L+ + ++++ I            +  S  SKA +L I+A         K++QQ
Sbjct: 323 LGNYEHNLRRKANNEQIIEFSESDEDSDTNISPSYASKAVILNIRAN--------KSKQQ 374

Query: 472 PSTPRAP---SLKELFSSLKKANKKQILDHRREITEKRGLNLEDIEREKKEVENLLEQEI 528
           P   +     +L  L+++LK+A+K+QI+ +++E+ EK+G+NLE++E+E + VENLLEQEI
Sbjct: 375 PKVSQKSDQTTLLMLYNNLKRASKEQIVSYQKELMEKKGINLEELEKENEIVENLLEQEI 434

Query: 529 ERNRKIXXXXXXXXXXXXXXXXXXGGYPGDFDYSENELD 567
            RN+KI                     P +FD S NEL+
Sbjct: 435 ARNQKIRQREKQKQKKENQDDLNSN--PEEFDLSANELE 471

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 35/67 (52%), Gaps = 17/67 (25%)

Query: 47  FLFGNSTIVDKVKSRLNGVSNEETDG---------------ERGDALPQTQVIPNYYD-G 90
            LFGNS I+ ++++RLN + NE+ D                +     PQTQ+I N YD G
Sbjct: 51  ILFGNS-ILGQIRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQIINNLYDGG 109

Query: 91  EDLEQDF 97
           EDLE + 
Sbjct: 110 EDLENEI 116

>KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON}
            weakly similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 925

 Score =  253 bits (646), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 155/381 (40%), Positives = 218/381 (57%), Gaps = 51/381 (13%)

Query: 795  RKREQEHKIRQKRKEMKRKGVSKMFXXXXXXXXXXWHGVGGADGELSDEYDSELEKMVDD 854
            R+R +    +++++ +K  G++K+           WHGVGGADGE SD+YDS+L+ M+DD
Sbjct: 595  RRRMEIEAAKKRKQVLKSTGLNKILEMEAEESEDEWHGVGGADGENSDDYDSDLDTMIDD 654

Query: 855  YTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFRRRGKGAXXXXXXXXXXXXXQ 914
            ++K+ FD A IR+ LA E+KE DE+++NKILHDI  GGFR+RG+GA             +
Sbjct: 655  FSKSKFDTASIRERLALENKEMDERMINKILHDINTGGFRKRGRGALDLELSDDEDELLR 714

Query: 915  RYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVEDLVESKNPFSIGETADPDSGAI 974
            ++  KRRE+++QK+LEN +   +V+N KS AFF+SMVED+     P            A+
Sbjct: 715  QFREKRREIMKQKLLENVDG--VVNNSKSKAFFDSMVEDITRKSIP------------AV 760

Query: 975  SENDKVDNASEHGTQPDAGGQPVRTERKRIKISQEFVQRSLSFLNSKDELDNEFELDRRL 1034
            +        S   T+ + G       +K+I IS+EFVQ SLSFL++KD+  NEFE+    
Sbjct: 761  T--------SFSNTRDEMG-------KKKIVISEEFVQSSLSFLSAKDDDINEFEVTE-- 803

Query: 1035 AKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTPARTSSRTVDLEVDGNSPANGFKLPSVI 1094
            A H         D  EDL +LKQ S IK+L +P R  +     +VDG S    FKLPS++
Sbjct: 804  AAH---------DATEDLESLKQRSNIKSLDSPQRNRNSAFFDDVDGTSL--DFKLPSIV 852

Query: 1095 SSFSSRIDINEKFKEGXXXXXXXXXXXXIGGSRASITYLGKVRKLNAPKRKESGRKPVFG 1154
             SFSS  D+N+KFK G              GSR++IT+LGK RKL AP+    GRK    
Sbjct: 853  KSFSSNSDVNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAPQ----GRKSTPL 908

Query: 1155 HRHPEAAPKRAGLFADNDDSF 1175
             R P ++     LF  N DSF
Sbjct: 909  VRKPTSS-----LFDSNSDSF 924

 Score = 87.0 bits (214), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 65/90 (72%), Gaps = 2/90 (2%)

Query: 445 SKMSKAAVLEIKARTSKRQGIKKTRQQPSTPRAPSLKELFSSLKKANKKQILDHRREITE 504
           S+ SKAA+L IKA+ S+ +  K      ST    SLKELF+SLK  N+ QIL+ RREI+ 
Sbjct: 336 SQSSKAALLLIKAKRSRNKATKAKNMHVST--VDSLKELFTSLKTKNRDQILEFRREISG 393

Query: 505 KRGLNLEDIEREKKEVENLLEQEIERNRKI 534
           K+G++LE IE EK +VE LLEQE+ERNR++
Sbjct: 394 KKGISLEAIEDEKIQVEKLLEQELERNRRV 423

>AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YCL061C (MRC1)
          Length = 1018

 Score =  249 bits (636), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 153/400 (38%), Positives = 230/400 (57%), Gaps = 38/400 (9%)

Query: 781  DKEEYEKAMRQVLARKREQEHKIRQKRKEMKRKGVSKMFXXXXXXXXXXWHGVGGADGEL 840
            D+E   K +  +LAR R++  + + +R+EMK+KG++KM           WHG+GG+D EL
Sbjct: 652  DQETRRKILSDLLARNRKRAERNKLRRREMKKKGITKMLEMEAEESEDEWHGIGGSDNEL 711

Query: 841  SDEYDSELEKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFRRRGKGA 900
            S++YDSE+EKM+DDY+  + +   +R +LA  ++++DE IVNKILHDI  GGFRRRGKGA
Sbjct: 712  SEDYDSEVEKMIDDYSVHSSNADHLRAILAKNERQHDENIVNKILHDISTGGFRRRGKGA 771

