Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0B06116g3.454ON43143122370.0
Ecym_24653.454ON43842113570.0
KLTH0E13948g3.454ON43839613230.0
Kwal_27.123173.454ON43542412881e-176
TDEL0F033903.454ON42441412751e-174
ABL019W3.454ON43138912731e-174
YGR110W (CLD1)3.454ON44541412461e-169
Kpol_1035.93.454ON42741612391e-169
ZYRO0C06270g3.454ON43041512211e-166
Smik_6.2003.454ON44541412191e-165
Skud_7.4153.454ON45241912111e-164
KNAG0B009503.454ON41842012081e-164
NCAS0E008603.454ON44042612081e-164
KAFR0I019703.454ON41138611951e-162
Suva_7.3953.454ON45141111971e-162
NDAI0G010903.454ON45639711801e-159
TPHA0O013103.454ON43838111691e-158
KLLA0B12914g3.454ON42641611011e-148
CAGL0L04686g3.454ON45144110501e-140
TBLA0F034603.454ON4414009551e-125
SAKL0G19074gna 1ON4324184851e-55
Ecym_5577singletonON4334034371e-48
KLTH0C01254gna 1ON4344094187e-46
Kwal_14.985na 1ON4351912872e-27
Kwal_56.237028.284ON4163362051e-16
Suva_10.1838.284ON3943411933e-15
YLR099C (ICT1)8.284ON3943351915e-15
Skud_12.1678.284ON3943351898e-15
Smik_12.1588.284ON3943241836e-14
KNAG0G021408.284ON4083381782e-13
Skud_4.3868.284ON4463321773e-13
Kpol_543.498.284ON4293611755e-13
Suva_2.2888.284ON4353381755e-13
Smik_4.3718.284ON4353411731e-12
KLTH0G13178g8.284ON4153461702e-12
YDR125C (ECM18)8.284ON4533331667e-12
TDEL0F041008.284ON4343401632e-11
TPHA0A016908.284ON4053531571e-10
KNAG0H031208.284ON4343391571e-10
NCAS0B051208.284ON3962721515e-10
KAFR0B028308.284ON3913461506e-10
KLLA0F19624g8.284ON4093591499e-10
CAGL0M11462g8.284ON3863551481e-09
SAKL0H16500g8.284ON4193431462e-09
NDAI0J012108.284ON4163401435e-09
NCAS0B037108.284ON4303201401e-08
AGR062C8.284ON3843331355e-08
KAFR0B053808.284ON4113851347e-08
CAGL0B01969g8.284ON4233361339e-08
Ecym_42858.284ON4053271284e-07
NDAI0J01200singletonON4273351259e-07
ZYRO0D06666g8.284ON3803331231e-06
NDAI0C054308.524ON3621381071e-04
TBLA0H014008.284ON4211541043e-04
TPHA0L016008.524ON372118910.010
SAKL0H10450g8.524ON392165910.013
KLTH0E12188g8.524ON336173800.22
KNAG0A037708.524ON356123800.25
Kwal_23.6592singletonON164112740.76
CAGL0M07854g5.130ON10544700.97
Kwal_26.9628singletonON25496721.7
Kwal_43.16490singletonON28696721.8
Skud_14.400na 2ON29345721.9
Kwal_26.6639singletonON30396721.9
Kwal_48.19391singletonON18396712.1
Ecym_47385.285ON871100732.2
Suva_14.424na 2ON28951712.6
KLLA0A10395gna 3ON29445713.1
YNR064Cna 2ON29052703.6
TBLA0H035408.524ON378235704.1
TDEL0G00150singletonON29951685.8
TPHA0E036601.50ON64795688.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0B06116g
         (431 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0B06116g Chr2 complement(519929..521224) [1296 bp, 431 aa] {...   866   0.0  
Ecym_2465 Chr2 complement(908173..909489) [1317 bp, 438 aa] {ON}...   527   0.0  
KLTH0E13948g Chr5 complement(1231122..1232438) [1317 bp, 438 aa]...   514   0.0  
Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]...   500   e-176
TDEL0F03390 Chr6 (624579..625853) [1275 bp, 424 aa] {ON} Anc_3.4...   495   e-174
ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-synteni...   494   e-174
YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}  CLD1Mitoch...   484   e-169
Kpol_1035.9 s1035 complement(19721..21004) [1284 bp, 427 aa] {ON...   481   e-169
ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} simila...   474   e-166
Smik_6.200 Chr6 (329969..331306) [1338 bp, 445 aa] {ON} YGR110W ...   474   e-165
Skud_7.415 Chr7 (692655..694013) [1359 bp, 452 aa] {ON} YGR110W ...   471   e-164
KNAG0B00950 Chr2 (173167..174423) [1257 bp, 418 aa] {ON} Anc_3.4...   469   e-164
NCAS0E00860 Chr5 (157521..158843) [1323 bp, 440 aa] {ON} Anc_3.454    469   e-164
KAFR0I01970 Chr9 (401907..403142) [1236 bp, 411 aa] {ON}              464   e-162
Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W ...   465   e-162
NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454    459   e-159
TPHA0O01310 Chr15 complement(258745..260061) [1317 bp, 438 aa] {...   454   e-158
KLLA0B12914g Chr2 (1126975..1128255) [1281 bp, 426 aa] {ON} simi...   428   e-148
CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} simil...   409   e-140
TBLA0F03460 Chr6 (853280..854605) [1326 bp, 441 aa] {ON}              372   e-125
SAKL0G19074g Chr7 (1646858..1648156) [1299 bp, 432 aa] {ON} cons...   191   1e-55
Ecym_5577 Chr5 (1185997..1187298) [1302 bp, 433 aa] {ON} similar...   172   1e-48
KLTH0C01254g Chr3 complement(113435..114739) [1305 bp, 434 aa] {...   165   7e-46
Kwal_14.985 s14 complement(142781..144088) [1308 bp, 435 aa] {ON...   115   2e-27
Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {...    84   1e-16
Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {...    79   3e-15
YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON} ...    78   5e-15
Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {...    77   8e-15
Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {...    75   6e-14
KNAG0G02140 Chr7 complement(484440..485666) [1227 bp, 408 aa] {O...    73   2e-13
Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON...    73   3e-13
Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {O...    72   5e-13
Suva_2.288 Chr2 complement(496577..497884) [1308 bp, 435 aa] {ON...    72   5e-13
Smik_4.371 Chr4 complement(662692..663999) [1308 bp, 435 aa] {ON...    71   1e-12
KLTH0G13178g Chr7 (1131579..1132826) [1248 bp, 415 aa] {ON} simi...    70   2e-12
YDR125C Chr4 complement(701397..702758) [1362 bp, 453 aa] {ON}  ...    69   7e-12
TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {O...    67   2e-11
TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.2...    65   1e-10
KNAG0H03120 Chr8 (586146..587450) [1305 bp, 434 aa] {ON} Anc_8.2...    65   1e-10
NCAS0B05120 Chr2 complement(953798..954988) [1191 bp, 396 aa] {O...    63   5e-10
KAFR0B02830 Chr2 complement(578530..579705) [1176 bp, 391 aa] {O...    62   6e-10
KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]...    62   9e-10
CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa...    62   1e-09
SAKL0H16500g Chr8 (1450828..1452087) [1260 bp, 419 aa] {ON} simi...    61   2e-09
NDAI0J01210 Chr10 (282384..283634) [1251 bp, 416 aa] {ON} Anc_8....    60   5e-09
NCAS0B03710 Chr2 (664097..665389) [1293 bp, 430 aa] {ON} Anc_8.284     59   1e-08
AGR062C Chr7 complement(833212..834366) [1155 bp, 384 aa] {ON} S...    57   5e-08
KAFR0B05380 Chr2 (1107049..1108284) [1236 bp, 411 aa] {ON} Anc_8...    56   7e-08
CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {...    56   9e-08
Ecym_4285 Chr4 (612053..613270) [1218 bp, 405 aa] {ON} similar t...    54   4e-07
NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON}              53   9e-07
ZYRO0D06666g Chr4 (576172..577314) [1143 bp, 380 aa] {ON} simila...    52   1e-06
NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON} Anc_8...    46   1e-04
TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.2...    45   3e-04
TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8....    40   0.010
SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {...    40   0.013
KLTH0E12188g Chr5 (1082142..1083152) [1011 bp, 336 aa] {ON} simi...    35   0.22 
KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {O...    35   0.25 
Kwal_23.6592 s23 (1658078..1658572) [495 bp, 164 aa] {ON} [conti...    33   0.76 
CAGL0M07854g Chr13 (785153..785470) [318 bp, 105 aa] {ON} simila...    32   0.97 
Kwal_26.9628 s26 (1300688..1301449) [762 bp, 254 aa] {ON} YNR064...    32   1.7  
Kwal_43.16490 s43 (51..911) [861 bp, 286 aa] {ON} YNR064C - Hypo...    32   1.8  
Skud_14.400 Chr14 complement(717609..718490) [882 bp, 293 aa] {O...    32   1.9  
Kwal_26.6639 s26 complement(252..1163) [912 bp, 303 aa] {ON} YNR...    32   1.9  
Kwal_48.19391 s48 (3319..3870) [552 bp, 183 aa] {ON} YNR064C - H...    32   2.1  
Ecym_4738 Chr4 (1440812..1443427) [2616 bp, 871 aa] {ON} similar...    33   2.2  
Suva_14.424 Chr14 complement(736902..737771) [870 bp, 289 aa] {O...    32   2.6  
KLLA0A10395g Chr1 complement(908097..908981) [885 bp, 294 aa] {O...    32   3.1  
YNR064C Chr14 complement(749136..750008) [873 bp, 290 aa] {ON} E...    32   3.6  
TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.5...    32   4.1  
TDEL0G00150 Chr7 complement(22315..23214) [900 bp, 299 aa] {ON}        31   5.8  
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...    31   8.9  

