Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0C00440g1.4ON46246224550.0
KLLA0C00462g1.4ON4604995266e-61
TDEL0C069801.4ON4264795044e-58
ZYRO0F18502g1.4ON4504924846e-55
Kwal_33.130031.4ON4494724654e-52
KLTH0F00462g1.4ON4514854435e-49
Kpol_2002.71.4ON4745024342e-47
Suva_3.1511.4ON4213614277e-47
YCL063W (VAC17)1.4ON4233614093e-44
Smik_3.131.4ON4254044084e-44
KNAG0C001901.4ON4424844085e-44
Skud_3.21.4ON4263653928e-42
NDAI0A001301.4ON4785193931e-41
NCAS0B091201.4ON4335033349e-34
CAGL0B00308g1.4ON4304053145e-31
TPHA0E040201.4ON5405703081e-29
TBLA0A075801.4ON5133332902e-27
KAFR0D001201.4ON3994812572e-23
Ecym_10071.4ON4624912023e-16
KNAG0H017101.408ON427123870.043
TBLA0F032503.401ON239899810.31
NDAI0E015008.631ON42876751.1
Ecym_81775.355ON957115741.7
YBR142W (MAK5)3.122ON773100732.5
Skud_2.2703.122ON768100713.5
Smik_2.2823.122ON800134714.2
NOTE: 1 genes in the same pillar as SAKL0C00440g were not hit in these BLAST results
LIST: AFR746C

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0C00440g
         (462 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly s...   950   0.0  
KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly s...   207   6e-61
TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa] ...   198   4e-58
ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]...   191   6e-55
Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W ...   183   4e-52
KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly s...   175   5e-49
Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON} (10372.....   171   2e-47
Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W ...   169   7e-47
YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}  VAC17Phospho...   162   3e-44
Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)   161   4e-44
KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4 Y...   161   5e-44
Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)      155   8e-42
NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4 YCL...   155   1e-41
NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa] ...   133   9e-34
CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar ...   125   5e-31
TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {O...   123   1e-29
TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa] ...   116   2e-27
KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4 YC...   103   2e-23
Ecym_1007 Chr1 (11741..13129) [1389 bp, 462 aa] {ON} similar to ...    82   3e-16
KNAG0H01710 Chr8 (304440..304469,304846..306099) [1284 bp, 427 a...    38   0.043
TBLA0F03250 Chr6 (792302..799498) [7197 bp, 2398 aa] {ON} Anc_3....    36   0.31 
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    33   1.1  
Ecym_8177 Chr8 complement(371716..374589) [2874 bp, 957 aa] {ON}...    33   1.7  
YBR142W Chr2 (528317..530638) [2322 bp, 773 aa] {ON}  MAK5Essent...    33   2.5  
Skud_2.270 Chr2 (496096..498402) [2307 bp, 768 aa] {ON} YBR142W ...    32   3.5  
Smik_2.282 Chr2 (512869..515271) [2403 bp, 800 aa] {ON} YBR142W ...    32   4.2  

>SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 462

 Score =  950 bits (2455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/462 (100%), Positives = 462/462 (100%)

Query: 1   MEGLHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQPDNGLLTKLQEYQTCLAQLN 60
           MEGLHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQPDNGLLTKLQEYQTCLAQLN
Sbjct: 1   MEGLHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQPDNGLLTKLQEYQTCLAQLN 60

Query: 61  SLHIRSEHLRDRIASTDHRASQDGDSIGHLVTEFQKITTKLNELAATQDRAYQSPGSQST 120
           SLHIRSEHLRDRIASTDHRASQDGDSIGHLVTEFQKITTKLNELAATQDRAYQSPGSQST
Sbjct: 61  SLHIRSEHLRDRIASTDHRASQDGDSIGHLVTEFQKITTKLNELAATQDRAYQSPGSQST 120

Query: 121 KSVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGHSKSTSL 180
           KSVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGHSKSTSL
Sbjct: 121 KSVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGHSKSTSL 180

Query: 181 PGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQRRRQDSDNRLNFFKENQRLSISFFDD 240
           PGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQRRRQDSDNRLNFFKENQRLSISFFDD
Sbjct: 181 PGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQRRRQDSDNRLNFFKENQRLSISFFDD 240

Query: 241 EIDYSSDEDTVISVSPPETTSFKGFPKAEPLRRYNSHESVLSRKEVLPAALPARAGWFSL 300
           EIDYSSDEDTVISVSPPETTSFKGFPKAEPLRRYNSHESVLSRKEVLPAALPARAGWFSL
Sbjct: 241 EIDYSSDEDTVISVSPPETTSFKGFPKAEPLRRYNSHESVLSRKEVLPAALPARAGWFSL 300

Query: 301 WAGRNNKPKPMAESVSINDKPVYSTAALLRSHSKTTETSKDLLAQFVSAAPKQKKQTTSW 360
           WAGRNNKPKPMAESVSINDKPVYSTAALLRSHSKTTETSKDLLAQFVSAAPKQKKQTTSW
Sbjct: 301 WAGRNNKPKPMAESVSINDKPVYSTAALLRSHSKTTETSKDLLAQFVSAAPKQKKQTTSW 360

Query: 361 FGPAEEPKRSIFSGWKLFNNSVLVTSETGLQDSNSKPSAKRIGAAAPAKRVPLGRRKTHL 420
           FGPAEEPKRSIFSGWKLFNNSVLVTSETGLQDSNSKPSAKRIGAAAPAKRVPLGRRKTHL
Sbjct: 361 FGPAEEPKRSIFSGWKLFNNSVLVTSETGLQDSNSKPSAKRIGAAAPAKRVPLGRRKTHL 420

Query: 421 PSSSLIMGPNGSRFVSPPNEPVLNNKVSYDALHEALCTEFRL 462
           PSSSLIMGPNGSRFVSPPNEPVLNNKVSYDALHEALCTEFRL
Sbjct: 421 PSSSLIMGPNGSRFVSPPNEPVLNNKVSYDALHEALCTEFRL 462

>KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 460

 Score =  207 bits (526), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 177/499 (35%), Positives = 264/499 (52%), Gaps = 76/499 (15%)

Query: 1   MEGLHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQPDNG-LLTKLQEYQTCLAQL 59
           ME +  ++++L++R  EA++QL+L IQR  ++ E++    P+N     ++QEY + LA+L
Sbjct: 1   MEDMRYVAERLVIRCNEAVMQLELSIQR--KMCEFD----PNNSHCFIQVQEYYSFLARL 54

Query: 60  NSLHIRSEHLRDRIASTDHRASQDGD------SIGHLVTEFQKITTKLNELAATQDRAYQ 113
           +SL +R+EH+++   S  H+     D      ++  L+ EFQ IT  LNE+A    RAYQ
Sbjct: 55  SSLKLRAEHVQE---SLRHQRKDPNDVCIEYETLEKLIYEFQDITMSLNEVA----RAYQ 107

Query: 114 SPG----SQSTKSVSSFEPKPLKILERTKLQH-PTSPTKRVATPPKK-----IAPLRKNP 163
           SP     S S+K  S    K LKI+ER +     TSP K+  +  KK       P ++N 
Sbjct: 108 SPTKSARSGSSKESSVIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNV 167

Query: 164 PF---DKKVMFSGHS--KSTSLPGSP--SMAASSPVSIQQERFPRHAKSCDAGLNKQQRR 216
            F   D  ++   HS  ++ SLPGSP       S +  ++ +  R AKS D GLN + ++
Sbjct: 168 RFQEDDLDILHHLHSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGRAKK 227

Query: 217 RQDSDNRLNFFKENQRLSISFFDDEIDYSSDEDTVISVSPPETTSF-----KGFPKAEPL 271
             D +    FFK   RLS+S FDD    +SDE+TVISVSPP  + +       +P  + +
Sbjct: 228 NADWE----FFKNKNRLSLSVFDDVNTDASDEETVISVSPPNISYYLSQNEDQYPSKQ-V 282

Query: 272 RRYNSHESVLSRKEV---LPAALPARAGWFSLWAGRNNKPKPMAESVSINDKPVYSTAAL 328
           RR NSHES+LSRK +    PA L  R  + S+W  +           +I  KP  S +  
Sbjct: 283 RRCNSHESILSRKILSPSTPANLIMRPTYQSVWQKK-----------AIVTKPTISCSTS 331

Query: 329 LRSHSKTTET---SKDLLAQFVSAAPKQKKQTTSWFGPAEEP--KRSIFSGWKLFNNSVL 383
             + S T  +   SKD+L+QFV+A P +K +   WF  +       SIF  W  FN+  L
Sbjct: 332 NSTASPTIGSPHLSKDMLSQFVTAPPSKKYR--GWFSSSNSTPFASSIFQKW--FNSDSL 387