Query: 901  XXXXXXXXXXXXXQRYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVEDLVESKNP 960
                         Q++  KRRELL+QK+LENG+ SKLVSNPKS+AFF++MV+D+ E+   
Sbjct: 772  LDLEMSENEDQELQQFRQKRRELLKQKILENGDTSKLVSNPKSYAFFQTMVDDVTEA--- 828

Query: 961  FSIGETADPDSGAISENDKVDNASEHGTQPDAGGQPVRTERKRIKISQEFVQRSLSFLNS 1020
             S G T D +   I E           T P A G       ++I IS++FV+ +LSFL+S
Sbjct: 829  -SFGNTFDAN---IDEK----------TDPSAAG-------RKIVISEQFVKETLSFLSS 867

Query: 1021 KDELDNEFELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTPARTSSRTVDLEVD 1080
            K     + E+         ST+  + ++++DL TLKQNS IK L       ++  +L   
Sbjct: 868  K---SGDSEIPAETKSISSSTV--EREEIQDLHTLKQNSNIKHLKGSLELPAQMAELS-S 921

Query: 1081 GNSPANGFKLP---SVISSFSSRIDINEKFKEGXXXXXXXXXXXXIGGSRASITYLGKVR 1137
            G+    GF L    S   SF++  ++++KFK G            IGGS+A+IT++G+ R
Sbjct: 922  GDEGDYGFSLDRFRSAAKSFNNGTNVDDKFKSGTKAVRILKANKTIGGSKAAITFIGRKR 981

Query: 1138 KLNAPKRKESGRKPVFGHRHPEAAPKRAGLFAD-NDDSFE 1176
            +L  PK      +P        +   R+ LF++ N+ SF+
Sbjct: 982  RLIPPKNDYKDSEPKLN----SSKRARSQLFSEGNNRSFD 1017

 Score = 71.6 bits (174), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 62/88 (70%), Gaps = 10/88 (11%)

Query: 444 ASKMSKAAVLEIKARTSKR---QGIKKTRQQPSTPRAPSLKELFSSLKKANKKQILDHRR 500
           +S +SKAAVL IKAR SK    Q I +T+   S        ELF+ L+KAN++Q+L+ RR
Sbjct: 381 SSAVSKAAVLAIKARNSKFITPQKIDETKSSKSN-------ELFAKLRKANREQLLEQRR 433

Query: 501 EITEKRGLNLEDIEREKKEVENLLEQEI 528
              E+RG+N++++E+E++++ NLLEQE+
Sbjct: 434 NAIERRGINMQNLEQEREQLGNLLEQEL 461

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 82/310 (26%), Positives = 137/310 (44%), Gaps = 49/310 (15%)

Query: 34  DEEKKQPQLSSASFLFGNSTIVDKVKSRLNGVSNEETDGERGDAL-PQTQVIPNYYDGED 92
           ++ K +P  +  + +F  S+++D+V++RLN    E+      DAL P++ +  + YDGE+
Sbjct: 26  EQSKDEPSSNKPAAVF-RSSLLDRVRTRLNV---EDGHAPSSDALEPESGLTDDVYDGEN 81

Query: 93  LEQDFVSPPKPRRVSNTGHGQDCDCDSEEQTQLMPTQETGAYESQVVPV-IAPVQVSE-- 149
           LE  F          + G  +D DC        +PTQ  G  E   V V  AP +     
Sbjct: 82  LEVSF----------DVGDAED-DC--------LPTQADGKPEQIEVNVGTAPEEPFSRI 122

Query: 150 TIPVSINDGLLGESLFKTSK---DEVKGNGGNTTRNLAEPCYGLTQIIPSPQYKNSQ--- 203
            IP+ ++DG     +F  S    DE+            +P   L    P+ Q  ++    
Sbjct: 123 KIPLKLSDG----GIFSPSTQVDDEMAMQ--------LQPTQKLPPESPALQAVDTHTEL 170

Query: 204 QMQLETQEAGETQ-EVDKTQRILEATARDPTLSEEDFVAATVADGSEAVTTQLDTCVPDT 262
           Q +LET  A + +  + +TQ I+  T   PT  +++ VA        A     DT   D 
Sbjct: 171 QDELETGVAVDGRISLSQTQVIVSGTNYGPTRVDDEVVATQQDSMGTADAQCWDTQTLDC 230

Query: 263 SALGDVQPTAPDQS--AHRNSQRLLIHEIEKDLDAEEERE-KRITEAKPHXXXXXXXXXX 319
           +   D Q T PD    A    ++L IH+IE+++  + ++E   +T+AK            
Sbjct: 231 ALADDFQATIPDAQTLATARHEKLFIHQIEEEIATKTQKELPMMTQAKEAPYIPKQKLVF 290

Query: 320 XXEAFLNNFD 329
             + FL++FD
Sbjct: 291 TKDNFLDSFD 300

>CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {ON}
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061c
          Length = 1136

 Score =  247 bits (630), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 150/374 (40%), Positives = 216/374 (57%), Gaps = 26/374 (6%)

Query: 780  DDKEEYEKAMRQVLARKREQEHKIRQKRKEMKRKGVSKMFXXXXXXXXXXWHGVGGADGE 839
            D ++E   A++Q + R++E+E K R+K +E+  KGV++ F          W G+GG DG+
Sbjct: 768  DTEQERIAAIKQQVKRQQEREVKERKKLQELANKGVNQYFEEEAEESDDEWRGIGGVDGD 827

Query: 840  LSDEYDSELEKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFRRRGKG 899
               EYDSE+EKM+DDY+KT  D   +RQ +  E+KE D K+VNKIL+DIKNGGFR+RG+ 
Sbjct: 828  DFGEYDSEVEKMIDDYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNGGFRKRGRN 887

Query: 900  AXXXXXXXXXXXXXQRYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVEDLVESKN 959
                          Q +  KRREL++Q++LEN +  KL  NPKS AFFESM+ DLVE KN
Sbjct: 888  DMELEFSDDEDAELQEFRRKRRELMKQRMLENEDTDKLTKNPKSKAFFESMIVDLVEDKN 947