>SAKL0B06116g Chr2 complement(519929..521224) [1296 bp, 431 aa] {ON}
           similar to uniprot|P53264 Saccharomyces cerevisiae
           YGR110W Hypothetical ORF
          Length = 431

 Score =  866 bits (2237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/431 (96%), Positives = 416/431 (96%)

Query: 1   MXXXXXXXXXXLLTALKAAVNSISITNLISRAKVRTSAETTAIINQKSTPPTAMPLIQIA 60
           M          LLTALKAAVNSISITNLISRAKVRTSAETTAIINQKSTPPTAMPLIQIA
Sbjct: 1   MSSSSSSSSSSLLTALKAAVNSISITNLISRAKVRTSAETTAIINQKSTPPTAMPLIQIA 60

Query: 61  TQLPNLFPLSFEASIRDYSMFQENAESFQSQLLSTLPFYPSPANGRSSEILKTPVDDEGN 120
           TQLPNLFPLSFEASIRDYSMFQENAESFQSQLLSTLPFYPSPANGRSSEILKTPVDDEGN
Sbjct: 61  TQLPNLFPLSFEASIRDYSMFQENAESFQSQLLSTLPFYPSPANGRSSEILKTPVDDEGN 120

Query: 121 YINEFTIKPMNPXXXXXMKHLIFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGF 180
           YINEFTIKPMNP     MKHLIFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGF
Sbjct: 121 YINEFTIKPMNPSSSSSMKHLIFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGF 180

Query: 181 SSRPKFPFNYPEHNPIMVEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANK 240
           SSRPKFPFNYPEHNPIMVEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANK
Sbjct: 181 SSRPKFPFNYPEHNPIMVEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANK 240

Query: 241 FPNHFSKLIMCSPAGICPSPKLGQAPPQWFVKLWDRNISPFSLVRNSFHLGSKLTSGWTY 300
           FPNHFSKLIMCSPAGICPSPKLGQAPPQWFVKLWDRNISPFSLVRNSFHLGSKLTSGWTY
Sbjct: 241 FPNHFSKLIMCSPAGICPSPKLGQAPPQWFVKLWDRNISPFSLVRNSFHLGSKLTSGWTY 300

Query: 301 RRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNT 360
           RRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNT
Sbjct: 301 RRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNT 360