Query: 384 VTSETGLQDSNSKPSAKRIGAAAPAKRVPLGRRKTHLPSSSLIMGPNGSRFVSPPNEPVL 443
           VT E G  D NS PS+ R     P          ++  S+S+++GPNG++F+   N+P++
Sbjct: 388 VTKEIGNPD-NSSPSSGR-----PIVENRQRHSSSNSYSTSIVIGPNGAKFIRGLNDPLV 441

Query: 444 NNKVSYDALHEALCTEFRL 462
              VSY+ L EAL TEF  
Sbjct: 442 TCTVSYNELQEALNTEFNF 460

>TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa]
           {ON} Anc_1.4 YCL063W
          Length = 426

 Score =  198 bits (504), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 171/479 (35%), Positives = 236/479 (49%), Gaps = 79/479 (16%)

Query: 4   LHEISQKLLVRSQEAILQLDLYIQRQQRLYEYE--TLDQPDNGLLTKLQEYQTCLAQLNS 61
           L ++S++LL RSQEAILQL+L+IQRQQ L E E  ++D+  N       +Y   +AQLNS
Sbjct: 3   LEDLSERLLTRSQEAILQLELWIQRQQHLRELEDSSIDKLGN-------QYNVYIAQLNS 55

Query: 62  LHIRSEHLRDRIASTDHR---ASQDGDSIGHLVTEFQKITTKLNELAATQDRAYQSPGSQ 118
           L +RSE++RD++     R      D   I  LV EFQ IT KLNELA +Q     +P S+
Sbjct: 56  LCVRSEYVRDKLNKERERRMSIINDRKYIEDLVFEFQDITVKLNELAQSQS-IDSTPSSK 114

Query: 119 STK-SVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGH--- 174
           ST+ S+ SF+P+PLK+ ER     P     R        +PL KN    K V FSG    
Sbjct: 115 STRSSLGSFQPRPLKLTER---HGPNVKALRE-------SPL-KNKSVIKSVKFSGLHDS 163

Query: 175 -----SKSTSLPGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQRRRQDSDNRLN---F 226
                SK  SLPGSP        SI      R AKS D GLN +  ++       +    
Sbjct: 164 KEEAVSKCLSLPGSPVRVTGPTRSI------RMAKSYDTGLNSKNTKKSKGSRDYDVPSI 217

Query: 227 FKENQRLSISFFDD---EIDYSSDEDTVISVSPPETTSFKGFPKAEPLRRYNSHESVLSR 283
           F+ENQRLSI+ FDD   + D +SD+DTVIS+ P +        K  PLRR+NSHES+LS 
Sbjct: 218 FRENQRLSITVFDDFDEDADSTSDQDTVISLVPADDG------KGLPLRRFNSHESILST 271

Query: 284 KEVLPAALPARAGWFSLWAGRNNKPKPMAESVSINDKPVYSTAALLRSHSKTTETSKDLL 343
           K    ++LP  + +    + R     P  +SV ++  PV+S  +          +S+DLL
Sbjct: 272 KVQPISSLPLFSSFLLPSSNR-----PSMKSVRVSSAPVFSKTS-------APASSRDLL 319

Query: 344 AQFVSAAPKQKKQTTSWFGPAEEPKRSIFSGWKLFNNSVLVTSETGLQDSNSKPSAKRIG 403
           + FV+   K    T    G  +E K   F+ W  F      + +        + + ++  
Sbjct: 320 STFVTRPGKASNAT----GIKQENKLGFFANWNFFKGPSSASHDI-------RATKQKAS 368

Query: 404 AAAPAKRVPLGRRKTHLPSSSLIMGPNGSRFVSPPNEPVLNNKVSYDALHEALCTEFRL 462
           A+ P       R KT        M P      SP   PV ++ +SY+ L EAL TE  L
Sbjct: 369 ASRPESNSADCRSKTLEK-----MAPRRFSPRSPVKAPVFDSLISYEDLREALSTEIIL 422

>ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]
           {ON} similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 450

 Score =  191 bits (484), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 172/492 (34%), Positives = 242/492 (49%), Gaps = 72/492 (14%)

Query: 1   MEGLHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQPDNGLLTKLQEYQTCLAQLN 60
           M  L +IS++L +RSQEA+LQL+L+I+RQQ L E E     D        +Y   +AQLN
Sbjct: 1   MPSLDDISERLFIRSQEAVLQLELWIRRQQHLSEIEHEHARDKIA----DQYNLYMAQLN 56

Query: 61  SLHIRSEHLRDRI-ASTDHR---ASQDGDSIGHLVTEFQKITTKLNELAATQDRAYQSPG 116
           SL +RSE++RD++ A   +R      + + I  LV EFQ IT KLNELA  Q        
Sbjct: 57  SLCVRSEYVRDKLNAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQNQKEQVTPSS 116

Query: 117 SQSTKSVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVM--FSGH 174
             S  SV+SF+P+PLKI ER +     +        P +I    KN  F ++ +      
Sbjct: 117 KHSNGSVNSFQPRPLKITERYR-----TDIGATRQSPTRINGKLKNVNFVEESLPELFCP 171

Query: 175 SKSTSLPGSPSMAASSPVSIQQERFP----RHAKSCDAGLNKQQR---RRQDSDNRLNFF 227
           SK TSLPGSP +   SP     +R P    R AKS D GLN   R   ++Q  +  L+ F
Sbjct: 172 SKCTSLPGSP-LKMRSP-----DRLPDRPLRVAKSYDTGLNPNSRAKLKKQKEEEMLSVF 225

Query: 228 KENQRLSISFFDD---EIDYSSDEDTVISVSP-PETTSFKGFPKAE--PLRRYNSHESVL 281
           KENQRLSI+F DD     D +SD++TVIS SP P +   +   ++E  PLRRYNSH+SVL
Sbjct: 226 KENQRLSITFCDDIDEGSDSASDQNTVISTSPIPPSHPIQYDVQSEKPPLRRYNSHDSVL 285

Query: 282 SRKEVLPAALPARAGWFSLWAGRNNKPKPMAESVSINDKPVYSTAALLRSHSKTTETSKD 341
           S K V P +  A+   F      N   +P  +SV+++  P+ S+            +SKD
Sbjct: 286 STK-VQPIS-SAKCPTFLTIPTAN---RPSMKSVTVSSAPIISSTG-------GKASSKD 333

Query: 342 LLAQFVSAAPKQKKQTTSWFGPAEEPKRSIFSGWKLFNNSVLVTSETGLQDSNSKPSAKR 401
           LL+ F+S      K+  +  G       ++   W LF               N  P+  R
Sbjct: 334 LLSSFISNTQDYDKKARNDNGNNNRFSSNLI--WNLFKQK---------SQKNRNPTPLR 382

Query: 402 IGAAAPAKRVPLGRRKTHLPSSS-----------LIMGPNGSRFVSPPNEPVLNNKVSYD 450
           +    P + V   R++  L ++S           L++    S  +SP  + + N    YD
Sbjct: 383 V----PQQDVTSERKENQLLTTSHPSGVYSSCSRLLVKNQNSSIISPTRQRITNGNTMYD 438

Query: 451 ALHEALCTEFRL 462
            L EAL TE  L
Sbjct: 439 ELQEALDTELVL 450

>Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W -
           Hypothetical ORF [contig 123] FULL
          Length = 449

 Score =  183 bits (465), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 156/472 (33%), Positives = 239/472 (50%), Gaps = 37/472 (7%)

Query: 1   MEGLHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQP-DNGLLTKLQEYQTCLAQL 59
           ME L +I+Q  L RS+EA+++L+  + +Q+RLYE E  DQ       + + +Y + L QL
Sbjct: 1   MEQLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIVQYYSYLGQL 60

Query: 60  NSLHIRSEHLRDRIAS-TDHRASQDGDSIGHLVTEFQKITTKLNELAATQDRAYQSPGSQ 118
           N L+I+++ L+D + +   H  +   ++I  L  +++ +    NEL   +     SP   
Sbjct: 61  NCLYIKAQSLKDMMGNRCGHLPNSTQEAIERLEHDYKALCNHANELGIREKNLEDSPSCL 120

Query: 119 STKSVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLR----KNPPFDKKVMFSGH 174
           S  SVSSF+PKPLKI+ER   Q  TSPTK         +  R    KN  +    +   +
Sbjct: 121 SPASVSSFQPKPLKIIERRLAQTNTSPTKVCTATVMAKSFCRSGTDKNSDYIPDEIGKTN 180