Query: 960  PFSIGETADPDSGAISENDKVDNASEHGTQPD---AGGQPVRTERKRIKISQEFVQRSLS 1016
             F               +D+++   E+ TQ D      +    +R +I+IS++FVQ++LS
Sbjct: 948  NFD------------DLSDQIELKEENITQEDNEKEYNEAKSNKRGKIRISEDFVQKTLS 995

Query: 1017 FLNSKDELDNEFELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTPARTSSRTVD 1076
            FL++ DE   EF+    ++K +   +GD N        LK NS + +  +   TS + ++
Sbjct: 996  FLHN-DESTQEFQPSFIMSKEKG--IGDMN-------ALKSNSSL-SFCSKLSTSRKIIN 1044

Query: 1077 LEVDGNSPANGFKLPSVISSFSSRIDINEKFKEGXXXXXXXXXXXXIGGSRASITYLGKV 1136
             E D       FK PS+I SFSS+  I++KFK+G            +GGS+ASITYLGK 
Sbjct: 1045 DEEDVIEEFESFKRPSIIQSFSSKFTIDDKFKDGNKSVKVSTSYKTVGGSKASITYLGKT 1104

Query: 1137 RKLNAPKRKESGRK 1150
            RKL  PK   + RK
Sbjct: 1105 RKLVPPKNGPTVRK 1118

 Score = 81.6 bits (200), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 75/125 (60%), Gaps = 7/125 (5%)

Query: 412 LNSYKNQLKARLDSKEHIXXXXXXXXXXXXV--PASKMSKAAVLEIKARTSKRQGIKKTR 469
           L +Y N LK ++++K+              V    S  SKA +L +K R SK++ +KK  
Sbjct: 498 LPAYVNNLKQKVENKKLQLSSDSDDEVDSAVIYKLSNKSKATLLNLKVRLSKKKPVKKVH 557

Query: 470 QQPSTPRAPSLKELFSSLKKANKKQILDHRREITEKRGLNLEDIEREKKEVENLLEQEIE 529
            +  +        LF++L+KA K+QI+ HR+E+ E RGLN ED+E++K  VE+LLE+EIE
Sbjct: 558 NEKDSTNL-----LFNNLRKATKQQIMLHRKELMESRGLNFEDLEKQKVMVEDLLEKEIE 612

Query: 530 RNRKI 534
           RN KI
Sbjct: 613 RNLKI 617

>Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON}
            similar to Ashbya gossypii AFR745W
          Length = 1118

 Score =  243 bits (619), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 159/403 (39%), Positives = 225/403 (55%), Gaps = 50/403 (12%)

Query: 787  KAMRQVLARKREQEHKIRQKRKEMKRKGVSKMFXXXXXXXXXXWHGVGGADGELSDEYDS 846
            K +++++ + R QE   RQK+KEM++ GV+KM           WHGVGG D E SDEYDS
Sbjct: 754  KIVKELMLKLRLQEKIKRQKQKEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDS 813

Query: 847  ELEKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFRRRGKGAXXXXXX 906
            +L+KM+DDY K  FDP EIR++LA+ED ++D+ +VNKILHDIK GGFR+RG+G       
Sbjct: 814  DLDKMIDDYNKNEFDPVEIRKILASEDLQHDKNMVNKILHDIKTGGFRKRGRGELDLELS 873

Query: 907  XXXXXXXQRYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVEDLVESKNPFSIGET 966
                   Q Y AKR    +QK+L++   + + SNPKS  FFESMV++       F+I   
Sbjct: 874  EDEDGILQSYRAKRWNEQKQKMLDSEHNTSVKSNPKSLPFFESMVDE-------FTI--- 923

Query: 967  ADPDSGAISENDKVDNASEHGTQPDAGGQPV----RTERKRIKISQEFVQRSLSFLNSKD 1022
              P   A+   D           P A    V    +  +++I IS+ FV+++LSFL S +
Sbjct: 924  --PVERALGTPD----------SPPAQSTNVLELKQNTKQKIVISEHFVKQTLSFLTSDE 971

Query: 1023 ELDN---EFELDRRLAKHQHSTLGDDND----DLEDLFTLKQNSCIKTLHTPARTSSRTV 1075
             + N   E  +++           +DND    ++EDL+TLK+ S IK L+T   +    V
Sbjct: 972  NMTNMRSEINVEKP---------NNDNDIYSSEVEDLYTLKETSTIKVLNT--YSGKPIV 1020

Query: 1076 DLEVDGNSPANGFKLPSVISSFSSRIDINEKFKEGXXXXXXXXXXXXIGGSRASITYLGK 1135
            + + DG     GFK PSV+ +F SR D+N+KFK+G            +G SRA+IT+LGK
Sbjct: 1021 NEDEDG--AEFGFKAPSVMQTFGSRNDVNDKFKDGFKSVKISNKYKTLGSSRAAITFLGK 1078

Query: 1136 VRKLNAPKRKESGRKPV-FGHRHPEAAPKRAGLFADNDDSFEA 1177
             RKL  PKR  S + P    HR  +   K    F +N D+FEA
Sbjct: 1079 KRKLIIPKR--SSKSPRDSAHRSIKNRLKHQA-FLENTDTFEA 1118

 Score =  108 bits (269), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 108/356 (30%), Positives = 164/356 (46%), Gaps = 63/356 (17%)

Query: 188 YGLTQIIPSPQYKNSQQMQLETQEAGETQEVDKTQRILEATARDP-TLSEEDFVAATVAD 246
           Y  TQII + Q+   +    ETQ   E  + D  + +  A   D  TLS       T+AD
Sbjct: 225 YTQTQIIKNIQFDEGKYS--ETQLIPEITDDDDCRSLHNAQGPDSQTLS-------TLAD 275