Query: 361 SSFKANCDWLWLYGDEDWMDLRGGQRASEFLKKIGMKSDVKVVPSAGHHLYLDNYKHFNN 420
           SSFKANCDWLWLYGDEDWMDLRGGQRASEFLKKIGMKSDVKVVPSAGHHLYLDNYKHFNN
Sbjct: 361 SSFKANCDWLWLYGDEDWMDLRGGQRASEFLKKIGMKSDVKVVPSAGHHLYLDNYKHFNN 420

Query: 421 VVIKEMEKMSF 431
           VVIKEMEKMSF
Sbjct: 421 VVIKEMEKMSF 431

>Ecym_2465 Chr2 complement(908173..909489) [1317 bp, 438 aa] {ON}
           similar to Ashbya gossypii ABL019W
          Length = 438

 Score =  527 bits (1357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/421 (60%), Positives = 319/421 (75%), Gaps = 10/421 (2%)

Query: 16  LKAAVNSISITNLISRAKVRTSAETTAIINQKSTPPTAMPLIQIATQLPNLFPLSFEASI 75
           L+  +NS   +  I R K    A  ++  + K TPPTA+PL++I   +P+LFP+  + S 
Sbjct: 15  LRCLINSSQFS--IERNKY--GANMSSFTSPKPTPPTAIPLMEILLNIPSLFPMPLKESW 70

Query: 76  RDYSMFQENAESFQSQLLSTLPFYPSPANGRSSEILKTPVDDEGNYINEFTIKPMNPXX- 134
           +DY +F ++ + FQ+ LLSTLPF+PS A+G+  EI++TPVD+EGNYINEF I+P +P   
Sbjct: 71  KDYKIFHDDVDKFQTGLLSTLPFFPSAADGKIGEIIRTPVDEEGNYINEFCIRPNSPPVN 130

Query: 135 --XXXMKHLIFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPE 192
                M HLIFVHGYGAGLGFFLKNFENI LLNN+W IHAID PGYGFSSRPKFPF+  +
Sbjct: 131 PKDSKMHHLIFVHGYGAGLGFFLKNFENIKLLNNSWTIHAIDFPGYGFSSRPKFPFSINK 190

Query: 193 HNPIMVEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANKFPNHFSKLIMCS 252
           +    VE+WFH R + WL KRGLL + + NL++AHSLGAY+ ALYA   P H  KLIMCS
Sbjct: 191 NTASEVENWFHDRFEIWLQKRGLLEDQERNLVLAHSLGAYLIALYAQSRPKHLKKLIMCS 250

Query: 253 PAGICPSPKLGQAPPQWFVKLWDRNISPFSLVRNSFHLGSKLTSGWTYRRFRQFLREGQR 312
           PAGICPS K+ + PP WFVKLWDRN+SPFSLVRNS   GSKLTSGW++RRF+QFL EG  
Sbjct: 251 PAGICPSNKVIKQPPWWFVKLWDRNLSPFSLVRNSGIFGSKLTSGWSFRRFKQFLNEGTM 310

Query: 313 GYEQHKAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNTS--SFKANCDWL 370
           G  Q +A+H+Y YAIFNKPGSGEYLLSF LKCGGDPR PL  RLF++ +  SFKA CDWL
Sbjct: 311 GESQFQALHRYAYAIFNKPGSGEYLLSFVLKCGGDPRSPLLSRLFNSQAADSFKAQCDWL 370

Query: 371 WLYGDEDWMDLRGGQRASEFL-KKIGMKSDVKVVPSAGHHLYLDNYKHFNNVVIKEMEKM 429
           W+YGD+DWMD +GG++AS+F+ + IG +S+V V+P +GHHLYLDNY  FN ++  EM KM
Sbjct: 371 WMYGDQDWMDCKGGEQASDFIVRHIGKESNVHVIPQSGHHLYLDNYSVFNELLQAEMAKM 430

Query: 430 S 430
           S
Sbjct: 431 S 431

>KLTH0E13948g Chr5 complement(1231122..1232438) [1317 bp, 438 aa]
           {ON} similar to uniprot|P53264 Saccharomyces cerevisiae
           YGR110W Hypothetical ORF
          Length = 438

 Score =  514 bits (1323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 241/396 (60%), Positives = 299/396 (75%), Gaps = 4/396 (1%)

Query: 36  TSAETTAIINQKSTPPTAMPLIQIATQLPNLFPLSFEASIRDYSMFQENAESFQSQLLST 95
           + + +   I  + + P+A+PL ++   LP LFP S + S+RDY  F+++A + Q QLLST
Sbjct: 39  SESASNPSITCRPSSPSAIPLRELVINLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLST 98

Query: 96  LPFYPSPANGRSSEILKTPVDDEGNYINEFTIKPMNPXXXXXMKHLIFVHGYGAGLGFFL 155
           LPF+P   + + +E+++TPVD++ NYINEF ++P  P     ++HLI VHGYGAGLGFFL
Sbjct: 99  LPFFPVAGDDKVAEVVQTPVDEQANYINEFCVRPAMPHPSGTLRHLIIVHGYGAGLGFFL 158

Query: 156 KNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDWFHQRIKGWLHKRGL 215
           KN E + L++N W IHAIDLPGYGFSSRPKFP+ Y       VE WFH R K WL KRGL
Sbjct: 159 KNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGL 218

Query: 216 LANPKNNLLVAHSLGAYISALYANKFPNHFSKLIMCSPAGIC--PSPKLGQAPPQWFVKL 273
           L +P+ N+LVAHS+GAY++ALYANK+PNHF KL+MCSPAGIC  PS K  + PP WF KL
Sbjct: 219 LQHPEQNMLVAHSMGAYLAALYANKYPNHFKKLVMCSPAGICNTPSNKQRRLPPWWFAKL 278

Query: 274 WDRNISPFSLVRNSFHLGSKLTSGWTYRRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGS 333
           WDRNISPFSLVRNS  LGSKLTSGW+YRRF Q L EG RG +Q +A+HKY YAIFN PGS
Sbjct: 279 WDRNISPFSLVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGS 338