Query: 175 SKSTSLPGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQRRRQDSDNRLNFFKENQRLS 234
           S +T+ P + + A   P      +F R  KSC  GLNK        +NRL+FF++ QRLS
Sbjct: 181 SCNTNSPCT-NEAKKEP------KFIRVVKSCGTGLNKHS---NPHENRLSFFRDRQRLS 230

Query: 235 ISFFDDEIDYSSDEDTVISVSPPETT----SFKGFPKAEPLRRYNSHESVLSRKEVLPAA 290
           ISF +D+ +Y SDE+T+ S SP   +     F    K  P +   S   V + +    A 
Sbjct: 231 ISFIEDD-EYLSDEETITSGSPLNASFLLNDFAKVAKGRPNQTLASSRHVENNER--GAQ 287

Query: 291 LPARAGWFSLWAGRNNKPKPMAESVSI--NDKPVYSTAALLRSHSKTTETSKDLLAQFVS 348
             A + + SL   +    +    S+ I  +  P +S         +TTE SK++L+ FV 
Sbjct: 288 TAAVSPFVSLVPKKTCTAQIGLTSIDIRPDFGPCFSPKKF-----ETTE-SKEILSHFVI 341

Query: 349 AAPKQKKQTTSWFGPAEEPKRSIFSGWKLFNNSVLVTSETGLQDSNSKPSAKRIGAAAPA 408
             P+ K    SW    ++        +K+FNN VLVTSETG ++ +   S K I    P+
Sbjct: 342 KEPRTKSH--SWLKGCDKSV-PFLQTFKIFNNQVLVTSETGCRNVDRTTSTKLI---TPS 395

Query: 409 KRVPLGRRKTHLPSSSLIMGPNGSRFVSPPNEPVLNNKVSYDALHEALCTEF 460
           ++    R  +    S L+ G +GSRFV+ P +  L+ KVSY+AL EAL T+ 
Sbjct: 396 RKHFAQRELSDRTCSILVHGSSGSRFVNAPQQQELHFKVSYEALREALNTDL 447

>KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 451

 Score =  175 bits (443), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 173/485 (35%), Positives = 246/485 (50%), Gaps = 62/485 (12%)

Query: 1   MEGLHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQP-DNGLLTKLQEYQTCLAQL 59
           ME L EI+Q+ L  SQ A+ +LD  ++RQ+RLYE    DQ   +   T + +Y   + QL
Sbjct: 1   MEQLQEIAQESLALSQSALARLDSCLERQRRLYESGFPDQCLSDKSSTNMAQYYEYIGQL 60

Query: 60  NSLHIRSEHLRDRIASTDHRA--SQDGDSIGHLVTEFQKITTKLNELAATQDRAYQSPGS 117
            SL+ +++ L D +  +D ++  S    +I +L+ EFQ+I        +   R  +SP S
Sbjct: 61  YSLYTKAQKLSDTVILSDSKSLSSVQQRAIENLIQEFQEIAKNDENFISYSMR--ESPNS 118

Query: 118 QSTKSVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGHSKS 177
            S +S+ SF+PKPLKIL+R + Q   SPTKR   P   +   R     D+  + +   +S
Sbjct: 119 MSVQSICSFQPKPLKILQRRQAQLE-SPTKRSFRPSMSLLDNRG----DETNLATASDRS 173

Query: 178 TSLPGSPSMAASSPVSIQQER---------FPRHAKSCDAGLNKQQRRRQDSDNRLNFFK 228
                   +  SSP SI   R         F R AKSCDAGLN   RR    +NRLNFFK
Sbjct: 174 -----QERLLGSSPSSIHFFRPSHTNADTLFIRSAKSCDAGLN---RRSNPHENRLNFFK 225

Query: 229 ENQRLSISFFDDEIDYSSDEDTVISVSPPETTS-FKGFPKAEPLRRYNSHESVLSRKEVL 287
           + QRLSISF +DE D  SDE TVIS    ++   F+   K+ P +      S +  KE+ 
Sbjct: 226 DRQRLSISFIEDEEDV-SDEATVISAGSLQSAYIFETDIKSSPFK------SQIGEKEI- 277

Query: 288 PAALPARAGWFSLWA---GRNN--KPKPMAESVSIND---KPVYSTAALLRSHSKTTE-- 337
              +P +AG+ ++     G NN     P A  + I +   KP +       SH    E  
Sbjct: 278 --RIP-KAGYLAVGEKSKGFNNLLSATPSAPQIGITEVDYKPNFGF-----SHQPGVERE 329

Query: 338 --TSKDLLAQFVSAAPKQKKQTTSWFGPAEEPKRSIFSGWKLFNNSVLVTSETGLQDSNS 395
              SK +L+Q VS   K K    +WF   +   + I +  +L NN VLVTSETGL+  N+
Sbjct: 330 ASQSKKMLSQLVSQGNKTK--CKNWFNECDGLGKPISNTLRLLNNLVLVTSETGLRSVNN 387

Query: 396 KPSAKRIGAAAPAKRVPLGRRKTHLPSSSLIMGPNGSRFVSPPNEPVLNNKVSYDALHEA 455
             SAK +    P KR    ++  H   S  I G + S+FV+ P +  L+ KVS+ AL EA
Sbjct: 388 TTSAKLL--MPPRKRKE--KQAAHGSCSIFIHGSSRSKFVTAPQQTKLHFKVSHGALQEA 443

Query: 456 LCTEF 460
           L T+ 
Sbjct: 444 LNTDL 448

>Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON}
           (10372..11796) [1425 nt, 475 aa]
          Length = 474

 Score =  171 bits (434), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 168/502 (33%), Positives = 249/502 (49%), Gaps = 75/502 (14%)

Query: 3   GLHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQPDNGLLTKLQE-YQTCLAQLNS 61
            + ++S++LLVRSQEAILQLDL+IQRQQ+  E +  D  D   L K+ + Y   ++QLNS
Sbjct: 5   NIDDLSERLLVRSQEAILQLDLWIQRQQQWAESD--DNHDENDLEKVTDTYNLYMSQLNS 62

Query: 62  LHIRSEHLRDRIASTDH------------RASQDGDS-IGHLVTEFQKITTKLNELA-AT 107
           L+IRS+++RD++ +               + + +G S I  L+ EFQ IT KLN LA + 
Sbjct: 63  LYIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLASSR 122

Query: 108 QDRAYQSPGSQSTKSVSSFEPKPLKI-LERTK-LQHPTSPTKRVATPPKKIAPLRKNPPF 165
           +  +     S  + S+ SF+PKPLKI L+R K L+     T  V    +++  L  N   
Sbjct: 123 RRCSSSKSSSSRSSSIGSFQPKPLKISLKRNKSLKEQNKKT--VTFDVEEVTDLNINSVI 180

Query: 166 DKKVMFSGHSKSTSLPGSP--SMAASSPVSIQQERFPRHAKSCDAGLN-----KQQRRRQ 218
                        SLPGSP  +  +S P++       R AKS D GLN     K ++ + 
Sbjct: 181 -------------SLPGSPLRNEQSSPPMN----HHLRQAKSYDTGLNSKRSIKPKKSKI 223

Query: 219 DS--DNRLNFFKENQRLSISFFD-----DEIDYSSDEDTVISVS------PPETTSFKGF 265
           DS  D+    FK  QRLSIS FD     ++I   SD++TVIS S      P E    +  
Sbjct: 224 DSVYDST---FKNTQRLSISLFDIDTNENDITNISDQETVISSSSLTMDEPLEIIDDQK- 279

Query: 266 PKAEPLRRYNSHESVLSRKEVLPAALPAR--AGWFSLWAGRNNKPKPMAESVSINDKPVY 323
              +PLRRYNSHES+LS K + P ++  R   G F   +           + + + K   
Sbjct: 280 NNLKPLRRYNSHESILSTK-IRPISISKRFQIGPFRSVSTTTTSTNYDTTASNTDVKA-- 336

Query: 324 STAALLRSHSKTTETSKDLLAQFVSAAPKQKKQTTSWFGPAEEPKR--SIFSGWKLFNNS 381
                 + +   + TSKD+L+ +      Q     +     +E     S F+ W +FN  
Sbjct: 337 --DDFYKPNLSNSTTSKDILSMYSIKNDVQNSNRGNIINNKKESNSSTSFFNKWNIFNFP 394

