Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0C00418g1.3ON36436417410.0
NCAS0B091301.3ON3673399841e-132
NDAI0A001201.3ON3773449621e-128
KNAG0C001801.3ON3593439551e-128
TPHA0E040401.3ON3573309511e-127
KAFR0D001101.3ON3653399491e-127
Suva_3.1501.3ON3613439431e-126
YCL064C (CHA1)1.3ON3603429401e-125
Skud_3.11.3ON3603449381e-125
Smik_3.121.3ON3603439341e-124
TBLA0A049201.3ON3603669191e-122
KLTH0F00440g1.3ON3413349041e-120
NDAI0K02950singletonON3343369011e-120
NCAS0A15330singletonON3473378901e-118
KAFR0F04430singletonON3433398881e-118
SAKL0C13904gsingletonON3393358761e-116
ZYRO0F15774gsingletonON4103568761e-115
Kpol_2002.61.3ON3503508651e-114
CAGL0B00286g1.3ON3603378621e-113
Ecym_10061.3ON3643418601e-113
KLLA0C00440g1.3ON3773308411e-110
KAFR0I00130singletonON3443348281e-109
AFR747W1.3ON4263618251e-107
ZYRO0F18524g1.3ON3353328061e-105
Smik_9.2na 1ON3383378041e-105
KNAG0D05380singletonON3343367831e-102
Scer_YGOB_SDL1 (SDL1)na 1ON3373277701e-100
Skud_9.2na 1ON3393367411e-95
KLLA0E01805gsingletonON3223337364e-95
TDEL0D06540singletonON3373337365e-95
KNAG0A01150singletonON2312305651e-70
YIL167W (SDL1)singletonOFF2101895003e-61
YIL168WsingletonOFF1271232852e-30
SAKL0F11858g7.367ON5622871871e-14
ACR232C7.367ON5602601435e-09
Ecym_47087.367ON5702821419e-09
KLLA0E19779g7.367ON5672891372e-08
KAFR0K017007.367ON5792761373e-08
TDEL0C018007.367ON5692821302e-07
ZYRO0B02772g7.367ON5692861231e-06
Kpol_530.167.367ON5662851231e-06
Kwal_33.148227.367ON5622811222e-06
TPHA0F031307.367ON5682701185e-06
NCAS0A142307.367ON5692811185e-06
YER086W (ILV1)7.367ON5762871151e-05
TBLA0C050707.367ON5752861142e-05
Smik_5.2257.367ON5762661142e-05
Skud_5.2057.367ON5762661132e-05
CAGL0I05126g7.367ON5712811132e-05
SAKL0A10626gsingletonON3202871113e-05
KLTH0B04884g7.367ON5732891123e-05
NDAI0A018107.367ON5702861123e-05
KNAG0C036907.367ON5772811114e-05
Suva_5.1997.367ON5762661071e-04
YKL218C (SRY1)na 2ON3263291015e-04
Skud_11.2na 2ON3262881006e-04
NCAS0C056204.69ON50249741.3
Suva_6.338.46ON102963703.7
AGR137W8.200ON50356694.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0C00418g
         (364 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON...   675   0.0  
NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3    383   e-132
NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON} A...   375   e-128
KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}...   372   e-128
TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3...   370   e-127
KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON} A...   370   e-127
Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON...   367   e-126
YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}  CH...   366   e-125
Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL0...   365   e-125
Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON} Y...   364   e-124
TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa] ...   358   e-122
KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON...   352   e-120
NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON}             351   e-120
NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON}            347   e-118
KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON}              346   e-118
SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} simi...   342   e-116
ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} simi...   342   e-115
Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON} ...   337   e-114
CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON...   336   e-113
Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON} si...   335   e-113
KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON...   328   e-110
KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}...   323   e-109
AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic ...   322   e-107
ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} simi...   315   e-105
Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)      314   e-105
KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {O...   306   e-102
Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa...   301   e-100
Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)      290   1e-95
KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {O...   288   4e-95
TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON}            288   5e-95
KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}                   222   1e-70
YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open rea...   197   3e-61
YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading ...   114   2e-30
SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly...    77   1e-14
ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON} S...    60   5e-09
Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar...    59   9e-09
KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]...    57   2e-08
KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7....    57   3e-08
TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {O...    55   2e-07
ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly...    52   1e-06
Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}...    52   1e-06
Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {...    52   2e-06
TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {O...    50   5e-06
NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON} Anc_7...    50   5e-06
YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threon...    49   1e-05
TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON} Anc_7...    49   2e-05
Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W ...    49   2e-05
Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W ...    48   2e-05
CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {...    48   2e-05
SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {O...    47   3e-05
KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly...    48   3e-05
NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {O...    48   3e-05
KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {O...    47   4e-05
Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W ...    46   1e-04
YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}  SR...    44   5e-04
Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON} YKL...    43   6e-04
NCAS0C05620 Chr3 (1144950..1146458) [1509 bp, 502 aa] {ON} Anc_4...    33   1.3  
Suva_6.33 Chr6 complement(57692..60781) [3090 bp, 1029 aa] {ON} ...    32   3.7  
AGR137W Chr7 (1006520..1008031) [1512 bp, 503 aa] {ON} Syntenic ...    31   4.7  

>SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 364

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/364 (91%), Positives = 332/364 (91%)

Query: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGN 60
           MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGN
Sbjct: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGN 60

Query: 61  KTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGD 120
           KTAHVF                 FSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGD
Sbjct: 61  KTAHVFASSGGNAGLAAATACRAFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGD 120

Query: 121 ADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIV 180
           ADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIV
Sbjct: 121 ADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIV 180

Query: 181 CSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSL 240
           CS               KHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSL
Sbjct: 181 CSIGGGGLYNGIIEGLEKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSL 240

Query: 241 GTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLL 300
           GTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLL
Sbjct: 241 GTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLL 300

Query: 301 EDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRLGRPLTPSFTYETTPVDRKLEPVVN 360
           EDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRLGRPLTPSFTYETTPVDRKLEPVVN
Sbjct: 301 EDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRLGRPLTPSFTYETTPVDRKLEPVVN 360

Query: 361 LSAV 364
           LSAV
Sbjct: 361 LSAV 364

>NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3
          Length = 367

 Score =  383 bits (984), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 189/339 (55%), Positives = 231/339 (68%), Gaps = 3/339 (0%)

Query: 1   MTSFYSKTPLLRRIFPSSVL---SATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIES 57
           M+  Y+KTPLLR+ FP+      ++ PQF +KYE  QPSGSFKSRGIG+LI ++A RI+ 
Sbjct: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60

Query: 58  EGNKTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNH 117
            GNK+  VF                  SLPCTVVVPT T  RMV KIR TGA+VI++G H
Sbjct: 61  SGNKSPQVFSSSGGNAGFAAATASQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120

Query: 118 WGDADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVK 177
           W +AD YL  SVM  ID    EP+Y HPFDNP IWEGHST+VDEIV++L  Q I  +++K
Sbjct: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180

Query: 178 GIVCSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVA 237
           GIVCS               KH LA  IPI+GVETKGC VF+ SLK GK + F KITS+A
Sbjct: 181 GIVCSVGGGGLYNGIIQGLEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240

Query: 238 TSLGTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNP 297
           TSLGTA+I  +T E A KY+T+SVV+ D DV+ TCL +  D N+V EPACGASLH  YN 
Sbjct: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300

Query: 298 HLLEDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRL 336
           ++LE+ LG  L  +DII+VIACGGSS TVQDL++  VRL
Sbjct: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRL 339

>NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON}
           Anc_1.3
          Length = 377

 Score =  375 bits (962), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 184/344 (53%), Positives = 229/344 (66%), Gaps = 8/344 (2%)

Query: 1   MTSFYSKTPLLRRIFPSSV--------LSATPQFLVKYEVFQPSGSFKSRGIGHLITQSA 52
           M+  Y+KTPLLR+ F +SV        ++ATPQF VKYE  QPSGSFKSRGIG+LI +SA
Sbjct: 1   MSVVYNKTPLLRQFFQNSVAKSSATASVTATPQFFVKYECLQPSGSFKSRGIGNLILKSA 60

Query: 53  ARIESEGNKTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVI 112
             I   G KT  VF                  SLPCTVVVPT T  RMV KI+ TGA+VI
Sbjct: 61  MNINKIGQKTPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120

Query: 113 VHGNHWGDADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIP 172
           ++G HW +AD +L  S+M  IDT   EP+Y HPFDNP+IWEGH+T+VDEI++SL  Q IP
Sbjct: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180

Query: 173 ASQVKGIVCSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDK 232
            ++VKGIVCS               K++LA  IPI+GVETKGC VF+ SLK  K + F K
Sbjct: 181 INKVKGIVCSVGGGGLYNGIIQGLQKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240

Query: 233 ITSVATSLGTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLH 292
           ITS+ATSLGTA I KKT E A KY T+SVV+ D +V+ TCL +  D N+V EPACGAS+H
Sbjct: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300

Query: 293 FGYNPHLLEDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRL 336
             Y+  +LE +LG  L  +DII+VIACGGSS T  DL+ + + +
Sbjct: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNM 344

>KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}
           Anc_1.3 YCL064C
          Length = 359

 Score =  372 bits (955), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 185/343 (53%), Positives = 226/343 (65%), Gaps = 3/343 (0%)

Query: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGN 60
           M+  Y+KTPLLR+ FP   L   PQ  +KYE  QPSGSFKSRGIG+LI ++A RI+  G 
Sbjct: 1   MSLVYNKTPLLRQFFPGKNL---PQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGE 57

Query: 61  KTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGD 120
           + AHVF                  SLPCTVVVPT T  RMV KIR TGA VIV+G HW +
Sbjct: 58  RRAHVFASSGGNAGFAAATACQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKE 117

Query: 121 ADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIV 180
           ADQ+L ++VM  ID    EP+Y HPFDNP IWEGH+T+VDEI+E+L  Q+I    VKGIV
Sbjct: 118 ADQHLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIV 177

Query: 181 CSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSL 240
           CS               KH LA  IPI+GVET+GC V + SL   K + F+KITS+ATSL
Sbjct: 178 CSVGGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSL 237

Query: 241 GTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLL 300
           GTA+I K+T E A KYNT+SVV+ D+ V+ TCL +  D N+V EPACGA+LH  YN  +L
Sbjct: 238 GTASISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDIL 297

Query: 301 EDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRLGRPLTPS 343
           E  LG SL P D+I+VIACGGSS T++DL+   V L     PS
Sbjct: 298 EKALGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSKSIPS 340

>TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3
           YCL064C
          Length = 357

 Score =  370 bits (951), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 178/330 (53%), Positives = 220/330 (66%), Gaps = 3/330 (0%)

Query: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGN 60
           M+  Y+KTPLLR +FP   L   PQ  +KYE FQPSGSFKSRGIG+LI  ++  I+    
Sbjct: 1   MSQVYNKTPLLRHLFPGKNL---PQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSK 57

Query: 61  KTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGD 120
           K+  VF                  SLPCTVVVPT T LRMV KI+ TGA+VIV GNHW +
Sbjct: 58  KSPEVFSSSGGNAGLAAATASKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKE 117

Query: 121 ADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIV 180
           AD YL  +V+  ID    EP+Y HPFDN  IWEGH+T++DEIVE+  +Q IP  +VK IV
Sbjct: 118 ADTYLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIV 177

Query: 181 CSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSL 240
           CS               KHDLAT IP++GVET GC VF+ SLK GK + F+KI ++ATSL
Sbjct: 178 CSVGGGGLYNGIIQGLEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSL 237

Query: 241 GTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLL 300
           GTA I  +T E A KYNTKS+V+ D  VV TCL F  D+N+V EPACGA+LH GYN  +L
Sbjct: 238 GTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDIL 297

Query: 301 EDTLGGSLGPEDIIIVIACGGSSTTVQDLQ 330
           E +LG  L  +DI+++IACGGSS TVQ+L+
Sbjct: 298 EKSLGKKLATDDIVLIIACGGSSNTVQELE 327

>KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON}
           Anc_1.3 YCL064C
          Length = 365

 Score =  370 bits (949), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 175/339 (51%), Positives = 229/339 (67%), Gaps = 3/339 (0%)

Query: 1   MTSFYSKTPLLRRIFP---SSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIES 57
           M+  Y+KTPLLR+ FP   S   ++ PQF +KYE  QPSGSFKSRGIG+LI + A +I  
Sbjct: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60

Query: 58  EGNKTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNH 117
           +G K   VF                  SLPCTVVVPT T  RM+ KI+ TGA+VI+ G  
Sbjct: 61  KGTKRPEVFASSGGNAGYAAAVACQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120

Query: 118 WGDADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVK 177
           W +ADQYL +SVM  I+  + +P+Y HPFDNP+IWEGHS+IVDEI+++L  Q++  S +K
Sbjct: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180

Query: 178 GIVCSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVA 237
           GIVCS               +H L   IP++GVET+GC VF+ SLK GK + F+KITS+A
Sbjct: 181 GIVCSVGGGGLYNGIIQGLERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEKITSIA 240

Query: 238 TSLGTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNP 297
           TSL TA+I  KT ENALKY T+SV++ DADV+ TCL +  D N+V EPACGAS+H  YN 
Sbjct: 241 TSLATASISAKTFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300

Query: 298 HLLEDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRL 336
            +LE+ LG  L  +D ++VIACGGSS T+QD+++  +RL
Sbjct: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRL 339

>Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON}
           YCL064C (REAL)
          Length = 361

 Score =  367 bits (943), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 180/343 (52%), Positives = 226/343 (65%), Gaps = 3/343 (0%)

Query: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGN 60
           M+  Y+KTPLLR+ FP   L+   QF +KYE  QPSGSFKSRGIG+LI ++A RI+  G 
Sbjct: 1   MSIVYNKTPLLRQFFPGKSLA---QFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGK 57

Query: 61  KTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGD 120
           ++  VF                  SLPCTVVVPT T  RMV KIR TGA VIV+G  W +
Sbjct: 58  RSPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKE 117

Query: 121 ADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIV 180
           AD YL  +VM  ID    EP+Y HPFDNP IWEGHS++VDEIV+ L+ QR+P  +VKGIV
Sbjct: 118 ADTYLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIV 177

Query: 181 CSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSL 240
           CS               +H LA  IPI+GVETKGC VF+ SL+ G+P+ F KITS+ATSL
Sbjct: 178 CSVGGGGLYNGIIQGLERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSL 237

Query: 241 GTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLL 300
           GTA I  +T E A KYNTKSVV+ D DV+ TCL ++   N+V EPACGA+LH GY+  +L
Sbjct: 238 GTANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDIL 297

Query: 301 EDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRLGRPLTPS 343
           E  L   L  +DI+++IACGGSS TVQDL++    + +   P+
Sbjct: 298 ETALDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKEGVPA 340

>YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}
           CHA1Catabolic L-serine (L-threonine) deaminase,
           catalyzes the degradation of both L-serine and
           L-threonine; required to use serine or threonine as the
           sole nitrogen source, transcriptionally induced by
           serine and threonine
          Length = 360

 Score =  366 bits (940), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 178/342 (52%), Positives = 227/342 (66%), Gaps = 3/342 (0%)

Query: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGN 60
           M+  Y+KTPLLR+ FP     A+ QF +KYE  QPSGSFKSRGIG+LI +SA RI+ +G 
Sbjct: 1   MSIVYNKTPLLRQFFPGK---ASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGK 57

Query: 61  KTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGD 120
           ++  VF                  SLPCTVVVPT T  RMV KIR TGA VIV G +W +
Sbjct: 58  RSPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKE 117

Query: 121 ADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIV 180
           AD +L  +VM  ID+   EP+Y HPFDNP IWEGHS+++DEIV+ L+ Q I  ++VKGIV
Sbjct: 118 ADTFLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIV 177

Query: 181 CSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSL 240
           CS               ++ LA  IPI+GVET GC VF+ SLK G+P+ F KITS+ATSL
Sbjct: 178 CSVGGGGLYNGIIQGLERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSL 237

Query: 241 GTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLL 300
           GTA I  +T E A KYNT+SVV+ D DV+ TCL +    N+V EPACGA+LH GYN  +L
Sbjct: 238 GTAVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKIL 297

Query: 301 EDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRLGRPLTP 342
           E+ LG  L  +DI+I+IACGGSS T++DL++    + +  TP
Sbjct: 298 ENALGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKKDTP 339

>Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL064C
           (REAL)
          Length = 360

 Score =  365 bits (938), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 179/344 (52%), Positives = 228/344 (66%), Gaps = 3/344 (0%)

Query: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGN 60
           M+  Y+KTPLLR+ FPS    +  QF +KYE  QPSGSFKSRGIG+LI ++A RI+ +G 
Sbjct: 1   MSIVYNKTPLLRQFFPSK---SPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGR 57

Query: 61  KTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGD 120
           ++  VF                  SLPCTVVVPT T  RMV KIR TGA VIV+G +W +
Sbjct: 58  RSPQVFASSGGNAGLAAATTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKE 117

Query: 121 ADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIV 180
           AD +L  ++M  ID+   EP+Y HPFDNP IWEGHS++VDEIV+ L+ QRI  ++VKGIV
Sbjct: 118 ADTFLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIV 177

Query: 181 CSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSL 240
           CS               ++ LA  IPI+GVET GC VF+ SL+ G+P+ F KITS+ATSL
Sbjct: 178 CSVGGGGLYNGIIQGLERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSL 237

Query: 241 GTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLL 300
           GTA I  +T E A KYNTKSVV+ D DV+ TCL +    N+V EPACGA+LH GY+  +L
Sbjct: 238 GTAVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEIL 297

Query: 301 EDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRLGRPLTPSF 344
           E  LG  L  +DI+I+IACGGSS TVQDL++    L +   P+ 
Sbjct: 298 EKALGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQGLPAI 341

>Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON}
           YCL064C (REAL)
          Length = 360

 Score =  364 bits (934), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 178/343 (51%), Positives = 224/343 (65%), Gaps = 3/343 (0%)

Query: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGN 60
           M+  Y+KTPLLR+ FP     +  QF +KYE  QPSGSFKSRGIG+LI +SA RI+ +G 
Sbjct: 1   MSIVYNKTPLLRQFFPGK---SPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGK 57

Query: 61  KTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGD 120
           K+  +F                  SLPCTVVVPT T  RMV KIR TGA VIV G +W +
Sbjct: 58  KSPQIFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKE 117

Query: 121 ADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIV 180
           AD +L   VM  IDT   EP+Y HPFDNP IWEGHS++VDE+V+ LE QRI  ++VKGIV
Sbjct: 118 ADTFLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIV 177

Query: 181 CSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSL 240
           CS               ++ LA  IPI+GVET GC VF+ SL+ G+P+ F KITS+ATSL
Sbjct: 178 CSVGGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSL 237

Query: 241 GTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLL 300
           GTA I  +T + A KYNT+SVV+ D DV+ TCL +    N+V EPACGA+LH GYN  +L
Sbjct: 238 GTAVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEIL 297

Query: 301 EDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRLGRPLTPS 343
           E  LG  L  +DI+I+IACGGSS T+QDL++      +   P+
Sbjct: 298 ERALGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKRSAPA 340

>TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa]
           {ON} Anc_1.3 YCL064C
          Length = 360

 Score =  358 bits (919), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 189/366 (51%), Positives = 234/366 (63%), Gaps = 13/366 (3%)

Query: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEG- 59
           M+  Y+KTPLLR+ F  S +   PQF +KYE  QPSGSFKSRGIG+LI +S  +I S   
Sbjct: 1   MSIVYNKTPLLRQFFRGSPI---PQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNL 57

Query: 60  NKTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWG 119
           NK   VF                  S+PCTVVVPT T  RMV KI+ TGA VIV+G HW 
Sbjct: 58  NKRPQVFSSSGGNAGLAAATASRRLSIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWS 117

Query: 120 DADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGI 179
           +AD YL   V+  ID  + EP+Y HPFDNP+IWEGHST++DEI+ESL  Q I    VK I
Sbjct: 118 EADDYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAI 177

Query: 180 VCSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATS 239
            CS               K++LA+ IPIIGVET GC+VF+ SLK  K + F KI ++ATS
Sbjct: 178 TCSIGGGGLYNGLIRGLEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATS 237

Query: 240 LGTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHL 299
           LGT+TI  KT ENALKYNTKSVV+ + DV++TCL +  D N V EPACGA+LH  YN  L
Sbjct: 238 LGTSTISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGL 297

Query: 300 LEDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVR----LGRPLTPS--FTYETTPVDR 353
           +E+ L  +L  +DIIIVIACGGSS TVQ+L++  ++       P TP   FT   TP+  
Sbjct: 298 IENALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYKLDYSLPQTPEYIFTENHTPI-- 355

Query: 354 KLEPVV 359
            L PV+
Sbjct: 356 -LSPVL 360

>KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 341

 Score =  352 bits (904), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 171/334 (51%), Positives = 226/334 (67%), Gaps = 2/334 (0%)

Query: 1   MTSFYSKTPLLRRIFPSSV--LSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESE 58
           M S + KTPLL   F +S   L   PQF++K E  QPSGSFKSRGIG++IT+ A +I SE
Sbjct: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60

Query: 59  GNKTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHW 118
           GNK  HVF                  S+PC+VVVP +T+ RMV KI   GA+V V+G +W
Sbjct: 61  GNKLPHVFASSGGNAGLAAATTSRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120

Query: 119 GDADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKG 178
            +AD++L  S++   + ++ + +YAHPFD+P+IWEGHS+IVDEI++SL+ Q+I    +K 
Sbjct: 121 KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA 180

Query: 179 IVCSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVAT 238
           IVCS               +H L   IPIIGVE+KGCEVF+ SLK GK   F+ ITS+AT
Sbjct: 181 IVCSVGGGGLYNGIIEGLSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT 240

Query: 239 SLGTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPH 298
           S+GT +I KKTLENAL+Y+TKSVVL+D +++ TCL FAD+TNI+PEPACGA+LH GY P 
Sbjct: 241 SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD 300

Query: 299 LLEDTLGGSLGPEDIIIVIACGGSSTTVQDLQQM 332
           +L   L     PED+II+I CGGS+T+  DL  +
Sbjct: 301 ILYQALNSDFTPEDVIIMIGCGGSATSYNDLASL 334

>NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  351 bits (901), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 166/336 (49%), Positives = 227/336 (67%), Gaps = 3/336 (0%)

Query: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGN 60
           M+  Y+KTPLLR+ F S+ +   P+  +KYE  QPSGSFKSRGIG LI Q   +++ +GN
Sbjct: 1   MSFIYNKTPLLRQTFDSAKIG--PRIFLKYENLQPSGSFKSRGIGCLILQHINKLKQDGN 58

Query: 61  KTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGD 120
           KTAHVF                   +PCTVVVP +T  RMV KIR+TGA V++ G+HW +
Sbjct: 59  KTAHVFSSSGGNAGLAAATASRSLQVPCTVVVPKSTKERMVNKIRKTGASVLIKGDHWKE 118

Query: 121 ADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIV 180
           AD +L +S M  +D T+ +P+Y HPFD+PVIWEGHSTI+DEIV++L+ ++I   +VKGI+
Sbjct: 119 ADDFLRKS-MKEMDNTQEQPIYVHPFDDPVIWEGHSTIIDEIVQTLQTEKISIEKVKGII 177

Query: 181 CSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSL 240
           CS               +H+LA +IP+I VETKGC+V ++SLK G P+   KITSVATSL
Sbjct: 178 CSVGGGGLFNGIIKGLERHNLAQSIPVIAVETKGCDVLNKSLKNGTPVQLPKITSVATSL 237

Query: 241 GTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLL 300
           G+  I     ENA+KYN++S+ L+D DV+ TCL + DD ++  EPACGAS+H  YNP ++
Sbjct: 238 GSTYISSTAFENAMKYNSRSITLNDKDVLETCLKYNDDFSMTLEPACGASVHLAYNPGIV 297