Query: 334 GEYLLSFALKCGGDPRLPLEKRLFDNT-SSFKANCDWLWLYGDEDWMDLRGGQRASEFLK 392
           GEYLLSFALKCGGDPR  LE+RLF N  + FKA C+WLWLYGD+DWMD+ GG+R S FL 
Sbjct: 339 GEYLLSFALKCGGDPRDALERRLFHNKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLN 398

Query: 393 K-IGMKSDVKVVPSAGHHLYLDNYKHFNNVVIKEME 427
             +G KS V+VV  +GHHLY DNY+ FN ++ KEM+
Sbjct: 399 TAMGKKSKVEVVHDSGHHLYFDNYEQFNRILEKEMK 434

>Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]
           {ON} YGR110W - Hypothetical ORF [contig 20] FULL
          Length = 435

 Score =  500 bits (1288), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 239/424 (56%), Positives = 312/424 (73%), Gaps = 9/424 (2%)

Query: 12  LLTALKAAVNSISITNLISRAKVRTSAETTAIINQ----KSTPPTAMPLIQIATQLPNLF 67
           ++  +++A + +S   L  R ++R       + N     K + P+A+PL +I  +LPNLF
Sbjct: 12  VIAVIRSAADQLSNLQL-RRLRIRPLEIKNQVPNTSYHPKPSSPSAIPLNEIILKLPNLF 70

Query: 68  PLSFEASIRDYSMFQENAESFQSQLLSTLPFYPSPANGRSSEILKTPVDDEGNYINEFTI 127
           P S E S RD+  F+ NA + QS+LL+TLPF+P+  + R++EI++T VD +GNYINEF I
Sbjct: 71  PRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDSRRTAEIIRTTVDAQGNYINEFNI 130

Query: 128 KPMNPXXXXXMKHLIFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFP 187
           +P        MKHLI VHGYGAGLGFFLK FEN+ L+N NW IHAIDLPGYGFSSRP FP
Sbjct: 131 RPTAVDTSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRPPFP 190

Query: 188 FNYPEHNPIMVEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANKFPNHFSK 247
           F   +  P  VE WFH R   W+ +RGLL  P+NN++VAHS+GAY++ALYANK P HF K
Sbjct: 191 FKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLTALYANKHPGHFKK 250

Query: 248 LIMCSPAGICPS-PKLGQAPPQ-WFVKLWDRNISPFSLVRNSFHLGSKLTSGWTYRRFRQ 305
           L+MCSPAG+C S P++ + PP  WF KLWD+NISPFSLVRN+  LGSKLTSGW+YRR  Q
Sbjct: 251 LVMCSPAGVCHSAPEMRKRPPPWWFAKLWDKNISPFSLVRNANVLGSKLTSGWSYRRLGQ 310

Query: 306 FLREGQRGYEQHKAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNT-SSFK 364
            L++      QH+A+H+Y YAIFN+ GSGEYLLSFAL+CGG+PR+PLE+RLF N    FK
Sbjct: 311 LLKDKVLNARQHEALHRYAYAIFNRKGSGEYLLSFALQCGGEPRVPLERRLFHNRGQQFK 370

Query: 365 ANCDWLWLYGDEDWMDLRGGQRASEFLK-KIGMKSDVKVVPSAGHHLYLDNYKHFNNVVI 423
           ANC+WLWLYGD+DW+D RGG+R S+FL  ++G +S VK+V ++GHHLYLDN++ FN ++ 
Sbjct: 371 ANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGHESCVKIVKNSGHHLYLDNHRMFNKILE 430

Query: 424 KEME 427
            EM 
Sbjct: 431 DEMR 434

>TDEL0F03390 Chr6 (624579..625853) [1275 bp, 424 aa] {ON} Anc_3.454
           YGR110W
          Length = 424

 Score =  495 bits (1275), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 242/414 (58%), Positives = 297/414 (71%), Gaps = 11/414 (2%)

Query: 25  ITNLISRAKVRTSAETTAIINQKSTPPTAMPLIQIATQLPNLFPLSFEASIRDY-SMFQE 83
           I   + R +V   A++ ++       PTA+PL +I  +LP+LFP SF  S+RDY  + + 
Sbjct: 13  IVGSLLRNRVSLKAQSVSL--DVPAAPTAIPLREIIVKLPSLFPRSFGDSVRDYRDLCRH 70

Query: 84  NAESFQSQLLSTLPFYPSPANGRSSEILKTPVDDEGNYINEFTIKPMNPXX-XXXMKHLI 142
             E FQ  LL+TLPFY      R SE+++T VDDEGNYINEF I P N       +KHL+
Sbjct: 71  TDEKFQRDLLATLPFYGEGDLHRRSEVIRTKVDDEGNYINEFYIMPKNASVPRDRLKHLV 130

Query: 143 FVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDWF 202
           F+HGYGAGLGFFLKNFENIPLLNN WCIHAIDLPGYGFSSR KFPF YP+     V +WF
Sbjct: 131 FIHGYGAGLGFFLKNFENIPLLNNEWCIHAIDLPGYGFSSRCKFPFQYPKDTVTDVHEWF 190

Query: 203 HQRIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANKFPNHFSKLIMCSPAGICPSPKL 262
           H+R+  W  +R LL NP+NN+++AHSLGAY+ ALYA+K  +HF KL+MCSPAGIC S   
Sbjct: 191 HKRLNRWFAERNLLRNPENNIVMAHSLGAYLMALYASKNSSHFKKLVMCSPAGICESTTT 250

Query: 263 ----GQAPPQWFVKLWDRNISPFSLVRNSFHLGSKLTSGWTYRRFRQFLREGQRGYEQH- 317
                + PP W+ KLWDRNISPFSLVR S  LGSKLTSGW+Y+RF + LR   R  EQ  
Sbjct: 251 KAIGNRKPPWWYSKLWDRNISPFSLVRVSSRLGSKLTSGWSYKRFGKLLRSKSRKSEQQF 310

Query: 318 KAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNTSS--FKANCDWLWLYGD 375
           +A+HKY Y+IFNKPG GEYLLSFAL+CGGDPR+PLE  LF    S     N +WLWLYG+
Sbjct: 311 EALHKYCYSIFNKPGCGEYLLSFALRCGGDPRIPLEDMLFKTNDSGIMNGNLEWLWLYGE 370