Query: 382 VLVTSETGLQDSNSKPSAKRIGAAAPAKRVPLGRRKTHLPSSSLIMGPNGSRFVSPP-NE 440
           ++ +SE G +  N+  +AK  G+    +   L   K +   S++ +GPNGS F SP   E
Sbjct: 395 LIASSEVGSKQENN-TTAKHFGSQRKKQISSLSYNKANY--STMTIGPNGSMFCSPTIYE 451

Query: 441 PVLNNKVSYDALHEALCTEFRL 462
           P  +N VS+  LH+AL TE  L
Sbjct: 452 PTFSNTVSFQELHDALNTELDL 473

>Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W
           (REAL)
          Length = 421

 Score =  169 bits (427), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 140/361 (38%), Positives = 201/361 (55%), Gaps = 39/361 (10%)

Query: 2   EGLHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQPDNGLLTKL-QEYQTCLAQLN 60
           + L +I+++LL RS+EAILQLDL+IQRQQR       +  D   L KL Q+Y   ++QLN
Sbjct: 4   QALEDITERLLTRSEEAILQLDLWIQRQQR---SSVCEPSDRDSLDKLSQQYNQYMSQLN 60

Query: 61  SLHIRSEHLRDRIASTDHR----ASQDGDSIGHLVTEFQKITTKLNELAATQDRAYQ-SP 115
           SL++RSE +RD+++    R       +   I  LV EFQ IT +LN+LA   ++A   SP
Sbjct: 61  SLYVRSESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPNKASNDSP 120

Query: 116 GSQSTK-SVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGH 174
            SQST+ S+ SF+P+PLKI+ER +L         V TP K   P +K+  F+        
Sbjct: 121 QSQSTRSSLDSFQPRPLKIIERQRLC--------VVTPSK---PPKKSVVFNPINDVECP 169

Query: 175 SKSTSLPGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQRRRQDSDNRLNFFKENQRLS 234
           SK+ SLP SP        ++      R AKS D GLNK  ++   +D   +FFK  QRLS
Sbjct: 170 SKTNSLPCSPKKQPGKAHTL------RAAKSHDTGLNK-SKKPSSTDAYESFFKNKQRLS 222

Query: 235 ISFFDD--EIDYSSDEDTVI--SVSPPETTSF--KGFPKAEPLRRYNSHESVLSRKEVLP 288
           ++FFD+  + D  SD+DT+I  ++S P       KG  + EPLRRYNSHES+LS K   P
Sbjct: 223 LTFFDEMDDEDLDSDQDTIILPNISTPSHMDMATKG-AEFEPLRRYNSHESILSNK---P 278

Query: 289 A-ALPARAGWFSLWAGRNNKPKPMAESVSINDKPVYSTAALLRSHSKTTETSKDLLAQFV 347
           A A+    G F  +   N        +V +N +P  + + + + +     TSK LL+ F+
Sbjct: 279 APAMSLSLGSFPFFKPSNPTFGTSVSNVQVNYRPKMAASMIPKRNGSRAPTSKALLSSFI 338

Query: 348 S 348
           +
Sbjct: 339 A 339

>YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}
           VAC17Phosphoprotein involved in vacuole inheritance;
           degraded in late M phase of the cell cycle; acts as a
           vacuole-specific receptor for myosin Myo2p
          Length = 423

 Score =  162 bits (409), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 142/361 (39%), Positives = 195/361 (54%), Gaps = 37/361 (10%)

Query: 2   EGLHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQPDNGLLTKL-QEYQTCLAQLN 60
           + L +I+++LL+RSQEAILQLDL+IQRQQR    +T DQ     L KL Q+Y   ++QLN
Sbjct: 4   QALEDITERLLIRSQEAILQLDLWIQRQQRSSICQTTDQES---LDKLSQQYNQYMSQLN 60

Query: 61  SLHIRSEHLRDRIASTDHR--ASQDGDS--IGHLVTEFQKITTKLNELAATQDRA-YQSP 115
           SL++RSE +RD+++    R   ++D +   I  LV EFQ IT +LNELA   + A   SP
Sbjct: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATVPNEAPNDSP 120

Query: 116 GSQSTK-SVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGH 174
            SQST+ S+ SF+P+PLKI+ER +L   T P+K    PPKK         F+        
Sbjct: 121 QSQSTRSSLGSFQPRPLKIIERQRLCMVT-PSK----PPKKSV------GFNPINEVDCP 169

Query: 175 SKSTSLPGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQRRRQDSDNRLNFFKENQRLS 234
           SK+ SLP SP    +      + R  R AKS D GLNK  ++   SD   +FFK  QRLS
Sbjct: 170 SKTNSLPCSPKKQPA------RNRTLRAAKSHDTGLNK-SKKPSSSDTYESFFKNRQRLS 222

Query: 235 ISFFDDEIDYSSDEDTVISV-----SPPETTSFKGFPKAEPLRRYNSHESVLSRKEVLPA 289
           ++FFD+  D   D D    +     +PP         + EPLRRYNSHES+LS K     
Sbjct: 223 LTFFDEMDDEDFDSDQDTIILPNISTPPHVGVTAKGAEFEPLRRYNSHESILSNKPAPSK 282

Query: 290 ALPARAGWFSLWAGRNNKPK--PMAESVSINDKPVYSTAALLRSHSKTTETSKDLLAQFV 347
           +L    G FS    R + P       +V +N  P  +       +     +SK LL+ F+
Sbjct: 283 SL--NLGSFSASFFRPSNPTFGTSISNVQVNCHPTVAATMAPSRNGPRISSSKALLSSFI 340

Query: 348 S 348
           +
Sbjct: 341 A 341

>Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)
          Length = 425

 Score =  161 bits (408), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 155/404 (38%), Positives = 214/404 (52%), Gaps = 50/404 (12%)

Query: 2   EGLHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQPDNGLLTKL-QEYQTCLAQLN 60
           + L +I+++LL+RSQEAILQLDL+IQRQQR    +T DQ    LL K+ ++Y   ++QLN
Sbjct: 4   QALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTTDQ---ELLDKVSKQYNQYMSQLN 60

Query: 61  SLHIRSEHLRDRIASTDHR--ASQDGDS--IGHLVTEFQKITTKLNELA-ATQDRAYQSP 115
           SL++RSE +RD+++    R   ++D +   I  LV EFQ IT +LNELA A  + A  SP
Sbjct: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATAPNEVANDSP 120

Query: 116 GSQSTK-SVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGH 174
            SQST+ S+ SF+P+PLKI+ER +L   T P+K    PPKK      NP  D        
Sbjct: 121 QSQSTRSSLESFQPRPLKIIERQRLCMVT-PSK----PPKKSVGF--NPIND----VDCP 169

Query: 175 SKSTSLPGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQRRRQDSDNRLNFFKENQRLS 234
           SK+ SLP SP    +   ++      R AKS D GLNK  ++   +D   +FFK  QRLS
Sbjct: 170 SKTNSLPCSPKKQPAKNHTL------RAAKSHDTGLNK-SKKPSSADAYESFFKNRQRLS 222

Query: 235 ISFFDDEIDYSSDEDTVISV-----SPPETTSFKGFPKAEPLRRYNSHESVLSRKEVLPA 289
           ++FFD+  D   D D    +     +PP         + EPLRRYNSHES+LS K   PA
Sbjct: 223 LTFFDEMDDEDFDSDQDTVILPNISTPPHVNVTAKGAEFEPLRRYNSHESILSNK---PA 279

Query: 290 ALPARA-GWF--SLWAGRNNKPKPMAESVSINDKPVYSTAALLRSHSKTTETSKDLLAQF 346
            L + + G F  S +   N        +V  N  P  +     R +     +SK LL+ F
Sbjct: 280 PLMSHSLGSFPVSFFKPSNPTFGTSISNVQANCHPTITATMAPRRNGVHAPSSKALLSSF 339

Query: 347 V--SAAPKQKKQTTSWFGPAEEPKRSIFSGWKLFNNSVLVTSET 388
           +  S  P  K+ T         P     S    FN+S+   SE+
Sbjct: 340 IGRSERPMVKQNT---------PNLKHVSLLDKFNSSLTTISES 374

>KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4
           YCL063W
          Length = 442

 Score =  161 bits (408), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 163/484 (33%), Positives = 246/484 (50%), Gaps = 64/484 (13%)

Query: 1   MEGLHEISQKLLVRSQEAILQLDLYIQRQQRLY--EYETLDQPDNGLLTKLQEYQTCLAQ 58
           M+ L +++ +LL+RSQ+AILQL+L++Q+Q++L   ++ ++D+     +   Q+    L+Q
Sbjct: 1   MDCLEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVDRKKFEAIA--QQRNLHLSQ 58