Query: 301 EDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRL 336
           E  LG +L   DI+IV+ CGGSS T+ DL+ +  +L
Sbjct: 298 ESALGTALSNHDIVIVVLCGGSSCTLHDLESLNSKL 333

>NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON} 
          Length = 347

 Score =  347 bits (890), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 169/337 (50%), Positives = 217/337 (64%), Gaps = 2/337 (0%)

Query: 1   MTSFYSKTPLLRRIFPSSV-LSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEG 59
           M+  Y+KTPLLRR+FP+ + + + PQ  VKYE  QPSGSFKSRGIGHLI ++A R++  G
Sbjct: 1   MSLVYNKTPLLRRVFPTGLKVPSAPQLYVKYESLQPSGSFKSRGIGHLIMKNALRVQQLG 60

Query: 60  NKTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWG 119
            K+ HVF                   LPCTVVVPT+T  RMV KIR  G +VIV G+HW 
Sbjct: 61  GKSLHVFSSSGGNAGLAAATASQSLKLPCTVVVPTSTKSRMVEKIRNVGTEVIVKGSHWK 120

Query: 120 DADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGI 179
           +AD +L  SV+P +D  + EP+Y HPFD+P +WEGHST+VDEIV++   Q +  ++VK I
Sbjct: 121 EADSFLKNSVIPSVDRIE-EPIYVHPFDHPDVWEGHSTMVDEIVDTFRSQNVSLNKVKAI 179

Query: 180 VCSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATS 239
           VCS               K+ LA  IP+I +ET GC  F+  LKA K +   KITSVATS
Sbjct: 180 VCSVGGGGLYNGIIHGLEKYHLADKIPVIAMETDGCNSFNACLKAKKQVELPKITSVATS 239

Query: 240 LGTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHL 299
           LG   +  K  EN  +Y + SVVL D DVV TCL +A+D NI+ EPACGASLH  YN  L
Sbjct: 240 LGATGVATKAFENGQRYQSPSVVLQDIDVVNTCLKYANDFNIITEPACGASLHMAYNTKL 299

Query: 300 LEDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRL 336
           +E  LG  L  +DII++IACGGS+ T++DLQ    +L
Sbjct: 300 IEKALGKKLDSDDIIVIIACGGSANTMEDLQNSYKQL 336

>KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score =  346 bits (888), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 168/339 (49%), Positives = 227/339 (66%), Gaps = 3/339 (0%)

Query: 1   MTSFYSKTPLLRRIFPSS---VLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIES 57
           M + Y+KTPLLR  F  +      ++PQ   KYE FQP  SFKSRGIG+LI ++A ++E 
Sbjct: 1   MPTVYNKTPLLRPYFLEANRGTSDSSPQVFFKYESFQPGCSFKSRGIGNLILKNAKKVEE 60

Query: 58  EGNKTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNH 117
           EG KT  VF                  S+PCTVVVP++T +RMV KIR TGA VIV GN 
Sbjct: 61  EGIKTLEVFSSSGGNAGYAAAVACRELSIPCTVVVPSSTKVRMVEKIRSTGAQVIVSGNF 120

Query: 118 WGDADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVK 177
           W +AD+YL  SV+  +D++K EP+Y HPFD+P+IWEGHSTI+DEIVESL  + +  S+VK
Sbjct: 121 WKEADEYLRNSVINKVDSSKVEPLYVHPFDDPLIWEGHSTIIDEIVESLNDENVHTSKVK 180

Query: 178 GIVCSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVA 237
           G+VCS               +H LA  IP+I VET+GC VF+  L+ GK + F+KI+S+A
Sbjct: 181 GVVCSIGGGGLYNGIIEGLERHALADKIPVIAVETEGCHVFNTCLELGKHVEFEKISSIA 240

Query: 238 TSLGTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNP 297
           TSLG+ +I  KT E A KY++K VVL D DV+ TCL +++D+N++ EPAC AS+H  YN 
Sbjct: 241 TSLGSPSISTKTFEYAQKYHSKGVVLQDIDVLETCLRYSEDSNMIIEPACAASVHLAYNV 300

Query: 298 HLLEDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRL 336
            +LE+ L   L  +D+II+IACGGS+TT+QD++    +L
Sbjct: 301 DILEEALNKKLSKDDVIIIIACGGSATTLQDIKDSLAKL 339

>SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 339

 Score =  342 bits (876), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 163/335 (48%), Positives = 219/335 (65%), Gaps = 2/335 (0%)

Query: 3   SFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKT 62
           SFY+KTPLL R+  ++     P+F +KYE  QP GSFKSRGIG+L+ +S  +   +G K+
Sbjct: 6   SFYNKTPLLPRVLTTT--DGAPRFFLKYEFLQPGGSFKSRGIGYLVKKSYEKARRDGGKS 63

Query: 63  AHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDAD 122
             VF                 FS+ CTVVVP TT  RMV KIR+TGA+V+V+G HWG AD
Sbjct: 64  LAVFSSSGGNAGLAAAIAAQTFSINCTVVVPRTTKSRMVEKIRKTGAEVLVYGKHWGMAD 123

Query: 123 QYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCS 182
           +YL   VM  +D +K  P+Y HPFDNP+IW+GHSTIVDE+V  L+ + +   +VK IVCS
Sbjct: 124 EYLREVVMKEVDVSKVVPLYVHPFDNPIIWQGHSTIVDEVVAQLKEENVSIDKVKAIVCS 183

Query: 183 XXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGT 242
                           H LA  IPI+ +ETKGC+V ++SL +G P+V + +TSVA+SL +
Sbjct: 184 VGGGGLYNGIVKGLETHQLADRIPILAIETKGCDVLNKSLNSGNPVVLESLTSVASSLAS 243

Query: 243 ATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLLED 302
             I +K  ENA KY +KS++L D+ V+ TCL+FADD  IV EPACGASL+  Y+P LL  
Sbjct: 244 PYISEKAFENARKYESKSILLKDSQVIETCLNFADDAGIVVEPACGASLYSCYHPELLPL 303

Query: 303 TLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRLG 337
            +G  L  +D+I+VIACGGS+ T +DL+ M+  LG
Sbjct: 304 YIGKELTEDDVIVVIACGGSAVTYKDLEYMKKELG 338

>ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 410

 Score =  342 bits (876), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 167/356 (46%), Positives = 228/356 (64%), Gaps = 11/356 (3%)

Query: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGN 60
           M S Y+KTPLL++IF  +    + Q  VKYE  QPSGSFKSRGIGHLI++ A  I+ +G 
Sbjct: 47  MPSIYNKTPLLKQIFNHAT---SAQVFVKYECLQPSGSFKSRGIGHLISKRAKDIQGDGR 103

Query: 61  KTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGD 120
           K+ HVF                  +LPCTVV+PTTT  RM  KIR  GA+V+V G+HW +
Sbjct: 104 KSPHVFSSSGGNAGYAAAVAAQKLNLPCTVVIPTTTKQRMADKIRGCGANVVVQGSHWKE 163

Query: 121 ADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIV 180
           AD +L   +   ++    EP+Y HPFDNP IWEGH++IVDEI+ SL+ +    ++VKGIV
Sbjct: 164 ADSHLKNILQNQVNMAILEPIYVHPFDNPTIWEGHASIVDEIISSLKNENTALNRVKGIV 223

Query: 181 CSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSL 240
           CS               K++LA  IP++ VETKGC V + SL+ G+ + F+K+ SVATSL
Sbjct: 224 CSVGGGGLYNGIIQGLEKYNLANKIPLLAVETKGCHVLNTSLQVGQCVEFNKMNSVATSL 283

Query: 241 GTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLL 300
            T+ I  +TL+   KY +KS+VL D +V++TCL +A++ N++ EPACGASLH GY+P L+
Sbjct: 284 CTSQISSRTLDYVQKYGSKSIVLEDKEVLQTCLKYAENFNMITEPACGASLHLGYHPQLI 343

Query: 301 EDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRLG--------RPLTPSFTYET 348
           E  LG +L  +D+IIVIACGGSS T+ DL++   +L         R  TPS  +E 
Sbjct: 344 ERALGKNLDKDDVIIVIACGGSSNTILDLEESLAKLEEAPHLSIRRNATPSLEHEN 399

>Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON}
           complement(7840..8892) [1053 nt, 351 aa]
          Length = 350

 Score =  337 bits (865), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 174/350 (49%), Positives = 225/350 (64%), Gaps = 9/350 (2%)

Query: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGN 60
           M+  Y+KTPLL+  FP   L   PQF +KYE  QPSGSFKSRGIG+LI ++A RI+    
Sbjct: 1   MSLVYNKTPLLKHFFPGKNL---PQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINV 57

Query: 61  KTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGD 120
           K  +VF                  SLPCTVVVPT T  RMV KIR TGA+VI+ GNHW +
Sbjct: 58  KKPYVFSSSGGNAGLAAATASQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKE 117

Query: 121 ADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIV 180
           AD +L +++M  I+  K EP+Y HPFDNP+IWEGHST+VDEI+E+  +Q+     +K IV
Sbjct: 118 ADNFLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIV 177

Query: 181 CSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSL 240
           CS               K++LA  IP++GVET+GC VF+ SLK  KP+ F KI+++ATSL
Sbjct: 178 CSVGGGGLYNGIIQGLEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSL 237

Query: 241 GTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLL 300
           GTA I  +  + A KYNTKSVV+ D DVV TCL F  D N+V EPACGA++H GY+  LL
Sbjct: 238 GTANISNQMFDYAKKYNTKSVVVEDKDVVETCLKFTHDHNMVIEPACGAAIHLGYHTDLL 297

Query: 301 EDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRL------GRPLTPSF 344
           E  LG  L  +D ++++ACGGSS TV++L+   + L        P  PSF
Sbjct: 298 ETALGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQKASPTIPSF 347

>CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|P25379 Saccharomyces
           cerevisiae YCL064c CHA1 L-serine/L-threonine deaminase
          Length = 360

 Score =  336 bits (862), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 168/337 (49%), Positives = 219/337 (64%), Gaps = 8/337 (2%)

Query: 3   SFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEG-NK 61
           S Y+KTPL+R+IFPS      PQ  +K+E FQPSGSFKSRGIGHLI++ + RI   G  K
Sbjct: 2   SVYNKTPLIRQIFPS-----IPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGK 56

Query: 62  TAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDA 121
              VF                  +LPCTVV+PT T  RM  KIR TGA+VIV GN W +A
Sbjct: 57  KPMVFASSGGNAGLAAATAAKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEA 116

Query: 122 DQYLHRSVMPCIDT--TKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGI 179
           D YL  +++  ++      EP+Y HPFDNP IWEGH+++VDEIVE  + + IP +++K I
Sbjct: 117 DNYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAI 176

Query: 180 VCSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATS 239
           VCS               K++LA  IPI+GVETKGC VF+ SL+  K + F KITS+ATS
Sbjct: 177 VCSVGGGGLYNGIIQGLEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATS 236

Query: 240 LGTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHL 299
           LGTA I  +  + A +Y TKSVVLSD DVV+TCL +  D N+V EPACGA++H  Y+  +
Sbjct: 237 LGTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEI 296

Query: 300 LEDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRL 336
           LE  LG  L  +DI++V+ACGGSS TV+D++ +  RL
Sbjct: 297 LEKELGTKLNADDIVLVVACGGSSNTVEDMESILQRL 333

>Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON}
           similar to Ashbya gossypii AFR747W
          Length = 364

 Score =  335 bits (860), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 172/341 (50%), Positives = 221/341 (64%), Gaps = 7/341 (2%)

Query: 1   MTSFYSKTPLLRRIF--PSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESE 58
           M+S Y KTPLLRR F  P+  +S  PQFLVKYE FQPSGSFKSRGIG+LI    + I  +
Sbjct: 1   MSSLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD 60

Query: 59  GNKTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHW 118
             K  HVF                   +PCTVVVPT+T  R++ KI  TGA +I  G+++
Sbjct: 61  PAKQPHVFSSSGGNAGLAAATASQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120