Query: 376 EDWMDLRGGQRASEFLKKIGMKSDVKVVPSAGHHLYLDNYKHFNNVVIKEMEKM 429
            DWMD  GG+R SE LKK G KS+V +VP+AGHHLY DNY +FN+++I+EM+ M
Sbjct: 371 RDWMDFNGGKRVSEHLKKSGQKSEVCIVPNAGHHLYFDNYDYFNSLIIREMKSM 424

>ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR110W
          Length = 431

 Score =  494 bits (1273), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 231/389 (59%), Positives = 291/389 (74%), Gaps = 5/389 (1%)

Query: 46  QKSTPPTAMPLIQIATQLPNLFPLSFEASIRDYSMFQENAESFQSQLLSTLPFYPSPANG 105
           +K TPPTA+PL +I   LPNLFPL    S  DY  F+ + E+FQ  LLSTLPF+     G
Sbjct: 40  RKPTPPTAVPLYEIIRNLPNLFPLPTSQSWEDYKAFKSDREAFQVGLLSTLPFFERAREG 99

Query: 106 RSSEILKTPVDDEGNYINEFTIKP--MNPXXXXXMKHLIFVHGYGAGLGFFLKNFENIPL 163
           +  +I++TPVDDEGNYINEF I+P  M         HLIF+HGYGAGLGFF+KNFE++PL
Sbjct: 100 KIGKIIRTPVDDEGNYINEFCIRPASMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLPL 159

Query: 164 LNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDWFHQRIKGWLHKRGLLANPKNNL 223
           L++ W IHAIDLPGYG+S+R +FPF+   H+   VE WFH+R++ WL KRGLL  P  N+
Sbjct: 160 LDDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNM 219

Query: 224 LVAHSLGAYISALYANKFPNHFSKLIMCSPAGICPSPKLGQAPPQWFVKLWDRNISPFSL 283
           ++AHS+GAY++A YA    NHF KLIMCSPAGI PS  + + PP WF+KLWDRN+SPFSL
Sbjct: 220 VMAHSMGAYLTAHYAQSRQNHFKKLIMCSPAGISPSKSMKKQPPWWFIKLWDRNVSPFSL 279

Query: 284 VRNSFHLGSKLTSGWTYRRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGSGEYLLSFALK 343
           VRNS  LGSKLTSGW++RRFR  L EG+ G  Q +A+HKY+YAIFN PGSGEYLLSF LK
Sbjct: 280 VRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVLK 339

Query: 344 CGGDPRLPLEKRLF--DNTSSFKANCDWLWLYGDEDWMDLRGGQRASEFL-KKIGMKSDV 400
           CGGDPR+PL   +F  +    FKA C+WLWLYGD  WMD  GGQRAS ++  +IG KS V
Sbjct: 340 CGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQRASSYITDRIGGKSRV 399

Query: 401 KVVPSAGHHLYLDNYKHFNNVVIKEMEKM 429
           ++VP++GHHLY DNY +FN ++++EM+ +
Sbjct: 400 EIVPNSGHHLYFDNYSYFNKILLREMQSI 428

>YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}
           CLD1Mitochondrial cardiolipin-specific phospholipase;
           functions upstream of Taz1p to generate
           monolyso-cardiolipin; transcription increases upon
           genotoxic stress; involved in restricting Ty1
           transposition; has homology to mammalian CGI-58
          Length = 445

 Score =  484 bits (1246), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 232/414 (56%), Positives = 300/414 (72%), Gaps = 17/414 (4%)

Query: 31  RAKVRTSAETTAIINQKSTPPTAMPLIQIATQLPNLFPLSFEASIRDYSMFQENAESFQS 90
           RA  R   E   +  +  + PTA+PL +I  ++P+LFP   E S++D+  F +N ++FQ+
Sbjct: 34  RASARDVTEKQIL--RTPSAPTAIPLREIIYRVPSLFPRPLEDSVKDFRDFIKNEDAFQT 91

Query: 91  QLLSTLPFYPSPANGRSSEILKTPVDDEGNYINEFTIKPMNPXX-XXXMKHLIFVHGYGA 149
           +LL TLPFYP+P+  +++ +++T VDDEGNYINEF I+P         +KHL+F+HGYGA
Sbjct: 92  ELLKTLPFYPTPSESKTARLIRTVVDDEGNYINEFCIRPRKTSVPEADLKHLVFIHGYGA 151

Query: 150 GLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDWFHQRIKGW 209
           GLGFF+KNFE+IPLL+N WCIHAIDLPGYGFSSRPKFPF YP  N   V+DWFH+RI  W
Sbjct: 152 GLGFFIKNFEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPRDNIHSVQDWFHERIHTW 211

Query: 210 LHKRGLLANPKNNLLVAHSLGAYISALYANKFPN--HFSKLIMCSPAGI--------CPS 259
             KR LL  P+ N+++AHSLG+Y+ ALY  K+     F KLI+CSPAG+           
Sbjct: 212 FSKRNLLNRPEKNIVMAHSLGSYLMALYLQKYKESPSFKKLILCSPAGVSYRDFNNTASE 271

Query: 260 PKLGQAPPQWFVKLWDRNISPFSLVRNSFHLGSKLTSGWTYRRFRQFLREGQRGYEQHKA 319
            +  + PP W+VKLWDRNISPF+LVRN   LGSK+TSGW+YRRF+  L       ++ +A
Sbjct: 272 VEKWKPPPWWYVKLWDRNISPFTLVRNFRQLGSKITSGWSYRRFKHILNGDPEQSKRFEA 331

Query: 320 MHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNTSS---FKANCDWLWLYGDE 376
           +H+Y YAIFNK GSGEYLLSFALKCGG+PRL LE++LFD   S     +NCDWLWLYGD+
Sbjct: 332 LHRYAYAIFNKRGSGEYLLSFALKCGGEPRLSLEQQLFDGKKSDILKNSNCDWLWLYGDD 391