Query: 59  LNSLHIRSEHLRDRIASTDHRAS-QDG--DSIGHLVTEFQKITTKLNELAATQDRAYQSP 115
           LNSL +RS ++++++AS  +  S + G    I +LV EFQ I   LNEL+ T +R   SP
Sbjct: 59  LNSLCLRSRYIKEKLASERNICSIRKGRRSYIENLVYEFQDIAMSLNELSET-NRKNGSP 117

Query: 116 GSQSTKSVS-SFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGH 174
            SQ+T + S SFEPKPL+ILER +  +  SPTKR +    KI    +   F + V    H
Sbjct: 118 VSQATTNSSDSFEPKPLRILERQRTCNAKSPTKRNSNHI-KIPRETEKSDFTENVADCLH 176

Query: 175 SKSTSLPGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQRRRQDSDNRLNFFKENQRLS 234
           S   SLP SP   ++       ++  R  KS    LN Q+         +N F    RLS
Sbjct: 177 S---SLPSSPLRGSNG-----SQQTIRLTKSYHESLNGQKPTSHSP--LMNPFNAKNRLS 226

Query: 235 ISFFDD----EI----DYSSDEDTVISVSPPETTSFKGFPKAEPLRRYNSHESVLSRKEV 286
           +  FD+    E+    D +SD++TV+  SP  +   KG    EPLRRYNSHES+LS  + 
Sbjct: 227 LYLFDNIDEKELTPCDDDNSDQETVMYNSPVVS---KG-AAFEPLRRYNSHESILSVAKK 282

Query: 287 LPAALPARAGWFSLWAGRNNKPKPMAESVSINDKPVYSTAALLRSHSKTTETSKDLLAQF 346
            P    A+   F   A         A+SV ++ KPVY+    ++S       SKDLL+  
Sbjct: 283 APIHSSAQKLQFYPSATNGTTS---AQSVFVSSKPVYTKPLSVQSR------SKDLLSSI 333

Query: 347 VSAAPKQKKQTTSWFGPAEEPKRSIFSGWKLFNNS--VLVTSETGLQDSNSKPSAKRIGA 404
             A   +  +TT           S+F+GW LF  S    +TSE G        S K+  A
Sbjct: 334 AHAEASKDTKTT-----------SVFNGWNLFGKSSTAAITSEVG----TCAISQKKHSA 378

Query: 405 AAPAKRVPLGR----RKTHLP--SSSLIMGPNGSRFVSPPNEPVLNNKVSYDALHEALCT 458
               +R   G       ++ P  S S +  P+G    + P  P+++++V  + L EAL T
Sbjct: 379 IKTNRRYITGDTLVISTSNRPRLSRSSVRQPHGYNRHTSPITPIVDHQVRQNELSEALET 438

Query: 459 EFRL 462
           E  L
Sbjct: 439 ELLL 442

>Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)
          Length = 426

 Score =  155 bits (392), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 140/365 (38%), Positives = 197/365 (53%), Gaps = 45/365 (12%)

Query: 2   EGLHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQPDNGLLTKL-QEYQTCLAQLN 60
           + L +I+++LL+RSQEAILQLDL+IQRQQR    +T DQ     L KL Q+Y   ++QLN
Sbjct: 4   QALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTSDQES---LDKLSQQYNQYMSQLN 60

Query: 61  SLHIRSEHLRDRIASTDHR--ASQDGDS--IGHLVTEFQKITTKLNELAATQDRAYQS-- 114
           SL++RSE +RD+++    R   ++D +   I  LV EFQ IT++LNELA           
Sbjct: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNELATVPHGVSNDSP 120

Query: 115 PGSQSTKSVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGH 174
               +  S  SF+P+PLKI+ER ++   T P+K    PPKK      NP  D        
Sbjct: 121 QSQSTRSSSGSFQPRPLKIIERQRVCMVT-PSK----PPKKSVGF--NPIND----VDCP 169

Query: 175 SKSTSLPGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQRRRQDSDNRLNFFKENQRLS 234
           SK+ SLP SP    +      + R  R AKS D GLNK  ++   +D   +FFK  QRLS
Sbjct: 170 SKTNSLPCSPKKPPA------KNRTLRAAKSHDTGLNK-SKKMSSTDAYESFFKNKQRLS 222

Query: 235 ISFFDD--EIDYSSDEDTV----ISVSPPETTSFKGFPKAEPLRRYNSHESVLSRKEVLP 288
           ++FFD+  + D  SD+DT+    IS  P    + KG  + EPLRRYNSHES+LS K   P
Sbjct: 223 LTFFDEMDDEDLDSDQDTIILPNISTPPHMNVTAKG-AEFEPLRRYNSHESILSNK---P 278

Query: 289 AALPARAGWFSLWAGRNNKPK-----PMAESVSINDKPVYSTAALLRSHSKTTETSKDLL 343
           A  P  +     + G   KP          +V ++  P  + +   R +     +SK LL
Sbjct: 279 A--PIMSLSLGGFPGSFYKPSHPTFGTSTSNVQVDCHPTITVSMASRRNGCYAPSSKALL 336

Query: 344 AQFVS 348
           + F++
Sbjct: 337 SSFIA 341

>NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4
           YCL063W
          Length = 478

 Score =  155 bits (393), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 161/519 (31%), Positives = 234/519 (45%), Gaps = 105/519 (20%)

Query: 4   LHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQPDNGLLTKL--QEYQTCLAQLNS 61
           L +I+++LL+RSQEAILQLDL+IQR+++  E  TL+  +N     +  Q+Y   LAQLNS
Sbjct: 5   LQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYLAQLNS 64

Query: 62  LHIRSEHLRDRIASTDHRASQDGDS---IGHLVTEFQKITTKLNELA----ATQDRAYQS 114
           L +R +++RD+     ++     D    I +LV EF++IT KLN+L+     T      S
Sbjct: 65  LIVRVQYIRDKFLHNINQLDSTQDEQKYIENLVYEFKQITLKLNDLSKKNKTTSSSENSS 124

Query: 115 PGSQSTKSVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGH 174
             + S  S+ SFEPKPLKI++RTK     S T               N   D  +     
Sbjct: 125 KTASSKSSMESFEPKPLKIIKRTKNDQKVSNT--------------INNDHDLIMQDENL 170

Query: 175 SKSTSLPGSPSMAASSPVSI-QQERFPRHAKSCDAGLNKQQRR-------RQDSDNRLN- 225
            +  SLP SP +  SS V+I Q E+  R  KS D    K   R       R+  ++ +N 
Sbjct: 171 QRPNSLPSSP-IEKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFENDTINQ 229

Query: 226 FFKENQRLSISFFDDE--------------------IDYSSDEDTVISVSPPETTSFKGF 265
           FFK  QRLSI  FD++                     D +SD+ TVIS    + T  +  
Sbjct: 230 FFKSQQRLSIGIFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVIS----QGTIKRND 285

Query: 266 PKAEPLRRYNSHESVLSRK-EVLPAALPARAGWFS----LWAGRNNKPKPMAESVSINDK 320
               PLRRYNSHES+LS+K    P         F+    L++      +P  +S+ +   
Sbjct: 286 DDFTPLRRYNSHESILSQKISSTPLIDNNNNLTFNSKLPLYSS---IRRPSMQSIHVTSN 342

Query: 321 PVYSTAALLRSHSKTTETSKDLLAQFV-SAAPKQKKQTTSWFGPAEEPKR---------- 369
           P++       + S   +TSKDLL+ FV S+ P+   +            R          
Sbjct: 343 PIF-------ARSSQGKTSKDLLSSFVTSSIPRNNNRNIQTRTKTRTQSRRNNQLRDHTI 395

Query: 370 ------SIFSGWKLFNNSVLVTSETGLQDSNSKPSAKRIGAAAPAKRVPLGRRKTHLPSS 423
                 S F  W   N   ++TSET     N+  + KR         +PL  +     S 
Sbjct: 396 NQTSTSSFFGNWNFLNRFNMITSET-----NTTTNRKR------NYNIPLVNQ-----SR 439

Query: 424 SLIMGPNGSRFVSPPNEPVLNNKVSYDALHEALCTEFRL 462
           +  +  N +       EPV +N +S D L +AL TE  L
Sbjct: 440 AHNIDVNDTMDSISIKEPVYDNTISLDDLEDALNTELLL 478

>NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa]
           {ON} Anc_1.4 YCL063W
          Length = 433

 Score =  133 bits (334), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 155/503 (30%), Positives = 232/503 (46%), Gaps = 111/503 (22%)