Query: 247 GSEAVTTQLDTCVPDTSALGDVQPTAPDQ---SAHRNSQRLLIHEIEKDLDAEEEREKRI 303
             E+  ++             ++ T P+Q    +++  + L IH+ ++DL   E+   ++
Sbjct: 276 TLESKLSE------------KLRATVPNQVISQSNKKKEELAIHKFQRDLGEAEDENNKV 323

Query: 304 TEAKPHXXXXXXXXXXXXEAFLNNFDCXXXXXXXXXXXXXXXXXXXXXXPASKRRKLFTS 363
           TE                EAFL++F+                        +S   ++  +
Sbjct: 324 TEHILPSYVALQNHIFTKEAFLDDFELSGQEVDY----------------SSTATRVKET 367

Query: 364 VPGNPLDSKDSEAGGSGNFXXXXXXXXXXXXDEGRSTRKDKEEAGWVPLNSYKNQL--KA 421
           V      S D  +  S N                R    ++ +   +PL S KN +    
Sbjct: 368 V------SNDISSDVSSNTNAVYDNLTDNFGTITRDAYAEEAKPPLLPLQSMKNTVGQDI 421

Query: 422 RLDS---KEHIXXXXXXXXXXXXVPASKMSKAAVLEIKARTSKRQGIKKTRQQPSTPRAP 478
            LDS   +EH                S M KAA+L IKA+ SK   + K  +Q  +  +P
Sbjct: 422 ILDSSSDEEH---------ASNQFATSTMVKAALLNIKAKISKNMNLSKNAEQ--SINSP 470

Query: 479 SLKELFSSLKKANKKQILDHRREITEKRGLNLEDIEREKKEVENLLEQEIERNRKI 534
           +LK+LF SLKKANKKQILDHRREITEKRG++LE +E+E+++VE+LLEQ+I+RNR+I
Sbjct: 471 TLKQLFISLKKANKKQILDHRREITEKRGISLEQLEQEREKVEDLLEQKIKRNRRI 526

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 6/57 (10%)

Query: 43 SSASFLFGNSTIVDKVKSRLNGVSNEETDGERGDALPQ--TQVIPNYYDGEDLEQDF 97
          S+A  +F N+ IVDKV++RL G     +  +R D L    ++ + N YDGE LE+DF
Sbjct: 36 SNAENVFANA-IVDKVRNRLEGTI---SSPDRLDTLSSKLSETVGNLYDGEALEEDF 88

>ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weakly
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 960

 Score =  236 bits (602), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 153/393 (38%), Positives = 214/393 (54%), Gaps = 39/393 (9%)

Query: 789  MRQVLARKREQEHKIRQKRKEMKRKGVSKMFXXXXXXXXXXWHGVGGADGELSDEYDSEL 848
            +R++  RK+++E ++    K+MK KG++KM           W GVGG DG+LSDE+DS+L
Sbjct: 603  IRKIEMRKKKKEQRL----KDMKAKGLNKMLEMEAEESEDEWKGVGGVDGDLSDEHDSDL 658

Query: 849  EKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFRRRGKGAXXXXXXXX 908
            E+M+DD+TK+  +  ++RQ+LA E+KE DEK+VNKIL+DIKNGGFR+RG+ A        
Sbjct: 659  EEMIDDFTKSNENFDDVRQLLAKENKELDEKMVNKILYDIKNGGFRKRGRNALDLELSDD 718

Query: 909  XXXXXQRYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVEDLVESKNPFSIGETAD 968
                 + Y  KRREL+++  +E  +  K   N KS AF ESMV+D+ ESKNPF      D
Sbjct: 719  EDEDLRNYRLKRRELMKKSRIEGKDKEKAFRNAKSKAFLESMVDDIDESKNPF-----GD 773

Query: 969  PDSGAISENDKVDNASEHGTQPDAGGQPVRTERKRIKISQEFVQRSLSFLNSKDELDNEF 1028
            P+              E  T  D         +++  +SQEFVQRSLSFL S +    EF
Sbjct: 774  PEMDV-----------EDNTDVDTQENDYPKNKEKNTLSQEFVQRSLSFL-SNNNSSREF 821

Query: 1029 ELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTPARTSSRTVDLEVDGNS----P 1084
            EL  ++      TLGD+    +D+ +LK+NS I  LH  +  S    DLE +        
Sbjct: 822  ELGEQI------TLGDEE---QDVSSLKRNSSIHALHNSS--SPIKEDLEKENQDEDFIT 870

Query: 1085 ANGFKLPSVISSFSSRIDINEKFKEGXXXXXXXXXXXXIGGSRASITYLGKVRKLNAPKR 1144
               FK PS+I S +   D N KF+ G            +GGSR+SITY GK+RKL  PK 
Sbjct: 871  LPNFKPPSLIKSLAGGFDPNNKFQSGKKTVTVSKSYRAVGGSRSSITYFGKMRKLVGPKN 930

Query: 1145 KESGRKPVFGHRHPEAAPKRAGLFADNDDSFEA 1177
            + S      G R P + P    L+    +SF+ 
Sbjct: 931  RNSTLSK--GPR-PASKPTMGKLWESQQNSFDT 960

 Score = 96.7 bits (239), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/122 (46%), Positives = 81/122 (66%), Gaps = 7/122 (5%)

Query: 415 YKNQLKARLDSKEHIX--XXXXXXXXXXXVPASKMSKAAVLEIKARTSKRQGIKKTRQQP 472
           Y+ +LK  LDSK  I              VP S++SKA VL+IKAR SK++ + K +Q+ 
Sbjct: 330 YEYKLKGELDSKRCIQLDDDEDESDEDVEVPLSRVSKATVLDIKARRSKQEPLSKIKQKK 389