Query: 119 GDADQYLHRSVMPCIDTT----KFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPAS 174
            +AD YL   +    +      K  P+Y HPF++P+IW GHS IV+EI+ESL  + IP S
Sbjct: 121 AEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYS 180

Query: 175 QVKGIVCSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKIT 234
           +VKGIVCS               +H LA TIPIIGVET+GCEV H+SL AGK + F K  
Sbjct: 181 RVKGIVCSVGGGGLYNGIIEGLERHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKAL 240

Query: 235 SVATSLGTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFG 294
           SVATSL   TI K+TL  A KY TKS+VL + +V+ TCL F D++NIV EPACGA+LH G
Sbjct: 241 SVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLG 300

Query: 295 YNPHLLEDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVR 335
           Y+P +L   L G L  EDI+I+IACGGS+TT+ DL++++++
Sbjct: 301 YHPAILHKEL-GPLSSEDIVILIACGGSATTLADLRELKLK 340

>KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 377

 Score =  328 bits (841), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 157/330 (47%), Positives = 216/330 (65%), Gaps = 4/330 (1%)

Query: 4   FYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIE-SEGNKT 62
            +SKTPLL+  F  S     PQ L+KYE  QPSGSFKSRGIGHLI+     I+ S   K 
Sbjct: 24  LFSKTPLLKHQFKRS---KGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKI 80

Query: 63  AHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDAD 122
            HVF                  ++PCTVVV   T  R++ KIR  GADV+VHGNHW +AD
Sbjct: 81  GHVFASSGGNAGLAAAVASLELNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEAD 140

Query: 123 QYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCS 182
            ++   +M  +D+ K+EP+Y+HPFDNP+IWEGHS +VDEI++ L   +IP +++KGIVCS
Sbjct: 141 SFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCS 200

Query: 183 XXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGT 242
                          +++LA  IPI+ VETKG +V   SL+ G P+ F+KI+S ATSLGT
Sbjct: 201 FGGGGLYNGLILGLQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGT 260

Query: 243 ATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLLED 302
           ATI     +N  ++ +KS V+SD +V+ TCL F++DTNIV EP CGA+L+FGYN   L++
Sbjct: 261 ATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQN 320

Query: 303 TLGGSLGPEDIIIVIACGGSSTTVQDLQQM 332
            LG  +  +D +I+I CGGSST+++DL+++
Sbjct: 321 ILGSDIKDDDYVILIGCGGSSTSLEDLKEL 350

>KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}
           Anc_1.3 YCL064C
          Length = 344

 Score =  323 bits (828), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 155/334 (46%), Positives = 215/334 (64%), Gaps = 3/334 (0%)

Query: 1   MTSFYSKTPLLRRIFPSSVLSAT---PQFLVKYEVFQPSGSFKSRGIGHLITQSAARIES 57
           M   Y+KTPL+ + FP + + ++   PQ L+KYE  QPSGSFKSRGIG+L+ Q A +I+ 
Sbjct: 1   MPIVYNKTPLVPQSFPGTEIRSSDSLPQVLIKYEYLQPSGSFKSRGIGNLVYQKALQIQK 60

Query: 58  EGNKTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNH 117
              K   VF                  SLPCTVVVP  T  RM+ KIR TGA V +HG  
Sbjct: 61  NSTKNPEVFSSSGGNAGYAAAVVAQKLSLPCTVVVPAATKQRMIEKIRSTGAKVTIHGTF 120

Query: 118 WGDADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVK 177
           W  AD+Y+  SV+  I+T K EP+Y HP D+P+IWEG+S IVDE++ESL+ Q+I  S+VK
Sbjct: 121 WKGADKYMKNSVLNEINTEKVEPIYVHPSDDPLIWEGNSMIVDELMESLQEQKIDPSKVK 180

Query: 178 GIVCSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVA 237
            IVCS               ++ LA  IPI+GVET G  VF+  LK+GK + F+KI++VA
Sbjct: 181 AIVCSVGGGGLYNGLMQGLERYKLADKIPIVGVETDGSHVFNTCLKSGKHIEFEKISTVA 240

Query: 238 TSLGTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNP 297
           TSLG+A+I KKT E A+KY  + V++ D +V+ TCL +  D N++ EPACGA++H  Y+ 
Sbjct: 241 TSLGSASITKKTFEYAMKYRPRGVIVKDIEVLETCLRYTQDYNMITEPACGAAIHLAYHV 300

Query: 298 HLLEDTLGGSLGPEDIIIVIACGGSSTTVQDLQQ 331
            +LE  L   L  +D++I+IACGGSS ++ D+++
Sbjct: 301 DILEKALDTRLDGDDVVIIIACGGSSNSLHDMEE 334

>AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL064C (CHA1)
          Length = 426

 Score =  322 bits (825), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 169/361 (46%), Positives = 226/361 (62%), Gaps = 8/361 (2%)

Query: 1   MTSFYSKTPLLRRIFPSSVL--SATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESE 58
           M SFY KTPL+R +F    +  +A P+ ++KYE FQPSGSFKSRGIG+LI +   +I   
Sbjct: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128

Query: 59  GNKTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHW 118
            +   HVF                   LPCTVVVP TT  RMV +IR TGADVI  G+  
Sbjct: 129 SSLQPHVFASSGGNAGLAAATASRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188

Query: 119 GDADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKG 178
            ++D YL   +M  ++  K  P+YAHPFDNP+IWEGH+T+VDE+VE+L  Q +    VKG
Sbjct: 189 KESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKG 248

Query: 179 IVCSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVAT 238
           IVCS               KH LA +IP++ VET+GCEV H+SL  G+ +  +   SVAT
Sbjct: 249 IVCSVGGGGLYNGIVYGLEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVAT 307

Query: 239 SLGTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPH 298
           SL T+ +   TL  A KY TKSVVL    VV+TCL+FA+++NIV EPACGA+LH GY+P 
Sbjct: 308 SLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPE 367

Query: 299 LLEDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRLGRPLTPSFTYETTPVDRKLEPV 358
           +LE  L G L P+D++IVIACGGS+  + DL++ + +L +P    F    TP+  + E +
Sbjct: 368 ILEREL-GPLTPQDVVIVIACGGSTMNLADLKESEDQL-QPKIKDF---HTPIGTQHETI 422

Query: 359 V 359
           +
Sbjct: 423 I 423

>ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 335

 Score =  315 bits (806), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 159/332 (47%), Positives = 209/332 (62%), Gaps = 10/332 (3%)

Query: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESE-G 59
           M ++Y KTPLLR+I      +  PQ  +KYE  QP GSFKSRGIG+LI+     ++SE G
Sbjct: 1   MNNWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLIS-----LKSENG 55

Query: 60  NKTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWG 119
              +HV                    LPCTVVVPT+T  RMV KI+ +GA+VI+ G+HW 
Sbjct: 56  LVKSHVLSSSGGNAGLAAAIASKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWK 115

Query: 120 DADQYLHRSVMPCI--DTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVK 177
           +AD YL ++ +     D T  +P+Y HPFD+P +WEGHST+V EI+++L  Q I    V+
Sbjct: 116 EADNYLQQNYIQSFRNDGTS-KPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVR 174

Query: 178 GIVCSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVA 237
           GIVCS                H LA  IP+I VET GC V + SL AG+P++ DKITS+A
Sbjct: 175 GIVCSVGGGGLFNGIIKGLEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLA 234

Query: 238 TSLGTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNP 297
           TSLG+  I +   ENA++Y  KS+VL D DV+ TCL +  D   + EPACGASLH GY+P
Sbjct: 235 TSLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHP 294

Query: 298 HLLEDTLGGSLGPEDIIIVIACGGSSTTVQDL 329
            LLE+ LGG    +DII++IACGGS+TT +DL
Sbjct: 295 ELLENFLGG-FSKDDIIVIIACGGSTTTFKDL 325

>Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)
          Length = 338

 Score =  314 bits (804), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 156/337 (46%), Positives = 208/337 (61%), Gaps = 2/337 (0%)

Query: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGN 60
           + S Y KTPL+R++F +      P F +K+++ QP GSFKSRGIGHLI +      +EG+
Sbjct: 2   LISHYEKTPLIRQVFDNG--KTNPLFYIKHDMLQPGGSFKSRGIGHLIRKKNKEALAEGS 59

Query: 61  KTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGD 120
               VF                  +L CTVVVP TT  RMV KI+  GA VI+HG+HWG+
Sbjct: 60  GKLVVFSSSGGNAGLAAATSCRLMALNCTVVVPKTTKSRMVKKIQSAGAKVIIHGDHWGE 119

Query: 121 ADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIV 180
           AD+YL + VM        + +Y HPFD+ +IWEGHSTIVDEI++ L+ + I   QVKG+V
Sbjct: 120 ADEYLKQEVMAQEGQHGSKTLYVHPFDDEIIWEGHSTIVDEILQQLQEKDISPLQVKGLV 179

Query: 181 CSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSL 240
           CS               ++ LA  IPI+ VET GC+V ++SLK G P+  +++TSVATSL
Sbjct: 180 CSVGGGGLFSGIIKGLERNRLAGKIPIVAVETAGCDVLNKSLKNGSPVALERLTSVATSL 239

Query: 241 GTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLL 300
           G+  I     E+ + Y  KSVVLSD DV+ TCL +ADD N + EPACGASLH  Y+P +L
Sbjct: 240 GSPYIAPFAFESFITYGCKSVVLSDQDVLDTCLRYADDYNFIVEPACGASLHLCYHPEIL 299

Query: 301 EDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRLG 337
           E  LG  L  +D++I+IACGGS  T +DL +    LG
Sbjct: 300 EKALGQKLSEDDVVIIIACGGSCMTYEDLVKASKTLG 336

>KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  306 bits (783), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 152/336 (45%), Positives = 207/336 (61%), Gaps = 5/336 (1%)

Query: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGN 60
           M + Y+KTPLL +          P FL KYE  QP GSFK RG+ HLI +   +I+SEG 
Sbjct: 1   MPALYNKTPLLPKNLSGG---DGPTFLFKYENMQPGGSFKIRGVSHLIEKRVEQIKSEGK 57

Query: 61  KTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGD 120
           K  HVF                  S+PCTVVVPT T  RMV KIR+  A+VIV G++W +
Sbjct: 58  KPPHVFSSSGGNAGLAAATACHILSIPCTVVVPTLTKPRMVEKIRKANAEVIVKGSNWKE 117

Query: 121 ADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIV 180
           AD YL  +V+        +P+Y +PFD+P++WEGHST++DEI+ +L ++ I    VKGIV
Sbjct: 118 ADDYLRGTVIA--SNNAVQPIYVNPFDDPLLWEGHSTMIDEILNALNQENIKLDAVKGIV 175

Query: 181 CSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSL 240
           CS                H LA TIP++ VETKGC+V   SL A KP+  +KI S+ATSL
Sbjct: 176 CSVGGGGLFNGIVHGLENHQLACTIPVVAVETKGCDVLGLSLAAEKPVRLNKIDSIATSL 235

Query: 241 GTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLL 300
           G++ +  +  +NA+K+ ++SVVL D+DV+ TC  + DD N + EPACGA++H  Y+  +L
Sbjct: 236 GSSYVSCQAFDNAVKFKSRSVVLHDSDVLNTCYRYLDDFNAIVEPACGATIHTAYHYKIL 295

Query: 301 EDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRL 336
           E  LG  L P DIII+I CGGS  T+QDL+  + +L
Sbjct: 296 EKALGQKLTPSDIIIIIVCGGSCVTIQDLENAKRKL 331

>Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa]
           {ON} ANNOTATED BY YGOB - Skipping over stop codon in
           S288c
          Length = 337

 Score =  301 bits (770), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 154/327 (47%), Positives = 198/327 (60%), Gaps = 3/327 (0%)

Query: 3   SFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKT 62
           ++Y KTPL+R+   +        F VK+E+ QP GSFKSRGIGHLI +S     SEG+  
Sbjct: 4   TYYEKTPLIRQFLNNG--KTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSGK 61