Query: 1   MEGLHEISQKLLVRSQEAILQLDLYIQRQQR--------LYEYETLDQPDN----GLLTK 48
           M  L +IS++LLVRSQEAILQLD++IQRQ+R          + +  D   N    G L +
Sbjct: 1   MSLLQDISERLLVRSQEAILQLDVWIQRQRRLQELMEGEEEQEQGGDTNTNMDIRGTLPQ 60

Query: 49  -LQEYQTCLAQLNSLHIRSEHLRDRIA---STDHRASQ--------DGDSIGHLVTEFQK 96
            L++Y T +AQLNSL +R E +RD +    +T  R  Q        +   I  LV EFQ 
Sbjct: 61  FLEQYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQD 120

Query: 97  ITTKLNELAATQD-RAYQSPGSQSTKSVSSFEPKPLKILERTKLQHPTSPTKRVATPPKK 155
           IT KL+EL+  ++     S  + +  S+ SF+PKPL+I+ R+                  
Sbjct: 121 ITQKLSELSTVRNPSTASSRSTSTKSSIESFKPKPLRIISRSNTH--------------- 165

Query: 156 IAPLRKNPPFDKKVMFSGHSKSTSLPGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQR 215
            + L +    DKKV F+    ++S+  S SM +      +  +  R+ KS D       +
Sbjct: 166 -SHLHQQTSLDKKVSFNEDESNSSISHSRSMESLH----ENSKSLRNTKSMDVLKRSTFK 220

Query: 216 RRQDSDNRLNFFKENQRLSISFFDDEI-----------DYS-SDEDTVISVSPPETTSFK 263
              D    LN     QRLSI+ FDD++            YS SD+ TVIS   P     +
Sbjct: 221 NHSDFSKLLN---SRQRLSINIFDDDLIANEDGNEFYNQYSDSDQATVISHGTP----IR 273

Query: 264 GFPKAEPLRRYNSHESVLSRKEVLPAALPARAGWFSLWAGRNNKPKPMAESVSINDKPVY 323
           G      LRRYNSHES+LS ++   +  P +   +S      +  +P  +SV++N  P++
Sbjct: 274 G-ADTPLLRRYNSHESILSFRKPTQSRQPNQILPYS------SVRQPSMQSVAVNSNPIF 326

Query: 324 STAALLRSHSKTTETSKDLLAQFVSA-APKQKKQTTSWFGPAEEPK---RSIFSGWKLFN 379
           S         +   TSKDLL+ F++   P +  Q        ++PK    S+F  W  FN
Sbjct: 327 SRM-------RPNATSKDLLSSFINKPQPNRLHQ--------QKPKPNSNSLFGKWNFFN 371

Query: 380 NSVLVTSETGLQDSNSKPSAKRIGAAAPAKRVPLGRRKTHLPSSSLIMGPNGSRFVSPPN 439
               VTSE G   +   P+     ++   K  P       +PSS+ I             
Sbjct: 372 KFNSVTSEIGTTTTQLYPT----NSSMSNKFNP-----NDIPSSASIR------------ 410

Query: 440 EPVLNNKVSYDALHEALCTEFRL 462
           EPV ++ +  + L++AL TE  L
Sbjct: 411 EPVFDDSLHLEDLNDALNTELLL 433

>CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar to
           uniprot|P25591 Saccharomyces cerevisiae YCL063w
          Length = 430

 Score =  125 bits (314), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 132/405 (32%), Positives = 198/405 (48%), Gaps = 68/405 (16%)

Query: 1   MEGLHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQPDNGL--LTKLQE-YQTCLA 57
           M  L EI+++LL RS EAI QLD +I  Q +      + +  +GL  + +L + Y   L 
Sbjct: 1   MASLEEITERLLERSNEAIEQLDEWILLQNK---NRHISENKSGLDSIERLDDKYTEFLE 57

Query: 58  QLNSLHIRSEHLRDRI------ASTDHRASQDGDSIGHLVTEFQKITTKLNELAATQDRA 111
           +LNSL+IRS++++D+I       +T  ++  +   I  L+ EF++IT  LNE+A   D  
Sbjct: 58  KLNSLYIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEITLSLNEIAQQDDET 117

Query: 112 YQ---SPGSQSTKS-VSSFEPKPLKILERTKLQHPTSPTKRVATPPKK----IAPLRKNP 163
                SP S STKS + SF PKPLKIL R  +    SP   + +PPKK      P+ +N 
Sbjct: 118 NSKQLSPASTSTKSSLESFTPKPLKILNRASMIR--SP---INSPPKKRNISFCPIHENL 172

Query: 164 PFDKKVMFSGHSKSTSLPGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQRRRQDSDNR 223
                      ++  SLP SP+    S +  +QE+    A+S   GL  ++ R+ D +  
Sbjct: 173 SV---------TEYESLPSSPN---RSNLLEEQEQVLHPARSFQTGLRTEKARKPDKNQL 220

Query: 224 LNFFKENQRLSISFF-----DD-----EIDYSSDEDTVISVSPPETTSFKGFPKAEPLRR 273
             +FK+ QRLS++ F     DD       DY SDE+TVI  S     +       +P+RR
Sbjct: 221 DKYFKDKQRLSLTLFGSADADDGESLNNNDY-SDEETVIFTSSSNIETDAITDDMKPIRR 279

Query: 274 YNSHESVLS-RKEVLPA-----ALPARAGWFSLW-AGRNNKPKPMAESVSINDKPVYSTA 326
            NSHESVLS   + +P          R   F  + A  NN+   +    SI +  V  T+
Sbjct: 280 CNSHESVLSVHNKFVPKNNNNLQFQNRLEPFGRYLATSNNRNFTIP---SIQNIQVSGTS 336

Query: 327 ALLRSHSKT--------TETSKDLLAQFVSAAP--KQKKQTTSWF 361
            L R   +         ++TSKDLL   ++A P   Q+    ++F
Sbjct: 337 TLSRFSREQDREMTQLGSKTSKDLLTSVMTATPITTQRNNKLTFF 381

>TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {ON}
           Anc_1.4 YCL063W
          Length = 540

 Score =  123 bits (308), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 159/570 (27%), Positives = 238/570 (41%), Gaps = 148/570 (25%)

Query: 3   GLHEISQKLLVRSQEAILQLDLYIQRQQRLY-EYETLDQPDNGLLTKLQE---------Y 52
            L E+S+KLL+RSQEAILQLDL+I RQQ+ + ++      D G  TK            Y
Sbjct: 7   NLEELSEKLLIRSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTY 66

Query: 53  QTCLAQLNSLHIRSEHLRDRIASTDHRASQ---DGDSIGHLVTEFQKITTKLNELAATQD 109
              ++QLNSL++RSE +RD++ S  +  ++   D  +I  LV EFQ I  KLN+LAA+  
Sbjct: 67  DLYMSQLNSLYVRSEFIRDKLNSEKNNVNKFNLDHRNIEELVFEFQNIREKLNQLAASSK 126

Query: 110 RAYQSPGSQSTKSVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKV 169
               SP   ST+S SS E   LK            P K VA   K+++   +    +K V
Sbjct: 127 LDKHSPPKTSTRS-SSMESMNLK------------PLKVVAKHEKRMSKELELKNKEKSV 173

Query: 170 MFSGHSK---STSLPGSPSM----AASSPVSIQQE-RFPRHAKSCDAGLNKQQR------ 215
            F   ++   +T+  G   M    + +SP  I ++ +  R+A S D GLN + +      
Sbjct: 174 TFGKETRISLTTNGIGGKLMIKDDSDASPQLIDKKYKVLRNAISYDTGLNSKSKSNKRSN 233

Query: 216 ---RRQDSDNRLNFFKENQRLSISFFDDEIDYS------------------------SDE 248
              R+++     + FK  QR SIS F+D +D +                        SD+
Sbjct: 234 REYRKKNDAAYDSLFKNKQRFSISLFEDYVDTTTNTNYNEFNPTVDASINTELIENNSDQ 293

Query: 249 DTVISVS---------------------PPETTSFKGFPKAEPLRRYNSHESVLSRK--- 284
           +TVIS S                          S     K   LRR NSHES+LS K   
Sbjct: 294 ETVISSSHLPCITNEPLDDYILSNSIQLDKNNNSGNNEGKKSHLRRCNSHESILSTKLEN 353

Query: 285 ---EVLPAALPARAGWFSLWAGRNNKPKPMAESVSI-------------NDKPVYSTAAL 328
              + + +    R  + S +       +P   SVS              N+ P  +    
Sbjct: 354 TFYKNVGSNFYDRFIFSSFY-------RPTVASVSTTSTNIEPFLSDGKNESPNKNLQLP 406