Query: 473 STPRAPSLKELFSSLKKANKKQILDHRREITEKRGLNLEDIEREKKEVENLLEQEIERNR 532
           +T     L +L  +LKKA+KKQI DH+ E+ + RG  LEDIE++K+E+ENLLEQEI RN+
Sbjct: 390 TT-----LNDLICTLKKASKKQITDHQNELMKSRGYKLEDIEKQKEEIENLLEQEIARNK 444

Query: 533 KI 534
           ++
Sbjct: 445 RL 446

 Score = 38.9 bits (89), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 76/307 (24%), Positives = 125/307 (40%), Gaps = 78/307 (25%)

Query: 40  PQLSSASFLFGNSTIVDKVKSRLNGVSN---------EETDGERGDALPQTQVIPNYYDG 90
           P +    FLF NSTI DKV++RL    +         +E + E+   L QTQVI + Y+G
Sbjct: 40  PPILGNGFLFQNSTI-DKVRNRLRNAEDGANKVQQKEQEQEQEQETQLNQTQVIADLYEG 98

Query: 91  -EDLEQ---DFVSPPKPRRVSNTGHGQDCDCDSEEQTQLMPTQETGAYESQVVPVIAPVQ 146
            E+LE+   + V  P  ++ S+          S+E+TQ++P   T       V     + 
Sbjct: 99  AEELEEQNKERVRLPLSKKTSSA---------SQEKTQVIPWAPTVEGVENNVEQGTDIH 149

Query: 147 VSET--IPVSINDGLLGESLFKTSKDEVKGNGGNTTRNLAEPCYGLTQIIPSPQYKNSQQ 204
             +T  +P  I+     +++    + EV+      T+ ++EP     + +  P Y  + +
Sbjct: 150 EEKTQQVPNEISYDQKTQAIQSFQQTEVEP----LTQRISEP----ERTLDVPTYAATSE 201

Query: 205 MQLETQEAGETQEVDKTQRILEATARDPTLSEEDFVAATVADGSEAVTTQLDTCVPDTSA 264
            QL+TQE     ++D +  +L                AT +D                  
Sbjct: 202 DQLDTQEQNPITQLDISNSLL--------------FQATDSDI----------------- 230

Query: 265 LGDVQPTAPDQSAHRNSQRLLIHEIEKDLDA--EEEREKRITEAKPHXXXXXXXXXXXXE 322
                P +P        QRL +H+IEK+L+   +E   +R  E +              E
Sbjct: 231 -----PKSP-------PQRLKMHDIEKELEEKRQERDHRRNIEYRAPEKPVNVKRVFSKE 278

Query: 323 AFLNNFD 329
           AFL NFD
Sbjct: 279 AFLKNFD 285

>KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON}
            weakly similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 993

 Score =  224 bits (572), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 142/390 (36%), Positives = 207/390 (53%), Gaps = 20/390 (5%)

Query: 788  AMRQVLARKREQEHKIRQKRKEMKRKGVSKMFXXXXXXXXXXWHGVGGADGELSDEYDSE 847
             +R+++ + + +E     K +++ +   S++           WHG+GG DGE  D++DS+
Sbjct: 624  VIRELIEKHKRKELLREAKLEKLHQSKASRIIDYEAEESDDEWHGIGGVDGERFDDHDSD 683

Query: 848  LEKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFRRRGKGAXXXXXXX 907
            LEKM+DDY+ + FD +E+R+    E+   D+ +VNKILHDI+ GGFR+RG+ A       
Sbjct: 684  LEKMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKILHDIETGGFRKRGRNALDLELSD 743

Query: 908  XXXXXXQRYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVEDLVESKNPFSIGETA 967
                   +YH++R+ELLRQKV   GEA  L  NPKS AFFE++VED+       S G   
Sbjct: 744  DDDEELLKYHSRRKELLRQKVSAQGEAKLLAENPKSKAFFETIVEDIR------SKGALE 797

Query: 968  DPDSGAISENDKVDNASEHGTQPDAGGQPVRTERKRIKISQEFVQRSLSFLNSKDELDNE 1027
            D     +     V+   E  +  D  G       K+  +S+ FVQ++LSFL S  E+  E
Sbjct: 798  DEGPPPVRGFSSVNAPEEKNSDSDKKG-------KKTVLSEAFVQQTLSFLTS-GEVGEE 849

Query: 1028 FELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTPARTSSRTVDLEVDGNSPANG 1087
               +  L          + ++ +D+F LKQNS IK+L  P R SS    L  D     + 
Sbjct: 850  KGPENNLGSLPTHVPSFNTEETQDIFALKQNSSIKSLSAPTRNSSNM--LIDDQEDLLSR 907

Query: 1088 FKLPSVISSFSSRIDINEKFKEGXXXXXXXXXXXXIGGSRASITYLGKVRKLNAPKRKES 1147
             +  S  + F+ R+D NEKF+EG             G S+ASITYLGK RKLNAPK+   
Sbjct: 908  KRACSFFARFTKRVDANEKFEEGKKTVRSLNSYKVAGSSKASITYLGKARKLNAPKKVAH 967

Query: 1148 GRKPVFGHRHPEAAPKRAGLFADNDDSFEA 1177
             +    GH+ P A     G+FA N +SFE+
Sbjct: 968  QQSRKRGHK-PAAG---FGIFASNSESFES 993

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 58/86 (67%)

Query: 449 KAAVLEIKARTSKRQGIKKTRQQPSTPRAPSLKELFSSLKKANKKQILDHRREITEKRGL 508
           KAA+L++KAR SK+       +   T    S + LF+SL+KANK QILD+R+E  + +G+
Sbjct: 360 KAAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKGI 419

Query: 509 NLEDIEREKKEVENLLEQEIERNRKI 534
           + + I  EK  +E+LLE+E+ RN+KI
Sbjct: 420 DYDKITEEKNSIESLLERELARNKKI 445