Query: 63  AHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDAD 122
             VF                  +L C+VVVP TT  RMV KI+  GA VI+HG+HWG+AD
Sbjct: 62  LAVFSSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEAD 121

Query: 123 QYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCS 182
           +YL R  M        + +Y HPFDN  IWEGHSTIVDEI+E L+   I   +VK +VCS
Sbjct: 122 EYL-RHEMAQESQHGSKTLYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCS 180

Query: 183 XXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGT 242
                          ++ LA  IP++ VET GC+V ++SLK G P+  +K+TSVATSL +
Sbjct: 181 VGGGGLFSGIIKGLDRNQLAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLAS 240

Query: 243 ATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLLED 302
             I     E+  KY  KSVVLSD DV+ TCL +ADD N + EPACGASLH  Y+P +LED
Sbjct: 241 PYIASFAFESFNKYGCKSVVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILED 300

Query: 303 TLGGSLGPEDIIIVIACGGSSTTVQDL 329
            L   +  +DI+I+IACGGS  T +DL
Sbjct: 301 ILEQKIYEDDIVIIIACGGSCMTYEDL 327

>Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)
          Length = 339

 Score =  290 bits (741), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 143/336 (42%), Positives = 203/336 (60%), Gaps = 2/336 (0%)

Query: 5   YSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKTAH 64
           Y +TPL+ ++F +      P+  VK+E+ QP GSFKSRGIGHLI +S     ++G+    
Sbjct: 6   YERTPLIHQVFNNG--QTGPRLYVKHEMLQPGGSFKSRGIGHLINRSNEEALADGSGKLA 63

Query: 65  VFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDADQY 124
           VF                  +L CTVVVP TT  RM+ KI+  GA VI+HG+HWG+AD+Y
Sbjct: 64  VFSSSGGNAGLAAATACSSMALDCTVVVPKTTKSRMIKKIQNAGAKVIIHGSHWGEADEY 123

Query: 125 LHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCSXX 184
           L + +M        + +Y HPFD+  IWEGHSTIVDE+++ L+ + I  +++K +VCS  
Sbjct: 124 LRQELMIQESQLGSKTLYVHPFDDERIWEGHSTIVDEVLQQLQEKNISLARIKAMVCSVG 183

Query: 185 XXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGTAT 244
                        +++LA  I +I VET GC+V ++SL  G P+  ++++S+ATSLG+  
Sbjct: 184 GGGLFSGIIKGLERNNLAGKIRVIAVETIGCDVLNKSLVNGSPITLERLSSIATSLGSPY 243

Query: 245 ICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLLEDTL 304
           I     E+   Y  KSVVLSD DV+ TCL +ADD N + EPACGASLH  Y+  +LE+ L
Sbjct: 244 IAPFAFESFNAYGCKSVVLSDQDVLATCLRYADDYNSIVEPACGASLHLCYHQEILENAL 303

Query: 305 GGSLGPEDIIIVIACGGSSTTVQDLQQMQVRLGRPL 340
              L  +DI+I+IACGGS  T +DL +   R+   L
Sbjct: 304 EQKLSDDDIVIIIACGGSCMTYEDLVETSRRISSVL 339

>KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 322

 Score =  288 bits (736), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 149/333 (44%), Positives = 198/333 (59%), Gaps = 11/333 (3%)

Query: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGN 60
           M     KTPLL    P   L+  P FL+KYE  QP GSFKSRGI HLI  +   I    N
Sbjct: 1   MDQLTIKTPLLPFREP---LNGGPTFLLKYENLQPGGSFKSRGISHLIKTTMDSISDPEN 57

Query: 61  KTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGD 120
           + A V+                   +PCTV+VP +T  RM+ KI   GA V++ G+HW +
Sbjct: 58  ELA-VYSSSGGNAGLAAARACATLKVPCTVIVPKSTKPRMIKKIESAGAKVVIFGDHWKE 116

Query: 121 ADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIV 180
           AD YL   VM    ++    +Y HPFDNP+IW+GHST++DEI+E L       + VKGIV
Sbjct: 117 ADTYLREYVMR--QSSYSNTLYVHPFDNPIIWDGHSTMIDEIIEQLAESHTDINDVKGIV 174

Query: 181 CSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSL 240
           CS               +H LA +IP+  +ET GC+V  +SL AG+P+V D+I+S+ATSL
Sbjct: 175 CSVGGGGLYNGVVNGLERHGLAGSIPVFAMETDGCDVLSKSLIAGEPVVLDRISSIATSL 234

Query: 241 GTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLL 300
           G+  IC  + + A+K+++KS+VL D +VV TCL F D+T+I+ EPACGASLH  Y P LL
Sbjct: 235 GSTEICADSFQKAIKFSSKSIVLDDKNVVDTCLRFFDETSILVEPACGASLHTCYRPELL 294

Query: 301 EDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQ 333
                G LGP+DI++VI CGGS  T  DL+   
Sbjct: 295 -----GPLGPDDIVVVILCGGSCNTYDDLKSFH 322

>TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  288 bits (736), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 148/333 (44%), Positives = 193/333 (57%), Gaps = 2/333 (0%)

Query: 3   SFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKT 62
           S+  K+PLL R F  S     PQF +KYE  QPSGSFKSRGIG+LI   A    S     
Sbjct: 2   SYSHKSPLLNRRFKESEKDG-PQFFLKYETLQPSGSFKSRGIGYLINSKAKEARSRDGSD 60

Query: 63  AHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDAD 122
            HVF                  +L CTVVVP TT   M+ +I+  G+ VIVHG HWG AD
Sbjct: 61  VHVFSSSGGNAGLAAANASKLLNLNCTVVVPVTTKRHMIDRIQNAGSQVIVHGTHWGMAD 120

Query: 123 QYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCS 182
            YL   VM  + +   EP+Y HPFD+P++WEGHS ++DEIVE L+ Q      VKGI+CS
Sbjct: 121 TYLKEVVMKKVPSN-VEPLYVHPFDDPLVWEGHSFMIDEIVEQLQEQGRSMRDVKGIICS 179

Query: 183 XXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGT 242
                          +H  A  IPII VET G +   +SL AGKP+   ++TS+A+SLG+
Sbjct: 180 VGGGGLYNGIVGGLERHGYAGKIPIIAVETVGADALAKSLAAGKPVRLTEVTSIASSLGS 239

Query: 243 ATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLLED 302
             I + + E A++Y T+S V +D + VRT L F  +TNI+ EPAC AS+   Y+   L  
Sbjct: 240 PYIAQDSFEKAIRYKTRSFVQTDEEAVRTSLRFFQETNILVEPACAASVSLCYHVDELNK 299

Query: 303 TLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVR 335
            L   L  +DI+IVI CGGS+TT+ DL+ +Q R
Sbjct: 300 LLSCKLSSKDIVIVIVCGGSATTISDLEMLQRR 332

>KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}
          Length = 231

 Score =  222 bits (565), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 107/230 (46%), Positives = 153/230 (66%), Gaps = 4/230 (1%)

Query: 110 DVIVHGNHWGDADQYLHRSVMPCIDTTK-FEPVYAHPFDNPVIWEGHSTIVDEIVESLER 168
           +V VH  +  +AD YL   V   ID  K  +P+Y +PFD+P+IWEGHSTI+DEI+ +L +
Sbjct: 4   EVFVHVANLKEADYYLQNVV---IDLYKDVQPIYVNPFDDPLIWEGHSTIIDEILNTLTQ 60

Query: 169 QRIPASQVKGIVCSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPL 228
           + I    VKGI+CS               K+DLA  IP++ VETKGC+V + SL A KP+
Sbjct: 61  ENIEVGSVKGIICSFSGGGLYNGIMQGLEKYDLAYNIPVVAVETKGCDVLNLSLAANKPV 120

Query: 229 VFDKITSVATSLGTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACG 288
             D ITS+A SLG++ + +K  +N +KY++KS+VL+D+D + TC  + DD   V EPACG
Sbjct: 121 QLDSITSIAKSLGSSVVSQKVFDNVIKYHSKSLVLNDSDALDTCFKYLDDFGTVLEPACG 180

Query: 289 ASLHFGYNPHLLEDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRLGR 338
           AS+H  Y+ ++LE+ L   L P+D+II+IACGGS  T QDL++ +V+LG 
Sbjct: 181 ASVHTAYHYNVLEEALDQKLRPDDVIIIIACGGSCATFQDLERAKVQLGN 230

>YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open
           reading frame, unlikely to produce a functional protein
           in S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL167W and adjacent
           ORF, YIL168W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 210

 Score =  197 bits (500), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 96/189 (50%), Positives = 123/189 (65%)

Query: 141 VYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCSXXXXXXXXXXXXXXXKHD 200
           +Y HPFDN  IWEGHSTIVDEI+E L+   I   +VK +VCS               ++ 
Sbjct: 12  LYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGGGLFSGIIKGLDRNQ 71

Query: 201 LATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGTATICKKTLENALKYNTKS 260
           LA  IP++ VET GC+V ++SLK G P+  +K+TSVATSL +  I     E+  KY  KS
Sbjct: 72  LAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIASFAFESFNKYGCKS 131

Query: 261 VVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLLEDTLGGSLGPEDIIIVIACG 320
           VVLSD DV+ TCL +ADD N + EPACGASLH  Y+P +LED L   +  +DI+I+IACG
Sbjct: 132 VVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQKIYEDDIVIIIACG 191

Query: 321 GSSTTVQDL 329
           GS  T +DL
Sbjct: 192 GSCMTYEDL 200

>YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading
           frame, unlikely to produce a functional protein in
           S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL168W and adjacent
           ORF, YIL167W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 127

 Score =  114 bits (285), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 56/123 (45%), Positives = 72/123 (58%), Gaps = 2/123 (1%)

Query: 3   SFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKT 62
           ++Y KTPL+R+   +        F VK+E+ QP GSFKSRGIGHLI +S     SEG+  
Sbjct: 4   TYYEKTPLIRQFLNNG--KTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSGK 61

Query: 63  AHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDAD 122
             VF                  +L C+VVVP TT  RMV KI+  GA VI+HG+HWG+AD
Sbjct: 62  LAVFSSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEAD 121

Query: 123 QYL 125
           +YL
Sbjct: 122 EYL 124

>SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 562

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 124/287 (43%), Gaps = 21/287 (7%)

Query: 6   SKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKTAHV 65
           S++P+   +  SS L+A  Q  +K E   P  SFK RG  ++I    A+++ E  KT  V
Sbjct: 63  SESPMTHGVGLSSRLNANVQ--LKREDLLPVFSFKLRGAYNMI----AKLD-ESQKTQGV 115

Query: 66  FXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDADQYL 125
                              ++P T+V+P +T       + + G+ V+++GN + +A    
Sbjct: 116 IACSAGNHAQGVAYASKHLNIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAK--- 172

Query: 126 HRSVMPCIDTTKFEPV-YAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCSXX 184
                 C   T+   +    PFD+P +  G  TI  EI+    RQ   AS++K + C+  
Sbjct: 173 ----AECTKLTEERGLTNIPPFDHPYVIAGQGTIAMEIL----RQVHNASKIKAVFCAVG 224

Query: 185 XXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGTAT 244
                        +  +A  I +IGVET      H SLKAGK +    + + A       
Sbjct: 225 GGGLITGVGAYLKR--IAPHIKVIGVETYDAATLHTSLKAGKRVPLPNVGTFADGTSVRM 282

Query: 245 ICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASL 291
           I ++T   A     + V+++  ++     D  +DT  + EP+   S+
Sbjct: 283 IGEETFRVAKDVVDEVVLVNTDEICAAVKDIFEDTRSIVEPSGALSV 329

>ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER086W
           (ILV1)
          Length = 560

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 59/260 (22%), Positives = 100/260 (38%), Gaps = 19/260 (7%)

Query: 28  VKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKTAHVFXXXXXXXXXXXXXXXXXFSLP 87
           +K E   P  SFK RG  ++I+        E  K+A V                    + 
Sbjct: 82  LKREDLLPVFSFKLRGAYNMISNL-----DEYQKSAGVIACSAGNHAQGVAFSARELGIR 136