Query: 329 LRSHSKTTETSKDLLAQFVSAAPKQKKQTTSWFGPAEEPKRSIFSGWKLF---------- 378
           L S ++   TS++LL++F     + K  TTS         +  F  W LF          
Sbjct: 407 LTSSTRGV-TSRELLSKFADKPEQLKAPTTS----NSNSSKYFFENWGLFSSMSSSSTFH 461

Query: 379 ----NNSVLVTSETG--LQDSNSKPSAKRIGAAAPAKRVPLGRRKTHLPSSSLIMGPNGS 432
               + S +++SE G  L D ++      I     A   P  R  +H  +   I      
Sbjct: 462 RKNTSGSNIISSEVGKKLCDRSTGIKVTSIN-TQNAYTFPFIRSNSHDITKQNITN---- 516

Query: 433 RFVSPPNEPVLNNKVSYDALHEALCTEFRL 462
                   P++  +VSY+ LH+AL TE +L
Sbjct: 517 --------PIIKERVSYNELHDALNTEIKL 538

>TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa]
           {ON} Anc_1.4 YCL063W
          Length = 513

 Score =  116 bits (290), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 104/333 (31%), Positives = 164/333 (49%), Gaps = 86/333 (25%)

Query: 6   EISQKLLVRSQEAILQLDLYIQRQQ--------RLYEYETLDQPDNGLLTKLQEYQTCLA 57
           E+S +LL ++QEA+LQLDL+I+ QQ        R    E+L+Q +       ++Y   + 
Sbjct: 6   EVSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAE-------RDYNRYMF 58

Query: 58  QLNSLHIRSEHLRDRIASTDHRASQDGDSIGH----------LVTEFQKITTKLNELAAT 107
           QLNSL++R++++RD+I   +     D D  G+          LVTEF  ++ K+NEL+A 
Sbjct: 59  QLNSLYLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAI 118

Query: 108 QDRAYQSPGSQSTKSVSS----------FEPKPLKILER------------------TKL 139
           Q+         S KS  S          F+P+PLKIL+R                   KL
Sbjct: 119 QENVTNGSSPLSNKSSHSNDSLSKITDGFQPRPLKILQRQKHNNNQNTHPQPDLESPLKL 178

Query: 140 QHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGHSKSTSLPGSPSMAASSPVSIQQERF 199
           +H +S  K +++  K+  P +    F+ K      SK+  L     ++  SPV IQ    
Sbjct: 179 KHRSSYNKLLSSNKKESKPYKN---FNSK-----KSKNNEL-----LSDISPVKIQSFEE 225

Query: 200 PRHAKSCDAGLNKQQRRRQDSDNRLNF--FKENQRLSISF---FDDEIDYS-----SDED 249
           P  + +          R ++S + L++  FK N RLSI F   +D++ +Y      SD+D
Sbjct: 226 PTFSVA--------NTRNKNSMDPLHYSLFKTNNRLSIQFPDGYDNDDEYDDPTCISDQD 277

Query: 250 TVISVSPPETTSFKGFPKAEPLRRYNSHESVLS 282
           T+   +P   +S K    +EPLR++NSHES+LS
Sbjct: 278 TIFVSTPKIASSIKN--TSEPLRKFNSHESILS 308

>KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4
           YCL063W
          Length = 399

 Score =  103 bits (257), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 138/481 (28%), Positives = 220/481 (45%), Gaps = 115/481 (23%)

Query: 7   ISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQPDNGLLTKLQEYQTCLAQLNSLHIRS 66
           +S  LL RS+EA+ QL+ ++++Q++L++                EY+    QLNSL  +S
Sbjct: 5   VSDTLLQRSEEAVSQLESWLKQQEQLHQTTA-------------EYK----QLNSLCAKS 47

Query: 67  EH----LRDRIASTDHRASQDGDS---IGHLVTEFQKITTKLNELAATQDRAYQSPGSQS 119
           ++    L+D  +S  H   +  +    +  L+ EF +I+TKLNE+       + SP S  
Sbjct: 48  KYISNLLKDDSSSIPHDLMEQKERSFIVESLIHEFNEISTKLNEIVT-----HTSPQS-- 100

Query: 120 TKSVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGHS--KS 177
             ++ SFEPKPL +L + K+    SPT+   + P     L +    +   +F  H+  K 
Sbjct: 101 --TIDSFEPKPLNLLRKNKILE--SPTR---SSPVTRGRLERKISIN---LFPMHTTTKC 150

Query: 178 TSLPGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQRRRQDSDNRLNFFKENQRLSISF 237
            S+P SP   ++S ++   +R  R+ KS   GLN          + +N FKEN RLSISF
Sbjct: 151 NSVPTSPKCKSTSTLN---QRTLRNIKSYHYGLN---------GDYINPFKENNRLSISF 198

Query: 238 FDDEIDYSSDED----------TVISVSPPETTSFKGFPKAEPLRRYNSHESVLSRKEVL 287
           F+ +  ++ +            TV+  SP     F   PK + L+R NS +SV   +  L
Sbjct: 199 FNGDNTFNDNNSDSESDIDDDDTVLVTSP-----FLTNPK-QKLKRSNSQDSVFWNENYL 252

Query: 288 PAALPARAGWFSLWAGRNNKPKPMAESVSINDKPVYSTAALLRSHSKTTETSKDLLAQFV 347
               P+     +L+       KP AE        + ST   L++  +   +SK LL  FV
Sbjct: 253 RK--PSFQKQLNLFPS--TLTKPTAE--------LSSTQVFLKNTGRLGSSSKALLTSFV 300

Query: 348 SAAPKQKKQTTSWFGPAEEPKRSIFSGWKLFNNSVLVTSETGLQDSNSKPSAKRIGAAAP 407
               +Q+++T +          S F+   +FN+   VTSE G      K    +      
Sbjct: 301 KDNLQQQQRTHN---------ASSFNN--IFNS---VTSEIG------KSKLDKSQIIHT 340

Query: 408 AKRVPLGRRKTHLPSSSLIMGPNGSRF--------VSPPNEPVLNNKVSYDALHEALCTE 459
            +RV        +  S+LI     SRF        +SP  +P++NN V Y  L++AL TE
Sbjct: 341 ERRV---LSDNSIVISTLITSK-KSRFNRFSSVDNISPTKKPIINNDVQYSDLNDALNTE 396

Query: 460 F 460
           F
Sbjct: 397 F 397

>Ecym_1007 Chr1 (11741..13129) [1389 bp, 462 aa] {ON} similar to
           XP_452214  K. lactis KLLA0C00462g
          Length = 462

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 121/491 (24%), Positives = 209/491 (42%), Gaps = 84/491 (17%)

Query: 9   QKLLVRSQEAILQLDLYIQRQQRLYEY--ETLDQPDNG---------------------L 45
            +LL R QE+++ L+L+IQ    L+E   +      NG                      
Sbjct: 9   HRLLTRCQESLVDLNLHIQMSWSLFELAQDCGGSECNGHNCDICRYTCRSAVQQSCGDQR 68

Query: 46  LTKLQEYQTCLAQLNSLHIRSEHLRDRIASTDHRASQDGDSIGHLVTEFQKITTKLNELA 105
             +++ YQ+ +A L SL IR++ L D+          D D++  L +EF+ I+  L  L 
Sbjct: 69  TEQMRRYQSSMAHLMSLSIRAQFLIDKFHKGGSGYQIDLDTVKKLGSEFEDISHNLCFLE 128

Query: 106 ATQDRAYQSPGSQSTKSVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKI----APLRK 161
             +         +S++  + F+ +PLK+L+R +     +P++  +    +I    AP R 
Sbjct: 129 PNKVFDKNHTRFRSSEYPAPFQLRPLKLLQRIR-----NPSENESKDNLRIYEGSAPQRD 183

Query: 162 NPPFDKKVMFSGHSKSTSLPGSPSMAASSPVS---IQQERFPRHAKSCDAGLNKQQRRRQ 218
           NP FD        S  +SL G    A  S +    +    F  H  + DA + +      
Sbjct: 184 NPSFDLN------SSLSSLHGLVVGADFSVIRQGLMNWNSFEMHIPNVDALMPQN----- 232

Query: 219 DSDNRLNFFKENQRLSISFFDDEIDYSSDEDTVISVS--PPETTSF-------KGFPKAE 269
                LNF +E    S  FFD  ++ +SD++TV+S+S    +T SF       K F  ++
Sbjct: 233 -----LNF-QEKSEFSTPFFDS-LECNSDDETVMSISRLDLDTCSFVSASSQSKRFSISD 285