Query: 377 DWMDLRGGQRASEFLK-KIGMKSDVKVVPSAGHHLYLDNYKHFNNVVIKEMEKM 429
           DWMD+ GG R S FLK K+  KS+V +VP +GHHLYLDNYK FNN++ KEM+K+
Sbjct: 392 DWMDVNGGLRVSRFLKEKLKQKSNVIIVPHSGHHLYLDNYKFFNNILTKEMQKI 445

>Kpol_1035.9 s1035 complement(19721..21004) [1284 bp, 427 aa] {ON}
           complement(19721..21004) [1284 nt, 428 aa]
          Length = 427

 Score =  481 bits (1239), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 226/416 (54%), Positives = 304/416 (73%), Gaps = 13/416 (3%)

Query: 25  ITNLISRAKVRTSAETTAIINQKSTP--PTAMPLIQIATQLPNLFPLSFEASIRDYSMFQ 82
           I+N  +  +V TS   +      + P  P A+PL +I  +LPNLFP + + S+ DY  F 
Sbjct: 14  ISNNFNFRRVATSGVPSRDEKLPTVPAAPAAIPLYEIILKLPNLFPRTLKESLNDYHDFH 73

Query: 83  ENAESFQSQLLSTLPFYPSPANGRSSEILKTPVDDEGNYINEFTIKPMNPXXXXX-MKHL 141
           ++ + FQ++LLSTLP+YP   +G+ +E++ T VDDEGNYINEF I P+        +KHL
Sbjct: 74  KDIDKFQTELLSTLPYYPMANDGKKAELITTKVDDEGNYINEFCISPIGAEADQRDLKHL 133

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDW 201
           IF+HGYGAGLGFFLKNFE++PLL+N WCIHAIDLPGYG+S R +FPF YPEH+   V+DW
Sbjct: 134 IFIHGYGAGLGFFLKNFEHLPLLDNKWCIHAIDLPGYGYSKRCEFPFKYPEHDISDVQDW 193

Query: 202 FHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANKFPNHFSKLIMCSPAGIC---P 258
           FH+RI+ W   R LL  P+NN+++AHSLGAY+ ALY +KFPN F K++MCSPAGIC    
Sbjct: 194 FHKRIRTWFKARSLLTTPENNMIMAHSLGAYLMALYIDKFPNDFKKIVMCSPAGICQSST 253

Query: 259 SPKLGQ-APPQWFVKLWDRNISPFSLVRNSFHLGSKLTSGWTYRRFRQFLREGQRGYEQH 317
           S ++G    P WF KLWD+N+SPF+LVRN+++LGSKLTSGW+YRRF+Q  + G     Q 
Sbjct: 254 SEEIGNIKTPWWFNKLWDQNVSPFTLVRNTYYLGSKLTSGWSYRRFKQLKQSGH--LMQF 311

Query: 318 KAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNTSSF---KANCDWLWLYG 374
           + +H+Y Y+IFN+ GSGEY+L FALKCGGDPR+PLE  LF +  +    K++C+WLW+YG
Sbjct: 312 EKLHRYAYSIFNQKGSGEYILGFALKCGGDPRIPLEDNLFKSPKTEGIPKSDCEWLWVYG 371

Query: 375 DEDWMDLRGGQRAS-EFLKKIGMKSDVKVVPSAGHHLYLDNYKHFNNVVIKEMEKM 429
           ++DWMD+ GG+R + E + + G KS   VVP +GHHLY DNYK FN +++KEM+ M
Sbjct: 372 EKDWMDIGGGKRVTDELVTRFGKKSSTTVVPDSGHHLYFDNYKFFNELLVKEMKNM 427

>ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
           Hypothetical ORF
          Length = 430

 Score =  474 bits (1221), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 227/415 (54%), Positives = 289/415 (69%), Gaps = 12/415 (2%)

Query: 27  NLISRAKVRTSAETTAIINQKS-TPPTAMPLIQIATQLPNLFPLSFEASIRDYSMFQENA 85
           +++SR  V    +    +  +    PTA+PL +I  +LP LFP S +AS RDY  F  + 
Sbjct: 16  SILSRKNVGIKKKLHGTLGTRVPAAPTAIPLHKIIMRLPKLFPRSVDASTRDYKDFCYHT 75

Query: 86  ESFQSQLLSTLPFYPSPANGRSSEILKTPVDDEGNYINEFTIKPMNPXX-XXXMKHLIFV 144
              Q +LL TLPFYP  A  + +E++KT VDD+GNYINEF I P+ P      MKHLI +
Sbjct: 76  GQLQEELLRTLPFYPYCAESKKAEVVKTTVDDQGNYINEFCITPVKPSVPSHKMKHLICI 135

Query: 145 HGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDWFHQ 204
           HGYGAGLGFFLKN E IPLL+N+W IHAIDLPGYGFSSRPKFPF YP+ +   V  WFH 
Sbjct: 136 HGYGAGLGFFLKNLEGIPLLDNSWVIHAIDLPGYGFSSRPKFPFKYPKDSLSQVHSWFHD 195

Query: 205 RIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANKFPNHFSKLIMCSPAGICPSPKL-- 262
           RI  W  KRGLL N +NNL++AHSLGAY+ ALY  K+  HF KL+MCSPAG+C S     
Sbjct: 196 RIHTWFKKRGLLVNSQNNLVMAHSLGAYLMALYTTKYTTHFKKLVMCSPAGVCKSTTAKN 255

Query: 263 --GQAPPQWFVKLWDRNISPFSLVRNSFHLGSKLTSGWTYRRFRQFLREGQR---GYEQH 317
                PP W+ KLWD NISPF LVRN+  LGS +TSGW+YRRF + L+          Q 
Sbjct: 256 IGNTTPPWWYTKLWDLNISPFCLVRNAAALGSMVTSGWSYRRFNKLLQSNSNTNLDRLQF 315

Query: 318 KAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNTSS--FKANCDWLWLYGD 375
           +A+H+Y YAIFN+ GSGEYLLSFAL CGGDPRLPLE  +F + +S  F++NC+W+W+YG+
Sbjct: 316 EALHRYAYAIFNRRGSGEYLLSFALSCGGDPRLPLEDTIFKDKTSGIFRSNCEWIWIYGE 375