Query: 88  CTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDADQYLHRSVMPCIDTTKFEPVY-AHPF 146
             +V+PT+T       +   GA+V+++G  + +A          C    +   +    PF
Sbjct: 137 AMIVMPTSTPSIKYNSVAAMGAEVVLYGKDFDEAKA-------ECARLAQLHKLTDIPPF 189

Query: 147 DNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCSXXXXXXXXXXXXXXXKHDLATTIP 206
           D+P +  G  TI  EI+    RQ   ASQ+  + C                +  +A  I 
Sbjct: 190 DHPYVIAGQGTIATEIL----RQVHNASQIGAVFCGVGGGGLIAGIGSYLKR--IAPHIK 243

Query: 207 IIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGTATICKKTLENALKYNTKSVVLSDA 266
           IIGVET      H +LK G+  +   +   A       + ++T   A     + V+++  
Sbjct: 244 IIGVETHDAPTLHTALKQGRRTMLPAVGCFADGTSVRMMGEETFRVARDVVDEVVLVNTD 303

Query: 267 DVVRTCLDFADDTNIVPEPA 286
           ++     D  +DT  + EP+
Sbjct: 304 ELCAAIKDIFEDTRAIVEPS 323

>Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar to
           Ashbya gossypii ACR232C
          Length = 570

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 59/282 (20%), Positives = 117/282 (41%), Gaps = 21/282 (7%)

Query: 6   SKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKTAHV 65
           +++P+ R  F SS L+   Q  +K E   P  SFK RG  ++I+        +  K   V
Sbjct: 71  NESPISRSEFLSSRLNTDVQ--LKREDLLPVFSFKLRGAYNMISHL-----DDVQKKCGV 123

Query: 66  FXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDADQYL 125
                               +P T+V+P +T       + + GA+V+++G+++  A    
Sbjct: 124 IACSAGNHAQGVAYSAKHLGIPATIVMPVSTPSIKYQNVSRLGAEVVLYGDNFDAAK--- 180

Query: 126 HRSVMPCIDTTKFEPVY-AHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCSXX 184
               + C   ++ + +Y   PFD+P +  G  TI  EI++ ++     +S++  + C+  
Sbjct: 181 ----VECSRLSEEKGLYDIPPFDHPYVIAGQGTIAMEILKQIQN----SSKIGAVFCAVG 232

Query: 185 XXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGTAT 244
                        +   A  I +IGVET      H S++        ++   A       
Sbjct: 233 GGGLIAGVGAYIKR--AAPHIKVIGVETYDAATLHTSMQNNARTTLSQVGGFADGTSVRL 290

Query: 245 ICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPA 286
           I +++   A +   + ++++  ++     D  +DT  V EP+
Sbjct: 291 IGEESFRVAREVVDEVILVNTDEICAAIKDIFEDTRAVVEPS 332

>KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086W ILV1 Threonine deaminase catalyzes
           the first step in isoleucine biosynthesis expression is
           under general amino acid control ILV1 locus exhibits
           highly positioned nucleosomes whose organization is
           independent of known ILV1 regulation
          Length = 567

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 73/289 (25%), Positives = 120/289 (41%), Gaps = 37/289 (12%)

Query: 7   KTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKTAHVF 66
           +TP+ R +  SS L+   +  +K E   P  SFK RG  ++I    A+++ E  K A V 
Sbjct: 69  ETPISRAVSLSSRLNTNVK--LKREDLLPVFSFKLRGAYNMI----AKLD-ETQKNAGVI 121

Query: 67  XXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDADQYLH 126
                             ++P T+V+P +T       + + GA V+++G+ + +A     
Sbjct: 122 ACSAGNHAQGVAFSSNHMNIPATIVMPVSTPSIKYQNVSRLGAQVVLYGDDFDEAK---- 177

Query: 127 RSVMPCIDTTKFEPVY-AHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCSXXX 185
              + C    +   +    PFD+P +  G  TI  EI+    RQ    S +  + C+   
Sbjct: 178 ---LECARLAEERGMTDIPPFDHPYVIAGQGTIAMEIL----RQVQNGSNIGAVFCAVGG 230

Query: 186 XXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGK--PL----VFDKITSVATS 239
                       +  +A  I +IGVET        SLK GK  PL     F   TSV   
Sbjct: 231 GGLISGIGSYLKR--IAPHIKVIGVETYDAATLDVSLKNGKRTPLPSVGTFADGTSVRL- 287

Query: 240 LGTAT--ICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPA 286
           +G  T  +C+  ++  +  NT  +  +  DV        +DT  + EP+
Sbjct: 288 IGEETFRVCQDVVDEVILVNTDEICAAVKDVF-------EDTRSIVEPS 329

>KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7.367
           YER086W
          Length = 579

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 61/276 (22%), Positives = 111/276 (40%), Gaps = 21/276 (7%)

Query: 17  SSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKTAHVFXXXXXXXXXX 76
           SS L+   Q  +K E   P  SFK RG  ++I +    + ++G     V           
Sbjct: 91  SSKLNTNVQ--LKREDLLPVFSFKLRGAYNMIAKLDDNVRNQG-----VIACSAGNHAQG 143

Query: 77  XXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDADQYLHRSVMPCIDTT 136
                    +P T+V+P +T       + + G+ V+++GN + +A          C   +
Sbjct: 144 VAYAAKKLGIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAK-------AECAKLS 196

Query: 137 KFEPV-YAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCSXXXXXXXXXXXXX 195
           +   +    PFD+P +  G  T+  EI+    RQ   A+++  +                
Sbjct: 197 EERGLTNIPPFDHPYVIAGQGTVAMEIL----RQVHNANKINAVFVPVGGGGLIAGVGAY 252

Query: 196 XXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGTATICKKTLENALK 255
             +  +A  I +IGVET      H SL+ GK     K+ + A       I ++T   A +
Sbjct: 253 LKR--IAPHIKVIGVETYDATTLHTSLQNGKRTELTKVGTFADGTSVRLIGEETFRVAQE 310

Query: 256 YNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASL 291
              + V+++  ++     D  +DT  + EP+   S+
Sbjct: 311 VVDEIVLVNTDELCAAIKDVFEDTRSILEPSGALSV 346

>TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {ON}
           Anc_7.367 YER086W
          Length = 569

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/282 (22%), Positives = 114/282 (40%), Gaps = 21/282 (7%)

Query: 6   SKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKTAHV 65
           S++P+   +  SS L+   Q  +K E   P  SFK RG  ++I    A+++ +  K   V
Sbjct: 70  SESPISHGVGLSSRLNTNVQ--LKREDLLPVFSFKLRGAYNMI----AKLD-DSQKNQGV 122

Query: 66  FXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDADQYL 125
                              S+P T+V+P +T       + + G+ V+++GN + +A    
Sbjct: 123 IACSAGNHAQGVAFAAKHMSIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAK--- 179

Query: 126 HRSVMPCIDTTKFEPV-YAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCSXX 184
                 C   ++   +    PFD+P +  G  T+  EI+    RQ   ++++  +     
Sbjct: 180 ----AECTRLSEERGLTNIPPFDHPYVIAGQGTVAMEIL----RQVRNSAKIGAVFVPCG 231

Query: 185 XXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGTAT 244
                        +  +A  I IIGVET      H SLK GK      + + A       
Sbjct: 232 GGGLVAGIGAYLKR--IAPHIKIIGVETFDSATLHTSLKNGKRTPLASVGTFADGTSVRM 289

Query: 245 ICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPA 286
           I ++T   A     + V++   ++     D  +DT  + EP+
Sbjct: 290 IGEETFRIAQDVVDEVVLVGTDEICAAIKDIFEDTRGIVEPS 331

>ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 569

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/286 (21%), Positives = 115/286 (40%), Gaps = 21/286 (7%)

Query: 7   KTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKTAHVF 66
           +TP+   +  SS L+   Q  +K E   P  SFK RG  ++I    A+++ E  K   V 
Sbjct: 71  ETPVNTAVGLSSRLNTNVQ--LKREDLLPVFSFKLRGAYNMI----AKLD-ENQKNQGVI 123

Query: 67  XXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDADQYLH 126
                             ++P T+V+P +T       + + G+ V+++GN + +A     
Sbjct: 124 ACSAGNHAQGVAYAARHMNIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAK---- 179

Query: 127 RSVMPCIDTTKFEPV-YAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCSXXX 185
                C    +   +    PFD+P +  G  T+  EI+    RQ   + ++  +      
Sbjct: 180 ---AECAKLAEERGLTNIPPFDHPYVIAGQGTVAMEIL----RQVHNSLKIGAVFVPVGG 232

Query: 186 XXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGTATI 245
                       +  +A  I I+GVET        S+K GK  +   + S A       I
Sbjct: 233 GGLIAGIGAYLKR--IAPHIKIVGVETHDAPTLSASMKTGKRELLKTVGSFADGTSVRII 290

Query: 246 CKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASL 291
            ++T   + +   + V+++  ++     D  +DT  + EP+   S+
Sbjct: 291 GEETFRVSQEVVDEIVLVNTDEICAAVKDIFEDTRSIIEPSGALSV 336

>Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}
           complement(41170..42870) [1701 nt, 567 aa]
          Length = 566

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 61/285 (21%), Positives = 116/285 (40%), Gaps = 19/285 (6%)

Query: 7   KTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKTAHVF 66
           ++P+   +  SS L+   Q  +K E   P  SFK RG  +++    A+++ +  K   V 
Sbjct: 68  ESPISYGVGLSSKLNTNVQ--LKREDLLPVFSFKLRGAYNMM----AKLD-DSQKNQGVI 120

Query: 67  XXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDADQYLH 126
                             ++P T+V+P +T       + + G+ V+++GN + +A     
Sbjct: 121 ACSAGNHAQGIAYAAKHLNIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECA 180

Query: 127 RSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCSXXXX 186
           R       T         PFD+P +  G  T+  EI+    RQ   A+++  +       
Sbjct: 181 RLAEERGLTN------IPPFDHPYVIAGQGTVAMEIL----RQVHKANKIGAVFVPVGGG 230

Query: 187 XXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGTATIC 246
                      +  +A  I IIGVET      + SL++GK +    + + A       I 
Sbjct: 231 GLIAGVGAYLKR--IAPHIKIIGVETFDANCLYTSLQSGKRVPLSSVGTFADGTAVRLIG 288

Query: 247 KKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASL 291
           ++T     +   + V+++  ++     D  +DT  + EP+   S+
Sbjct: 289 EETFRVCQEVVDEVVLVNTDEICAAVKDVFEDTRSIVEPSGALSV 333

>Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {ON}
           YER086W (ILV1) - threonine deaminase [contig 101] FULL
          Length = 562

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 62/281 (22%), Positives = 112/281 (39%), Gaps = 21/281 (7%)

Query: 7   KTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKTAHVF 66
           ++P+ R +  SS L+   Q  +K E   P  SFK RG  +++ + A   E +GNK   V 
Sbjct: 64  ESPITRGVGLSSRLNTNVQ--LKREDLLPVFSFKLRGAYNMMAKLA---EGQGNKG--VI 116

Query: 67  XXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDADQYLH 126
                             ++P  +V+P  T       + + G  V+++GN + +A     
Sbjct: 117 ACSAGNHAQGVAFASRHLNIPAIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEAK---- 172

Query: 127 RSVMPCIDTTKFEPV-YAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCSXXX 185
              + C   ++   +    PFD+P +  G  T+  EI+    RQ   AS++  +      
Sbjct: 173 ---IECARISEERGLTNIPPFDHPYVIAGQGTVAMEIL----RQVHNASKIGAVFVPVGG 225

Query: 186 XXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGTATI 245
                       +  +A  I I+GVET        SL AG       + + A       I
Sbjct: 226 GGLVAGVAAYLKR--IAPHIKIVGVETYDSATLKTSLDAGCRTPLTSVGTFADGTSVRMI 283

Query: 246 CKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPA 286
            ++T      +  + V+++  ++     D  +DT  + EP+
Sbjct: 284 GEETFRICEDFVDEVVLVNTDEICAAVKDIFEDTRSIVEPS 324

>TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {ON}
           Anc_7.367 YER086W
          Length = 568

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 58/270 (21%), Positives = 108/270 (40%), Gaps = 19/270 (7%)

Query: 17  SSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKTAHVFXXXXXXXXXX 76
           SS L+   Q  +K +   P  SFK RG  +++ +     +++G     V           
Sbjct: 80  SSKLNTNVQ--LKRDDLLPVFSFKLRGAYNMMAKLDDTQKNQG-----VIACSAGNHAQG 132

Query: 77  XXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDADQYLHRSVMPCIDTT 136
                    +P T+V+P +T       + + G+ V+++GN + +A     R       T 
Sbjct: 133 VAYAAKHLKIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECARLAEERGLTN 192

Query: 137 KFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCSXXXXXXXXXXXXXX 196
                   PFD+P +  G  T+  EI+    RQ   +S++  +                 
Sbjct: 193 ------IPPFDHPYVIAGQGTVAMEIL----RQVHMSSKIGAVFVPVGGGGLIAGVGTYL 242

Query: 197 XKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGTATICKKTLENALKY 256
            +  +A  I IIGVET      + SL++GK    + + S A       + ++T   A + 
Sbjct: 243 KR--IAPHIKIIGVETYDACALYTSLQSGKRAALESVGSFADGTAVRLLGEETFRVAQEV 300

Query: 257 NTKSVVLSDADVVRTCLDFADDTNIVPEPA 286
             + V+++  ++     D  +DT  + EP+
Sbjct: 301 VDEVVLVNTDEICAGIKDIFEDTRSIVEPS 330

>NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON}
           Anc_7.367
          Length = 569

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 60/281 (21%), Positives = 110/281 (39%), Gaps = 21/281 (7%)

Query: 7   KTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKTAHVF 66
           ++P+   +  SS L+   Q  +K E   P  SFK RG  ++I +      ++G     V 
Sbjct: 71  ESPVTAGVGLSSRLNTNVQ--LKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG-----VI 123

Query: 67  XXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDADQYLH 126
                              +P T+V+P +T       + + G+ V+++GN + +A     
Sbjct: 124 ACSAGNHAQGVAYAAKHLGIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAK---- 179

Query: 127 RSVMPCIDTTKFEPV-YAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCSXXX 185
                C    +   +    PFD+P +  G  T+  EI+    RQ   A+++  +      
Sbjct: 180 ---AECTKLAEERGLTNIPPFDHPYVIAGQGTVAMEIL----RQVHNANKIGAVFVPVGG 232

Query: 186 XXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGTATI 245
                       +  +A  I +IGVET      H SLK  K      + + A       I
Sbjct: 233 GGFIAGVGAYLKR--IAPHIKVIGVETFDAATLHTSLKHNKRTPLPTVGTFADGTSVRVI 290

Query: 246 CKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPA 286
            ++T   A +   + V+++  ++     D  +DT  + EP+
Sbjct: 291 GEETFRVAQQVVDEVVLVNTDEICAAVKDIFEDTRSIVEPS 331

>YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threonine
           deaminase, catalyzes the first step in isoleucine
           biosynthesis; expression is under general amino acid
           control; ILV1 locus exhibits highly positioned
           nucleosomes whose organization is independent of known
           ILV1 regulation
          Length = 576

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/287 (20%), Positives = 113/287 (39%), Gaps = 21/287 (7%)

Query: 6   SKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKTAHV 65
           +++P+ + +  SS L+     ++K E   P  SFK RG  ++I +      ++G     V
Sbjct: 77  NESPISQGVGLSSRLNTN--VILKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG-----V 129

Query: 66  FXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDADQYL 125
                               +P T+V+P  T       + + G+ V+++GN + +A    
Sbjct: 130 IACSAGNHAQGVAFAAKHLKIPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAK--- 186

Query: 126 HRSVMPCIDTTKFEPV-YAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCSXX 184
                 C    +   +    PFD+P +  G  T+  EI+    RQ   A+++  +     
Sbjct: 187 ----AECAKLAEERGLTNIPPFDHPYVIAGQGTVAMEIL----RQVRTANKIGAVFVPVG 238

Query: 185 XXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGTAT 244
                        +  +A  I IIGVET      H SL+  +      + + A       
Sbjct: 239 GGGLIAGIGAYLKR--VAPHIKIIGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRM 296

Query: 245 ICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASL 291
           I ++T   A +   + V+++  ++     D  +DT  + EP+   S+
Sbjct: 297 IGEETFRVAQQVVDEVVLVNTDEICAAVKDIFEDTRSIVEPSGALSV 343

>TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON}
           Anc_7.367 YER086W
          Length = 575

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/286 (20%), Positives = 116/286 (40%), Gaps = 19/286 (6%)

Query: 6   SKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKTAHV 65
           +++P+ + I  SS L++  Q  +K E   P  SFK RG  +++    A+++ E  +   V
Sbjct: 71  NESPMTKGIGLSSKLNS--QIQLKREDLLPVFSFKMRGAYNMV----AKLD-ETQRKQGV 123

Query: 66  FXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDADQYL 125
                               +P T+V+P +T       + + G+ V+++GN +  +    
Sbjct: 124 IACSAGNHAQGVAYAAKHLGIPATIVMPVSTPSIKYENVSRLGSQVVLYGNDFDSSKGEC 183

Query: 126 HRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCSXXX 185
            R    C +      V   PFD+P +  G  T+  EI+    RQ   ++++  +      
Sbjct: 184 ERL---CEERG---LVNIPPFDHPYVIAGQGTVAMEIL----RQVKNSAKIGAVFVPVGG 233

Query: 186 XXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGTATI 245
                       +  +A  I I+GVET        SL  GK    + + + A       I
Sbjct: 234 GGLVAGIGAYLKR--IAPHIKIVGVETYDAATLKTSLDNGKRTELNTVGTFADGTAVKMI 291

Query: 246 CKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASL 291
            ++T   +     + V+++  ++     D  +DT  + EP+   S+
Sbjct: 292 GEETFRVSKDVVDEIVLVNTDELCAAVKDIFEDTRSIVEPSGALSV 337

>Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/266 (20%), Positives = 102/266 (38%), Gaps = 19/266 (7%)

Query: 27  LVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKTAHVFXXXXXXXXXXXXXXXXXFSL 86
           ++K E   P  SFK RG  ++I +      ++G     V                    +
Sbjct: 96  ILKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG-----VIACSAGNHAQGVAFAAKHLKI 150

Query: 87  PCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDADQYLHRSVMPCIDTTKFEPV-YAHP 145
           P T+V+P  T       + + G+ V+++GN + +A          C    +   +    P
Sbjct: 151 PATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAK-------AECAKLAEERGLTNIPP 203

Query: 146 FDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCSXXXXXXXXXXXXXXXKHDLATTI 205
           FD+P +  G  T+  EI+    RQ   A+++  +                  +  +A  I
Sbjct: 204 FDHPYVIAGQGTVAMEIL----RQVRTANKIGAVFVPVGGGGLIAGIGAYLKR--VAPHI 257

Query: 206 PIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGTATICKKTLENALKYNTKSVVLSD 265
            +IGVET      H SL+  +      + + A       I ++T   A +   + V+++ 
Sbjct: 258 KVIGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQVVDEVVLVNT 317

Query: 266 ADVVRTCLDFADDTNIVPEPACGASL 291
            ++     D  +DT  + EP+   S+
Sbjct: 318 DEICAAVKDIFEDTRSIVEPSGALSV 343

>Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/266 (20%), Positives = 102/266 (38%), Gaps = 19/266 (7%)

Query: 27  LVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKTAHVFXXXXXXXXXXXXXXXXXFSL 86
           ++K E   P  SFK RG  ++I +      ++G     V                    +
Sbjct: 96  ILKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG-----VIACSAGNHAQGVAFAAKHLKI 150

Query: 87  PCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDADQYLHRSVMPCIDTTKFEPV-YAHP 145
           P T+V+P  T       + + G+ V+++GN + +A          C    +   +    P
Sbjct: 151 PATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAK-------AECAKLAEERGLTNIPP 203

Query: 146 FDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCSXXXXXXXXXXXXXXXKHDLATTI 205
           FD+P +  G  T+  EI+    RQ   A+++  +                  +  +A  I
Sbjct: 204 FDHPYVIAGQGTVAMEIL----RQVRTANKIGAVFVPVGGGGLIAGIGAYLKR--VAPHI 257

Query: 206 PIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGTATICKKTLENALKYNTKSVVLSD 265
            +IGVET      H SL+  +      + S A       I ++T   A +   + V+++ 
Sbjct: 258 KVIGVETFDAPTLHNSLQRNQRTPLPVVGSFADGTSVRMIGEETFRVAQQVVDEVVLVNT 317

Query: 266 ADVVRTCLDFADDTNIVPEPACGASL 291
            ++     D  +DT  + EP+   S+
Sbjct: 318 DEICAAVKDVFEDTRSIVEPSGALSV 343

>CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086w ILV1 anabolic serine and threonine
           dehydratase precursor
          Length = 571

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/281 (20%), Positives = 109/281 (38%), Gaps = 21/281 (7%)

Query: 7   KTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKTAHVF 66
           ++P+   +  SS L+   Q  +K E   P  SFK RG  ++I +      ++G     V 
Sbjct: 73  ESPISHGVGLSSRLNTNVQ--LKREDLLPVFSFKLRGAYNMIAKLDDTQRNQG-----VI 125

Query: 67  XXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDADQYLH 126
                              +P T+V+P +T       + + G+ V+++GN + +A     
Sbjct: 126 ACSAGNHAQGVAYAARHLDIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAK---- 181

Query: 127 RSVMPCIDTTKFEPV-YAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCSXXX 185
                C    +   +    PFD+P +  G  T+  EI+    RQ   ++++  +      
Sbjct: 182 ---AECTKLAEERGLTNIPPFDHPYVIAGQGTVAMEIL----RQVYNSNKIGAVFVPVGG 234

Query: 186 XXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGTATI 245
                       +  +   I IIGVET      H SL+  K      + + A       I
Sbjct: 235 GGLIAGVGAYLKR--VTPHIKIIGVETHDAATLHTSLQRNKRTNLASVGTFADGTSVRII 292

Query: 246 CKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPA 286
            ++T   A +   + V+++  ++     D  +DT  + EP+
Sbjct: 293 GEETFRVAREVVDEIVLVNTDEICAAVKDVFEDTRSIVEPS 333

>SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {ON}
           similar to uniprot|P36007 Saccharomyces cerevisiae
           YKL218C SRY1 3-hydroxyaspartate dehydratase deaminates
           L- threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia required for survival in the presence of
           hydroxyaspartate
          Length = 320

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 68/287 (23%), Positives = 115/287 (40%), Gaps = 36/287 (12%)

Query: 6   SKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKTAHV 65
           +KTP+L     ++ L A   F  K E FQ  G+FK RG  + + +      ++  + A V
Sbjct: 21  NKTPVLTSRTVNAELGAEVYF--KCENFQRIGAFKFRGAMNTLLKL-----TQEQRAAGV 73

Query: 66  FXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQT---GADVIVHGNHWGDAD 122
                               +P T+V+P   N    AK+R T   GA+++ +  +  D +
Sbjct: 74  VAFSSGNHAQAIALSAKLLGVPATIVMP---NDAPAAKVRATAGYGANIVRYDRYTEDRE 130

Query: 123 QYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVE---SLERQRIPASQVKGI 179
           Q + R++      T        P+D+P +  G  T   E++E    L+   +P       
Sbjct: 131 Q-IGRALAEEKGLT-----LVPPYDHPDVIAGQGTAAKELIEEVGELDLLFVPLGGGG-- 182

Query: 180 VCSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATS 239
                                L+    IIGVE +      QSL++G  +  D   ++A  
Sbjct: 183 ----------LLSGSALAAKRLSPRCEIIGVEPEAGNDGQQSLRSGSIVHIDTPETIADG 232