 Score = 52.4 bits (124), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 37/65 (56%), Gaps = 7/65 (10%)

Query: 40 PQLSSASFLFGNSTIVDKVKSRLNGVSNEETDGERGDA------LPQTQVIPNYYDGEDL 93
          P ++   FLFGNS ++ +VKSRL    N E D  +         L QTQV+   YDGEDL
Sbjct: 29 PLVTGTGFLFGNS-VLRRVKSRLGDDENHEADSTKSPIDNGCCDLSQTQVVGLAYDGEDL 87

Query: 94 EQDFV 98
          EQDF 
Sbjct: 88 EQDFA 92

>TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_1.5
            YCL061C
          Length = 1252

 Score =  217 bits (552), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 142/387 (36%), Positives = 210/387 (54%), Gaps = 37/387 (9%)

Query: 784  EYEKAMRQVLARKREQEHKIRQKRKEMKRKGVSKMFXXXXXXXXXXWHGVGGADGELSDE 843
            EY++ ++Q L +++ +E K + K +E+K+ G SKMF          W G+GGADGE+SDE
Sbjct: 842  EYKRHIKQELEKQKLKEAKKKAKLRELKKVGASKMFDMEAEESEDEWFGIGGADGEVSDE 901

Query: 844  YDSELEKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFRRRGKGAXXX 903
            YDSE+EK++DDY++  F+P EIR  L  E+KE D K+VN+IL+DIKNGGFR+R +     
Sbjct: 902  YDSEVEKLIDDYSRQDFNPDEIRNKLMNENKEMDIKMVNRILYDIKNGGFRKRNRNNIDL 961

Query: 904  XXXXXXXXXXQRYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVEDLVESKNPFSI 963
                      + Y  KRRE++++K LE     K++   KS AFF SMV+D+VE+ NPF I
Sbjct: 962  ELSDDEDDELREYRIKRREIMKKKRLEVTNTDKILKTSKSKAFFMSMVDDIVETSNPFMI 1021

Query: 964  GE-----TADPDSGAISEND----KVDNASEHGTQPDAGGQPVRTERKRIKISQEFVQRS 1014
             +     + D +  +IS  +          +   + D   +  ++ RK+  +S++FV ++
Sbjct: 1022 TQPSDDDSDDNNMDSISNKNHKDANNAKKDKKDKRTDDHARLSQSSRKKFVMSEDFVHKT 1081

Query: 1015 LSFLNSKDELDNEFELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTPARTSSRT 1074
            LSFL    E+ NEF+    + +H  S +G  N    D+ +LKQ S IKT+H  +  S  T
Sbjct: 1082 LSFLTKSKEV-NEFQ---HVNEHYKSQIGTIN----DIQSLKQKSSIKTMHVLSMMSQDT 1133

Query: 1075 -----------VDLEVDGNSPANGF--------KLPSVISSFSSRIDINEKFKEGXXXXX 1115
                        D+     S  N F        K PS+I  F S  DIN+KFK+G     
Sbjct: 1134 NVDLDASDKDDDDMIHHAGSFDNSFDDPLSSVSKAPSIIKIFGSTHDINDKFKDGNKTVT 1193

Query: 1116 XXXXXXXIGGSRASITYLGKVRKLNAP 1142
                   +GG + SIT  G+ RKL AP
Sbjct: 1194 ISNSYKTVGGMKTSITSFGR-RKLVAP 1219

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 83/162 (51%), Gaps = 9/162 (5%)

Query: 410 VPLNSYKNQLKARLDSKEHIXXXXXXXXXXXX-VPASKMSKAAVLEIKARTSKRQGIKKT 468
           V L+ Y+N+LK  L     I             +  S  SKA +L+I+ + SK++     
Sbjct: 578 VILSQYENRLKENLLYNNSIDLYSDSEENTQSDILFSTASKAQILDIRHKLSKKKP---- 633

Query: 469 RQQPSTPRAPSLKELFSSLKKANKKQILDHRREITEKRGLNLEDIEREKKEVENLLEQEI 528
            Q        +L +LF+ LKKA+KKQI DH++   E +GL LED+++EK+ VENLLEQEI
Sbjct: 634 -QVKKKTIQTNLDQLFNKLKKASKKQIFDHQKNAIESKGLKLEDLKKEKEIVENLLEQEI 692

Query: 529 ERNRKIXXXXXXXXXXXXX---XXXXXGGYPGDFDYSENELD 567
           ERNRKI                          DFD+S NEL+
Sbjct: 693 ERNRKIRAKERKRENKKNKVDDKSVQSASDEDDFDHSANELE 734

>TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1.5
            YCL061C
          Length = 941

 Score =  208 bits (529), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 142/362 (39%), Positives = 202/362 (55%), Gaps = 34/362 (9%)

Query: 787  KAMRQVLARKREQEHKIRQKRKEMKRKGVSKMFXXXXXXXXXXWHGVGGADGELSDEYDS 846
            + M +  ++ R QE K  Q+ K+MK  GV+ MF          W GVGG DGE  D+YDS
Sbjct: 581  RTMEKEKSKIRAQEEK--QRLKQMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDS 638

Query: 847  ELEKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFRRRGKGAXXXXXX 906
            +LEKM+DD++ TT +  +IRQ+L AE+KE D K VNKILHDIKNGGFR+R +        
Sbjct: 639  DLEKMIDDFSNTTSNADQIRQLLMAENKETDLKTVNKILHDIKNGGFRKRRQNNLQLELS 698

Query: 907  XXXXXXXQRYHAKRRELLRQKVLENG-EASKLVSNPKSHAFFESMVEDLVESKNPFSIGE 965
                     Y  ++ EL+R++ L+ G +  KL+ N +S AFFESMVED+++ K+PFS   
Sbjct: 699  DDEDDELLNYKKRKLELMRKRRLQFGADDKKLLKNSRSKAFFESMVEDIIDLKDPFS--- 755