Query: 376 EDWMDLRGGQRASEFLK-KIGMKSDVKVVPSAGHHLYLDNYKHFNNVVIKEMEKM 429
            DWMD+ GG+R S F++ + G KS V V P++GHHLY DN+K FN+ ++K+M+ M
Sbjct: 376 RDWMDVNGGERVSRFIENQGGRKSQVHVAPNSGHHLYFDNHKFFNSFIVKQMKDM 430

>Smik_6.200 Chr6 (329969..331306) [1338 bp, 445 aa] {ON} YGR110W
           (REAL)
          Length = 445

 Score =  474 bits (1219), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 228/414 (55%), Positives = 302/414 (72%), Gaps = 17/414 (4%)

Query: 31  RAKVRTSAETTAIINQKSTPPTAMPLIQIATQLPNLFPLSFEASIRDYSMFQENAESFQS 90
           RA VR   E    I++  + PTA+PL +I  ++P LFP     S++D+  F ++ + FQ+
Sbjct: 34  RASVRDITEKQ--ISRTPSAPTAIPLREIIYKVPGLFPRPVGDSVKDFRDFIKSEDVFQT 91

Query: 91  QLLSTLPFYPSPANGRSSEILKTPVDDEGNYINEFTIKPMNPXX-XXXMKHLIFVHGYGA 149
           +LL TLPFYP+P+  + S +++T VDD+GNYINEF I+P+NP      +KHLIF+HGYGA
Sbjct: 92  ELLKTLPFYPNPSKLKKSRVIRTVVDDDGNYINEFCIRPINPSVPETELKHLIFIHGYGA 151

Query: 150 GLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDWFHQRIKGW 209
           GLGFF+KNFE+IPLLNN WC+HAIDLPGYGFSSRPKFPF YP  N   V+DWFH+R+  W
Sbjct: 152 GLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFEYPRDNLHDVQDWFHKRLHTW 211

Query: 210 LHKRGLLANPKNNLLVAHSLGAYISALYANKFPNH--FSKLIMCSPAGI--------CPS 259
            +KR LL  P  N+++AHSLG+Y+ ALY  K+     F KLI+CSPAG+           
Sbjct: 212 FNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSPAGVSHRDSNNTTSE 271

Query: 260 PKLGQAPPQWFVKLWDRNISPFSLVRNSFHLGSKLTSGWTYRRFRQFLREGQRGYEQHKA 319
            +  + PP W+VKLWDRNISPF+LVRNS   GSK+TSGW+YRRF+  L    +   + +A
Sbjct: 272 AEKWKPPPWWYVKLWDRNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEA 331

Query: 320 MHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNTS---SFKANCDWLWLYGDE 376
           +H+Y Y+IFNK GSGEYLLSFALKCGG+PRLPLE++LF++ +      +N +WLWLYGD+
Sbjct: 332 LHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNDRNLNILRSSNYEWLWLYGDD 391

Query: 377 DWMDLRGGQRASEFL-KKIGMKSDVKVVPSAGHHLYLDNYKHFNNVVIKEMEKM 429
           DWMD+ GG R S+FL +K+  KS+V +VP AGHHLYLDN K FN++++KEM K+
Sbjct: 392 DWMDVNGGIRVSKFLNEKLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMRKV 445

>Skud_7.415 Chr7 (692655..694013) [1359 bp, 452 aa] {ON} YGR110W
           (REAL)
          Length = 452

 Score =  471 bits (1211), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 228/419 (54%), Positives = 307/419 (73%), Gaps = 18/419 (4%)

Query: 29  ISRAKVRTSAE---TTAIINQKSTPPTAMPLIQIATQLPNLFPLSFEASIRDYSMFQENA 85
           I+R++   S E   T   I +  + PTA+PL +I  ++P LFP   E S++D+  F +N 
Sbjct: 33  ITRSESDESPERDGTEERILRTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFTKNE 92

Query: 86  ESFQSQLLSTLPFYPSPANGRSSEILKTPVDDEGNYINEFTIKPMNPXX-XXXMKHLIFV 144
           + FQ++LL TLPFYP+P+  + S+++KT VDD+GNYINEF I P  P      +KHL+F+
Sbjct: 93  DVFQTELLETLPFYPNPSKYKKSKLIKTVVDDDGNYINEFCIYPQKPSVPETELKHLVFI 152

Query: 145 HGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDWFHQ 204
           HGYGAGLGFF+KN E+IPLL+N WCIHAIDLPGYGFSSRPKFPF YP+ N   V+DWFH+
Sbjct: 153 HGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPKDNLHTVQDWFHE 212

Query: 205 RIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANKFPN--HFSKLIMCSPAGIC----- 257
           RI  W +KR LL  P  N++VAHSLG+Y+ ALY  K+     F KL++CSPAG+      
Sbjct: 213 RIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFKKLVLCSPAGVSNRDFD 272

Query: 258 -PSPKLG--QAPPQWFVKLWDRNISPFSLVRNSFHLGSKLTSGWTYRRFRQFLREGQRGY 314
             + ++G  + PP W+VKLWDRNISPF+LVRN+  LGSK+TSGW+YRRF+  L       
Sbjct: 273 NTTAEVGKWKPPPWWYVKLWDRNISPFTLVRNARQLGSKITSGWSYRRFKHILNGDPGQS 332

Query: 315 EQHKAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLF--DNTSSFK-ANCDWLW 371
            + +A+H+Y Y+IFNK GSGEYLLSFAL+CGG+PRLPLE++LF  +N+   K +N +W+W
Sbjct: 333 RRFEALHRYAYSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFNGENSKVLKNSNYEWVW 392

Query: 372 LYGDEDWMDLRGGQRASEFL-KKIGMKSDVKVVPSAGHHLYLDNYKHFNNVVIKEMEKM 429
           LYG++DWMD+ GG R S++L +K+G KS+V +VP AGHHLYLDNY  FN +++KEM+ +
Sbjct: 393 LYGNDDWMDVDGGLRVSKYLNEKLGQKSNVFIVPHAGHHLYLDNYTFFNKILVKEMQNV 451