Query: 240 LGTATICKKTLENALKYNTKSVV-LSDADVVRTCLDFADDTNIVPEP 285
             T  + + T E  +  N   ++  SDA++V +   FA+   IV EP
Sbjct: 233 AQTQHLGQYTFE-VIHANVADILTASDAELVDSMRFFAERMKIVVEP 278

>KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 573

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 68/289 (23%), Positives = 115/289 (39%), Gaps = 37/289 (12%)

Query: 7   KTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKTAHVF 66
           ++P+ R +  SS L+   Q  +K E   P  SFK RG  +++ +      SE  K   V 
Sbjct: 75  ESPITRGVGLSSRLNTNVQ--LKREDLLPVFSFKLRGAYNMMAKL-----SEAQKNQGVI 127

Query: 67  XXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDADQYLH 126
                             ++P  +V+P  T       + + G  V+++GN + +A     
Sbjct: 128 ACSAGNHAQGVAFASRHLNIPAIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEAK---- 183

Query: 127 RSVMPCIDTTKFEPV-YAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCSXXX 185
                C   ++   +    PFD+P +  G  T+  EI+    RQ   A+++  +      
Sbjct: 184 ---TECTRISEERGLTNIPPFDHPYVIAGQGTVAMEIL----RQVHNAAKIGAVFVPVGG 236

Query: 186 XXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAG--KPL----VFDKITSVATS 239
                       +  +A  I IIGVET        SL+AG   PL     F   TSV   
Sbjct: 237 GGLVAGVAAYLKR--IAPHIKIIGVETYDSATLKTSLEAGTRTPLSTVGTFADGTSVRM- 293

Query: 240 LGTAT--ICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPA 286
           +G  T  IC+  +++ +  NT  +  +  D+        +DT  + EP+
Sbjct: 294 IGEETFRICQDLVDDVILVNTDEICAAVKDIF-------EDTRSIVEPS 335

>NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {ON}
           Anc_7.367
          Length = 570

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 61/286 (21%), Positives = 112/286 (39%), Gaps = 21/286 (7%)

Query: 7   KTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKTAHVF 66
           ++P+   +  SS L+   Q  +K E   P  SFK RG  ++I +      ++G     V 
Sbjct: 72  ESPVTAGVGLSSRLNTNVQ--LKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG-----VI 124

Query: 67  XXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDADQYLH 126
                             ++P T+V+P +T       + + G+ V+++GN + +A     
Sbjct: 125 ACSAGNHAQGVAFAAKHLNIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAK---- 180

Query: 127 RSVMPCIDTTKFEPV-YAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCSXXX 185
                C    +   +    PFD+P +  G  T+  EI+    RQ   A+++  +      
Sbjct: 181 ---AECTKLAEERGLTNIPPFDHPYVIAGQGTVAMEIL----RQVHNANKIGAVFVPVGG 233

Query: 186 XXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGTATI 245
                       +  +A  I IIGVET        SLK G+      +   A       I
Sbjct: 234 GGLVAGVGAYLKR--IAPHIKIIGVETHDAATLQTSLKHGRRTPLSVVGPFADGTSVRLI 291

Query: 246 CKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASL 291
            ++T   A +   + V+++  ++     D  +DT  + EP+   S+
Sbjct: 292 GEETFRVAQEVVDEVVLVNTDEICAAVKDVFEDTRSIVEPSGALSV 337

>KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {ON}
           Anc_7.367 YER086W
          Length = 577

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 59/281 (20%), Positives = 113/281 (40%), Gaps = 21/281 (7%)

Query: 7   KTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKTAHVF 66
           ++P+   +  SS L+   Q  +K E   P  SFK RG  +++    A+++ +  K   V 
Sbjct: 79  ESPMSHGVGLSSRLNTNVQ--LKREDLLPVFSFKLRGAYNMM----AKLD-DTQKNQGVI 131

Query: 67  XXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDADQYLH 126
                              +P T+V+P +T       + + G+ V+++GN + +A     
Sbjct: 132 ACSAGNHAQGVAFAAKHLDIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAK---- 187

Query: 127 RSVMPCIDTTKFEPV-YAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCSXXX 185
                C   +K   +    PFD+P +  G  T+  EI+    RQ   A+++  +      
Sbjct: 188 ---AECTKLSKERGLTNIPPFDHPYVIAGQGTVAMEIL----RQVHIANKIGAVFVPVGG 240

Query: 186 XXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGTATI 245
                       +  +A  I IIGVET      + SL+ G+      + + A       I
Sbjct: 241 GGLVAGVGAYLKR--IAPHIKIIGVETFDASTLYTSLQRGRRTSLPSVGTFADGTSVKLI 298

Query: 246 CKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPA 286
            ++T   +     + V+++  ++     D  +DT  + EP+
Sbjct: 299 GEETFRISQDVVDEVVLVNTDEICAAVKDIFEDTRSIVEPS 339

>Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/266 (19%), Positives = 100/266 (37%), Gaps = 19/266 (7%)

Query: 27  LVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKTAHVFXXXXXXXXXXXXXXXXXFSL 86
           ++K E   P  SFK RG  ++I +      ++G     V                    +
Sbjct: 96  ILKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG-----VIACSAGNHAQGVAFAAKHLKI 150

Query: 87  PCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDADQYLHRSVMPCIDTTKFEPV-YAHP 145
           P T+V+P  T       + + G+ V++ GN + +A          C    +   +    P
Sbjct: 151 PATIVMPVCTPSIKYQNVSRLGSQVVLFGNDFDEAK-------AECTKLAEERGLTNIPP 203

Query: 146 FDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIVCSXXXXXXXXXXXXXXXKHDLATTI 205
           FD+P +  G  T+  EI+    RQ    +++  +                  +  +A  I
Sbjct: 204 FDHPYVIAGQGTVAMEIL----RQVRTVNKIGAVFVPVGGGGLIAGIGAYLKR--IAPHI 257

Query: 206 PIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGTATICKKTLENALKYNTKSVVLSD 265
            +IGVET      H SL+  +      + + A       I ++T   A +   + V+++ 
Sbjct: 258 KVIGVETYDAATLHNSLQRNQRTPLPAVGTFADGTSVRMIGEETFRVAQQVVDEVVLVNT 317

Query: 266 ADVVRTCLDFADDTNIVPEPACGASL 291
            ++     D  +DT  + EP+   S+
Sbjct: 318 DEICAAVKDVFEDTRSIVEPSGALSV 343

>YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}
           SRY13-hydroxyaspartate dehydratase, deaminates
           L-threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia; required in the presence of hydroxyaspartate;
           highly similar to mouse serine racemase (Srr) but has no
           serine racemase activity
          Length = 326

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 73/329 (22%), Positives = 131/329 (39%), Gaps = 44/329 (13%)

Query: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGN 60
           +  + +KTP+L     +  L A  Q   K E FQ  G+FK RG  + +++ +    S+G 
Sbjct: 16  IKEYVNKTPVLTSRMLNDRLGA--QIYFKGENFQRVGAFKFRGAMNAVSKLSDEKRSKG- 72

Query: 61  KTAHVFXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGD 120
               V                   ++P T+V+P       VA     GA +I +  +  D
Sbjct: 73  ----VIAFSSGNHAQAIALSAKLLNVPATIVMPEDAPALKVAATAGYGAHIIRYNRYTED 128

Query: 121 ADQYLHRSVMPCIDTTKFEPVYAH--PFDNPVIWEGHSTIVDEIVESLERQRIPASQVKG 178
            +Q + R +         E  +A   P+D+P +  G  T   E++E +        Q+  
Sbjct: 129 REQ-IGRQLAA-------EHGFALIPPYDHPDVIAGQGTSAKELLEEV-------GQLDA 173

Query: 179 IVCSXXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVAT 238
           +                     L+    I GVE +      QS ++G  +  +   ++A 
Sbjct: 174 LFVPLGGGGLLSGSALA--ARSLSPGCKIFGVEPEAGNDGQQSFRSGSIVHINTPKTIAD 231

Query: 239 SLGTATICKKTLENALKYNTKSVV-LSDADVVRTCLDF-ADDTNIVPEP-ACGASLHFGY 295
              T  + + T    ++ N   ++ +SD ++V+ C+ F A+   +V EP AC      G+
Sbjct: 232 GAQTQHLGEYTFA-IIRENVDDILTVSDQELVK-CMHFLAERMKVVVEPTAC-----LGF 284

Query: 296 NPHLL--EDTLGGSLGPEDIIIVIACGGS 322
              LL  E+ +G  +G      +I  GG+
Sbjct: 285 AGALLKKEELVGKKVG------IILSGGN 307

>Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON}
           YKL218C (REAL)
          Length = 326

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 63/288 (21%), Positives = 114/288 (39%), Gaps = 33/288 (11%)

Query: 6   SKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGNKTAHV 65
           +KTP+L     +  L A   F  K E +Q  G+FK RG  + +++ + +   +G     V
Sbjct: 21  NKTPVLTSRTLNDRLEAEVYF--KGENYQRVGAFKFRGAMNAVSKLSDKERKKG-----V 73

Query: 66  FXXXXXXXXXXXXXXXXXFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDADQYL 125
                             F++P T+++P       VA     GA +I + N + +  +++
Sbjct: 74  IAFSSGNHAQAIALSAKLFNVPATIIMPEDAPALKVAATAGYGAHIIKY-NRYTEDREHI 132

Query: 126 HRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVE---SLERQRIPASQVKGIVCS 182
            R +       K   V   P+D+P +  G  T   E+ E    L+   +P          
Sbjct: 133 GRQL-----AAKHGYVLIPPYDHPDVIAGQGTSAKELFEEVGELDALFVPLGGGG----- 182

Query: 183 XXXXXXXXXXXXXXXKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSLGT 242
                             L+    + GVE +      QS K+G  +  D  +++A    T
Sbjct: 183 -------LLSGSALAARSLSPGCKVFGVEPEAGNDGQQSFKSGSIVHIDTPSTIADGAQT 235

Query: 243 ATICKKTLENALKYNTKSVV-LSDADVVRTCLDF-ADDTNIVPEP-AC 287
             + + T    ++ N   ++ +SD ++V  C+ F A+   +V EP AC
Sbjct: 236 QHLGEYTYA-VIRENVDDILTVSDEELVE-CMHFLAERMKLVVEPTAC 281

>NCAS0C05620 Chr3 (1144950..1146458) [1509 bp, 502 aa] {ON}
          Anc_4.69
          Length = 502

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 8  TPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIE 56
          TPL+        L   PQ   K E++ P GS K R    +I ++ AR E
Sbjct: 16 TPLIALKKLPKALGIKPQVFAKLELYNPGGSIKDRIAKSMIEEAEARGE 64

>Suva_6.33 Chr6 complement(57692..60781) [3090 bp, 1029 aa] {ON}
           YFL025C (REAL)
          Length = 1029

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 3/63 (4%)

Query: 114 HGNHWGDADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHST--IVDEIVESLERQRI 171
           HG    D  +YL+ +V   +   +  P Y+HP    VI  GHS   IV  ++ +L +  I
Sbjct: 195 HGKTMLDQAEYLNDAVRYILSLYETTPNYSHPIPESVIMVGHSMGGIVSRVMLTL-KNHI 253

Query: 172 PAS 174
           P S
Sbjct: 254 PGS 256

>AGR137W Chr7 (1006520..1008031) [1512 bp, 503 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR076W (RAD55)
          Length = 503

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%)

Query: 300 LEDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRLGRPLTPSFTYETTPVDRKL 355
           L+D LG  L P  I  V    G   T+  LQ ++   G+ +    T++ TP+DR L
Sbjct: 25  LDDALGAGLDPRSIYEVFGPPGIGKTLFGLQVIRCNRGKRVLVVDTHKRTPLDRLL 80

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,048,825
Number of extensions: 1314672
Number of successful extensions: 2998
Number of sequences better than 10.0: 59
Number of HSP's gapped: 2954
Number of HSP's successfully gapped: 60
Length of query: 364
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 253
Effective length of database: 40,753,473
Effective search space: 10310628669
Effective search space used: 10310628669
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)