Query: 270 PLRRYNSHESVLSRKEVLPAALPARAGWFSLWAGRNNKPKPMAESVSINDKPVYSTAALL 329
             R    H S +   EVL         +F+L    N+  + +A +  +    V S +   
Sbjct: 286 YDRIACRHGSTI---EVL-----GTPPFFNL----NHNIQELARTAIVGSSYVCSFSTRY 333

Query: 330 R-SHSKTTETSKDLLAQFVSAA------PKQKKQTTSWFGPAEEPKRSIFSGWKLFNNSV 382
           + +H K   TS+DLL +FV         P  K+    W+         I +  K+ N+  
Sbjct: 334 KMNHFKKAVTSRDLLTKFVEPVTTTKPLPAAKENHLHWWPIIN--LSGILTKCKIRNHGN 391

Query: 383 LVTSETGLQDSNSKPSAKRIGAAAPAKRVPLGRRKTHLPSSSLIMGPNGSRFVSP-PNEP 441
            VTSE+   +  S+ + + +     +        ++ +   SL + PNGS+FV     E 
Sbjct: 392 PVTSESCPHEETSETANQILKHTGKSTLENQAHIRSEVSQCSLFLEPNGSKFVHQFGGEQ 451

Query: 442 VLNNKVSYDAL 452
           V+ +++SY +L
Sbjct: 452 VVCSEISYSSL 462

>KNAG0H01710 Chr8 (304440..304469,304846..306099) [1284 bp, 427 aa]
           {ON} Anc_1.408 YNL004W intron location uncertain
          Length = 427

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 58/123 (47%), Gaps = 14/123 (11%)

Query: 316 SINDKPVYSTAALLRSHSKTTETSKDLL---AQFVSAAPKQKKQTTS------WFGPAEE 366
           ++NDKPVY        HS   +  KD+     + + A  ++  +  S       F   E+
Sbjct: 233 ALNDKPVYQVTVKNLPHSINWQALKDMFKECGRVLRADVEKNSERYSNGSGKVTFSNYED 292

Query: 367 PKRSI--FSGWKLFNNSVLVTSETGLQDSNSKPSAKRIGAAA--PAKRVPLGRRKTHLPS 422
            KRS+  ++G+++  N VL  SE G   +NS P+A+++      P   V  G R  ++  
Sbjct: 293 MKRSLDKYNGFRIEGN-VLEVSEVGKTSANSTPTAEKVEPVDKFPEGFVAGGERNNYIFC 351

Query: 423 SSL 425
           S+L
Sbjct: 352 SNL 354

>TBLA0F03250 Chr6 (792302..799498) [7197 bp, 2398 aa] {ON} Anc_3.401
           YBR136W
          Length = 2398

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 45/99 (45%), Gaps = 6/99 (6%)

Query: 120 TKSVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGHSKSTS 179
           T  + SFEP+  +IL   ++ +P      +    K++  L ++   D K+ F+G++  TS
Sbjct: 379 TTKIWSFEPEGDEILNSIRVHNP------IGIEQKQLENLHQSILHDFKMPFTGYTLKTS 432

Query: 180 LPGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQRRRQ 218
           L   P    S   S   + F   +K   A ++    +RQ
Sbjct: 433 LARLPIDVPSKAFSSWNDTFKFLSKELSAAISNNSLKRQ 471

>NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {ON}
           Anc_8.631
          Length = 428

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 35/76 (46%), Gaps = 12/76 (15%)

Query: 228 KEN--QRLSISFFDDEIDYSSD-----EDTVISVSPPETTSFKGFPKAEPLRRYNSHESV 280
           KEN  Q+  +S F     Y SD        VI+ S   T +    PKA+ LR Y+ H   
Sbjct: 163 KENRVQQNVVSIFKGHTCYISDIEFWDNSHVITSSGDMTCALWNIPKAKRLREYSDH--- 219

Query: 281 LSRKEVLPAALPARAG 296
               +VL  A+P+R G
Sbjct: 220 --LGDVLALAMPSRQG 233

>Ecym_8177 Chr8 complement(371716..374589) [2874 bp, 957 aa] {ON}
           similar to Ashbya gossypii AGR356W
          Length = 957

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 54/115 (46%), Gaps = 21/115 (18%)

Query: 84  GDSIGHLVTEFQKITTKLNELAATQDRAYQSPGSQSTKSVSSFEPKP--LKILERTKLQH 141
           G  + +++++  +I  K+N L +      QS G +S+       P P  LK+  R  ++ 
Sbjct: 538 GSEVPNMISK-DRIIDKMNSLHSETMETIQSSGGESSLGPVDMYPLPIALKVKRRDDIEK 596

Query: 142 PTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGHSKSTSLPGSPSMAASSPVSIQQ 196
           PT+      TPP  ++ LRKN   D          S S+P    M+++ P+++ Q
Sbjct: 597 PTT------TPPSLLSFLRKNVGKDL--------NSISMP----MSSNEPITVLQ 633

>YBR142W Chr2 (528317..530638) [2322 bp, 773 aa] {ON}  MAK5Essential
           nucleolar protein, putative DEAD-box RNA helicase
           required for maintenance of M1 dsRNA virus; involved in
           biogenesis of large (60S) ribosomal subunits
          Length = 773

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 47/100 (47%), Gaps = 10/100 (10%)

Query: 4   LHEISQKLLVRSQEAILQL--DLYIQRQQRLYEYETLDQPDNGLLTKLQEYQTCLAQLNS 61
           L +I + +L +SQ +IL L   L IQ+QQRL +Y+   Q    ++     +   L + N+
Sbjct: 263 LKKICEPVLAKSQYSILSLTGGLSIQKQQRLLKYDNSGQI---VIATPGRFLELLEKDNT 319

Query: 62  LHIRSEHLRDRIASTDHRASQDGDSIGHLVTEFQKITTKL 101
           L  R   +   I     R  QD    GH   EF+KI   L
Sbjct: 320 LIKRFSKVNTLILDEADRLLQD----GHF-DEFEKIIKHL 354

>Skud_2.270 Chr2 (496096..498402) [2307 bp, 768 aa] {ON} YBR142W
           (REAL)
          Length = 768

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 46/100 (46%), Gaps = 10/100 (10%)

Query: 4   LHEISQKLLVRSQEAILQL--DLYIQRQQRLYEYETLDQPDNGLLTKLQEYQTCLAQLNS 61
           L +I + +L +SQ +IL L   L IQ+QQRL +Y+   Q    ++     +   L + N 
Sbjct: 257 LRKICEPVLAKSQYSILSLTGGLSIQKQQRLLKYDNSGQI---VIATPGRFLELLEKDNE 313

Query: 62  LHIRSEHLRDRIASTDHRASQDGDSIGHLVTEFQKITTKL 101
           L  R   +   I     R  QD    GH   EF+KI   L
Sbjct: 314 LIKRFSQVNTLILDEADRLLQD----GHF-DEFEKIIKYL 348

>Smik_2.282 Chr2 (512869..515271) [2403 bp, 800 aa] {ON} YBR142W
           (REAL)
          Length = 800

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 63/134 (47%), Gaps = 18/134 (13%)

Query: 4   LHEISQKLLVRSQEAILQL--DLYIQRQQRLYEYETLDQPDNGLLTKLQEYQTCLAQLNS 61
           L +I + +L +SQ +IL L   L IQ+QQRL +Y+   Q    ++     +   L + N+
Sbjct: 290 LKKICEPVLAKSQYSILSLTGGLSIQKQQRLLKYDNSGQI---VIATPGRFLELLEKDNT 346

Query: 62  LHIRSEHLRDRIASTDHRASQDGDSIGHLVTEFQKITTKLN--------ELAATQDRAYQ 113
           L  R   +   I     R  QD    GH   EF+KI   L+        +++  +++ +Q
Sbjct: 347 LIERFSKVDTLILDEADRLLQD----GHF-DEFEKIIKYLSMERRKNKEKISEGKNKIWQ 401

Query: 114 SPGSQSTKSVSSFE 127
           +    +T S+  F+
Sbjct: 402 TLIFSATFSIDLFD 415

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.127    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,861,457
Number of extensions: 2308437
Number of successful extensions: 7447
Number of sequences better than 10.0: 123
Number of HSP's gapped: 7701
Number of HSP's successfully gapped: 125
Length of query: 462
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 349
Effective length of database: 40,524,141
Effective search space: 14142925209
Effective search space used: 14142925209
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)