Query: 966  TADPDSGAISENDKVDNASEHGTQPDAGGQPVRTERKRIKISQEFVQRSLSFLNSKDELD 1025
                +    SE DK            + G    + +++  IS EFVQ+SLSFL+S  +  
Sbjct: 756  ----NQAETSEKDK-----------KSEGLVDASNKQKDTISHEFVQQSLSFLSSSRDF- 799

Query: 1026 NEFELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTPART---SSRTVDLEVDGN 1082
            +EFE+ R   + + +T         DL +LKQ+S +KTL+ P+     S R    E D +
Sbjct: 800  SEFEVARVSQEGERNT---------DLNSLKQDSTVKTLYAPSNIISESERADHEEFDNS 850

Query: 1083 SPANGFKLPSVISSFSSRIDINEKFKEGXXXXXXXXXXXXIGGSRASITYLGKVRKLNAP 1142
                     SV+ SF   ++ N+K KEG            +GG++ASITYLGK+RKL AP
Sbjct: 851  VLPVESSYSSVVKSFGFDLNANDKLKEGRKTVTVSKSYRTVGGNKASITYLGKMRKLVAP 910

Query: 1143 KR 1144
            K+
Sbjct: 911  KK 912

 Score = 72.4 bits (176), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 63/93 (67%), Gaps = 5/93 (5%)

Query: 442 VPASKMSKAAVLEIKARTSKRQGIKKTRQQPSTPRAPSLKELFSSLKKANKKQILDHRRE 501
           V  S  +KA VL++KAR SKR+   +++   +     SL  L  +L+ + K+QILD ++E
Sbjct: 350 VSTSHEAKATVLKLKARLSKRRPPVESQHGKA-----SLSALMKNLRNSTKRQILDRQKE 404

Query: 502 ITEKRGLNLEDIEREKKEVENLLEQEIERNRKI 534
             E++GL  ED+E+EK+ VENLLEQEI RN++I
Sbjct: 405 GIERQGLKFEDVEKEKEIVENLLEQEIARNKRI 437

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 46/78 (58%), Gaps = 13/78 (16%)

Query: 28 ATQEENDEEKKQPQLSSA----SFLFGNSTIVDKVKSRLNGVSNEETDGERG-DALPQTQ 82
          A Q E+DE  + P +  A     FLF NS+ +DKVK+RLN       D E+G  A+  TQ
Sbjct: 22 AVQNEDDEYTEDPLVPPAVLGNGFLF-NSSTLDKVKNRLNK------DQEQGTQAIDTTQ 74

Query: 83 VIPNYY-DGEDLEQDFVS 99
          V+ N Y DGEDLE++  S
Sbjct: 75 VLSNLYEDGEDLEKEVPS 92

>Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON}
            YCL061C (MRC1) - protein involved in replication
            checkpoint [contig 123] FULL
          Length = 970

 Score =  204 bits (520), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 142/398 (35%), Positives = 204/398 (51%), Gaps = 28/398 (7%)

Query: 780  DDKEEYEKAMRQVLARKREQEHKIRQ-KRKEMKRKGVSKMFXXXXXXXXXXWHGVGGADG 838
            D  EE    + + L  KR+ +  +R+ K KE+ R   + M           W GVGGADG
Sbjct: 599  DQDEETRNPIIKNLIEKRKLKEALREAKMKELNRSKANGMIDFEAEESDDEWFGVGGADG 658

Query: 839  ELSDEYDSELEKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFRRRGK 898
            E SD YDSEL++M+DDY+ T  DP  +R+ L  E+K +D+ +V++ILHDI+NGGFR+RG+
Sbjct: 659  ENSDGYDSELDRMIDDYSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFRKRGR 718

Query: 899  GAXXXXXXXXXXXXXQRYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVEDLVESK 958
             A              RYHA+R+ELL ++   N E S L +NPKS AFF+S+ ED ++  
Sbjct: 719  YAMDLTLSDDEDDDLLRYHARRKELLNERKSGNQEISVLATNPKSKAFFDSIFEDDLK-- 776

Query: 959  NPFSIGETADPDSGAISENDKVDNASEHGTQPDAGGQPVRTERKRIKISQEFVQRSLSFL 1018
                         G I+    +     H +   A    +  +R+  +IS++FVQ++LSFL
Sbjct: 777  -------------GGIA---NLKEYQSHASPLKAAKDEISGKRE-TRISEQFVQKTLSFL 819

Query: 1019 NSKDELDNEFELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTPARTSSRTVDLE 1078
             SK++   + E    +A  Q S+ G D  +  D + LKQ S IK+   P R+S R     
Sbjct: 820  KSKEDEQGDAEF-VSVADTQESSSG-DFAEATDFYRLKQLSGIKSFSAPLRSSIRLQVRN 877

Query: 1079 VDGNSPANGFKLPSVISSFSSRIDINEKFKEGXXXXXXXXXXXXIGGSRASITYLGKVRK 1138
             DG    +G    +++  F   +D NEKF+EG             G SRASIT+LGK R 
Sbjct: 878  KDG--VLSGKANTTLVERFVRSVDTNEKFEEGRKTVKSLNSYKIAGSSRASITFLGKARS 935

Query: 1139 LNAPKRKESGRKPVFGHRHPEAAPKRAGLFADNDDSFE 1176
            L A KR    R    G +   +       FA +  SFE
Sbjct: 936  LKARKRGPHARSAPHGQKIMTSHQ----FFASDGQSFE 969

 Score = 84.0 bits (206), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 51/128 (39%), Positives = 77/128 (60%), Gaps = 3/128 (2%)

Query: 408 GWVPLNSYKNQLKARLDSKEHIXXXXXXXXXXXXVPASKMSKAAVLEIKARTS-KRQGIK 466
           G+ PL  Y   LK RL     +               S  SKAA+L++KAR S K+Q + 
Sbjct: 299 GFAPLQLYHTILKQRLTDANSVEFSSSDDEKSSEA-RSLSSKAAILDLKARMSKKKQSLA 357

Query: 467 KTRQQPSTPRAPSLKELFSSLKKANKKQILDHRREITEKRGLNLEDIEREKKEVENLLEQ 526
            T  + + P A SL+ LFSSL+KAN+ Q+++HR  +   RG++L +I +EK+ VE+LLE+
Sbjct: 358 VTSSKETMPSA-SLRHLFSSLRKANRDQLVEHRNGLLLLRGVDLAEIAKEKESVESLLER 416

Query: 527 EIERNRKI 534
           E+ RN+K+
Sbjct: 417 ELARNKKV 424

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 52/112 (46%), Gaps = 19/112 (16%)

Query: 4   LDALGDLKHPXXXXXXYVKDIEVYATQEENDEEKKQPQLSSASFLFGNSTIVDKVKSRLN 63
           +D +  L +P      +VK + ++       +++  P +    FLF NS I ++VK R+ 
Sbjct: 1   MDLIDQLSNPRTKRSGFVKKLHLF-------DDESCPTVGGTGFLFENS-IFNQVKKRIK 52

Query: 64  GVSNEETD--------GERGDALPQTQVIPNYYDGEDLEQDFV---SPPKPR 104
              + E +         E      +TQ I   YDGE+LE DFV   +P +P+
Sbjct: 53  ATDDNEINHNAPTTASTEILKDTCETQAIERPYDGEELETDFVLAKAPSEPK 104

>KLLA0E12673g Chr5 complement(1126397..1127197) [801 bp, 266 aa] {ON}
            weakly similar to uniprot|Q06667 Saccharomyces cerevisiae
            YDR315C IPK1 Inositol 1 3 4 5 6- pentakisphosphate
            2-kinase nuclear protein required for synthesis of 1 2 3
            4 5 6-hexakisphosphate (phytate) which is integral to
            cell function has 2 motifs conserved in other fungi ipk1
            gle1 double mutant is inviable
          Length = 266

 Score = 33.5 bits (75), Expect = 2.4,   Method: Composition-based stats.
 Identities = 26/100 (26%), Positives = 43/100 (43%), Gaps = 16/100 (16%)

Query: 1005 KISQEFVQRSLSFLNSKDELDNEFELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTL 1064
            ++ +EF+   L +L S D +       +R  K          DDL  L TL+  +C  T 
Sbjct: 171  QVPEEFLDDILQYLQSSDSITQRLYAAQRFVK----------DDLSTLMTLRDVTCFLTW 220

Query: 1065 HTPARTSSRTVDLEVDGNSPANGFK----LPSVISSFSSR 1100
                R+   T+ ++VD   PAN  +      S ++SF  +
Sbjct: 221  SRNTRSVKATI-IDVD-QKPANKLRHWQSTESALASFPGK 258

>ABL013C Chr2 complement(372923..375019) [2097 bp, 698 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR232W
           (FUS2)
          Length = 698

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 29/50 (58%), Gaps = 4/50 (8%)

Query: 113 QDCDCDSEEQTQLMPTQETGAYESQVVPVIAPVQV----SETIPVSINDG 158
           ++C+C+++   +L PTQ    YE  V P ++ + +    S++  +S+N G
Sbjct: 378 RECNCEAKANLELTPTQIIHFYECSVDPEVSAIDIKRKKSQSTALSVNTG 427

>TBLA0H01410 Chr8 (314446..315504) [1059 bp, 352 aa] {ON} Anc_8.281
            YLR097C
          Length = 352

 Score = 33.1 bits (74), Expect = 3.8,   Method: Composition-based stats.
 Identities = 32/112 (28%), Positives = 54/112 (48%), Gaps = 11/112 (9%)

Query: 956  ESKNPFSIGETADPDSGAISENDKVDNASEHGTQPDAGGQPVRTERKRIKISQEFVQRSL 1015
            ++  P  I +  D  S AI   +K  +  ++G+  DA    +R  R+ +KI    V+R  
Sbjct: 5    DTLKPIDINQLVDKVSEAIKIWEKGVDKEKNGSMTDA----IRYYRQALKIDSN-VER-- 57

Query: 1016 SFLNSKDELDNEFELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTP 1067
               N +++L  EFE  +RL + ++  L D ND  E++ T   +   K L  P
Sbjct: 58   ---NYREKLHEEFEEHKRLNELKNLKLNDTNDK-ENIETNDNHEDTKELELP 105

>NDAI0A04550 Chr1 complement(1025324..1028173) [2850 bp, 949 aa] {ON}
            Anc_3.473 YPR135W
          Length = 949

 Score = 32.3 bits (72), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 45/90 (50%), Gaps = 19/90 (21%)

Query: 1025 DNEFELDRRL----AKH---QHSTLGDDNDDLEDLFTLKQNSCIKTLHTPARTSSRTVDL 1077
            D+EF  + RL    A H   QH  +  D+  ++ +FT+K    +KTL  P+ T+S  +D+
Sbjct: 234  DSEFSTNNRLCTRVAWHPRGQHFAVPCDDKTVK-VFTIKDYGLLKTLTNPSITASNYIDM 292

Query: 1078 EVDGNSPANGFKLPSVISSFSSRIDINEKF 1107
            + +   P NG        +F + +D+  K 
Sbjct: 293  KYE---PLNG--------NFIAAVDLTNKL 311

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.129    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 104,247,036
Number of extensions: 4267558
Number of successful extensions: 16694
Number of sequences better than 10.0: 80
Number of HSP's gapped: 17202
Number of HSP's successfully gapped: 122
Length of query: 1177
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1056
Effective length of database: 39,606,813
Effective search space: 41824794528
Effective search space used: 41824794528
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 72 (32.3 bits)