>KNAG0B00950 Chr2 (173167..174423) [1257 bp, 418 aa] {ON} Anc_3.454
           YGR110W
          Length = 418

 Score =  469 bits (1208), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 225/420 (53%), Positives = 297/420 (70%), Gaps = 9/420 (2%)

Query: 12  LLTALKAAVNSISITNLISRAKVRTSAETTAIINQKSTPPTAMPLIQIATQLPNLFPLSF 71
           L  +L+A +N + + +L    + R  +++   + +  T PTA+PL +I  +LP LFP   
Sbjct: 6   LRGSLQAVLNRLKVFDL-KNVRFRKQSDSRVYV-KTPTAPTAIPLTEIIVKLPYLFPRGV 63

Query: 72  EASIRDYSMFQENAESFQSQLLSTLPFYPSPANGRSSEILKTPVDDEGNYINEFTIKPMN 131
             S+ DY +F  NA+  Q  LLSTLPF+P   +G+ +EI++T +D++ N+INEF I+P N
Sbjct: 64  AQSLEDYKVFSNNADKIQYDLLSTLPFFPEAKDGKRAEIVRTKIDEDDNFINEFFIQPAN 123

Query: 132 PXXXXXMKHLIFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYP 191
                 +KHLIF+HGYGAGLGFFLKNFENI L +N+WCIHAIDLPG+GFSSR KFPF YP
Sbjct: 124 VTEPSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFPFKYP 183

Query: 192 EHNPIMVEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANKFPNHFSKLIMC 251
           E +   V+ WFH+R+K W  KR LL NP NN++VAHSLGAY+ ALY    P HF KLIMC
Sbjct: 184 EDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMALYKRNNPLHFKKLIMC 243

Query: 252 SPAGICPSPKLGQAPPQWFVKLWDRNISPFSLVRNSFHLGSKLTSGWTYRRFRQFLREGQ 311
           SPAG+C S  + + PP W+  LWD N+SPFSLVRNS  LGSKLTSGW+YRRFR       
Sbjct: 244 SPAGMCNSTVVKKQPPWWYAALWDMNLSPFSLVRNSGWLGSKLTSGWSYRRFRSL----- 298

Query: 312 RGYEQHKAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLF-DNTSSFKANCDWL 370
               Q + +H Y+YAIFN+PG GEYLL+FAL+CGGDPR+ LE  LF D  + + ++ +W+
Sbjct: 299 HSKIQFENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLEATLFNDVVNKWDSDSEWV 358

Query: 371 WLYGDEDWMDLRGGQRASEFLKKI-GMKSDVKVVPSAGHHLYLDNYKHFNNVVIKEMEKM 429
           WLYGD DWMD++GG+R S+ + +I   KS V+V+P+AGHHLY DN   FN ++ KEM K+
Sbjct: 359 WLYGDRDWMDVKGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISCFNAILEKEMTKL 418

>NCAS0E00860 Chr5 (157521..158843) [1323 bp, 440 aa] {ON} Anc_3.454
          Length = 440

 Score =  469 bits (1208), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 239/426 (56%), Positives = 288/426 (67%), Gaps = 9/426 (2%)

Query: 12  LLTALKAAVNSISITNLISRAKVRTSAETTAIINQKSTPPTAMPLIQIATQLPNLFPLSF 71
           L T  K      +I    S+  V   A +  I+ Q STPP A+P+  I T LP+LFP S 
Sbjct: 15  LQTIFKRRQRIGTIAKQESQRNVTEYATSNTILPQPSTPPVAIPITDIITSLPSLFPRSL 74

Query: 72  EASIRDYSMFQENAESFQSQLLSTLPFYPSPANGRSSEILKTPVDDEGNYINEFTIKPM- 130
             S RDY+ F  + +S Q  LL TLPF+P  ++ + +++++TP+DDEGNYINEF I P  
Sbjct: 75  HDSRRDYNTFTTDIDSLQLNLLKTLPFFPMGSSQKVAKLIRTPIDDEGNYINEFCIMPAV 134

Query: 131 --NPXXXXXMKHLIFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPF 188
                    +KHLIF+HGYGAGLGFFLKN ENIPLL+N WCIHAIDLPGYGFSSR KFPF
Sbjct: 135 KDGDYSSPDLKHLIFIHGYGAGLGFFLKNLENIPLLDNKWCIHAIDLPGYGFSSRFKFPF 194

Query: 189 NYPEHNPIMVEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANKFPNHFSKL 248
           +YP  +   V+ WFH RI  W  +R LL NP+NNL++AHSLGAY+ A YA  F NHF K+
Sbjct: 195 HYPNDSQTKVQKWFHDRIYRWFRERNLLQNPQNNLVMAHSLGAYLMAHYAFHFSNHFKKI 254

Query: 249 IMCSPAGIC--PSPKLGQAPPQWFVKLWDRNISPFSLVRNSFHLGSKLTSGWTYRRFRQF 306
           IMCSPAG+      K  + PP W+ KLWD N SPFSLVRNS   GSK+TSGW+YRRF+  
Sbjct: 255 IMCSPAGVSQFAVGKQNKQPPWWYNKLWDLNYSPFSLVRNSGIYGSKITSGWSYRRFKPT 314

Query: 307 LREGQRGYEQHKAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNTSSFKAN 366
              G     Q +A+HKYTY IFNK GSGEYLLSF L CGGDPR  LE  LF   +  +  
Sbjct: 315 SFNGLNE-SQFEALHKYTYGIFNKNGSGEYLLSFILSCGGDPRFALEDNLFKEENPPEDL 373

Query: 367 CDWLWLYGDEDWMDLRGGQRAS-EFLKKIG--MKSDVKVVPSAGHHLYLDNYKHFNNVVI 423
           CDW+W+YGD DWMD+ G  R S   +KK G   KS V V+PSAGHHLYLDNYK FNN++I
Sbjct: 374 CDWVWVYGDRDWMDINGAHRISRRLVKKAGDTSKSKVHVIPSAGHHLYLDNYKAFNNLII 433

Query: 424 KEMEKM 429
           KEME M
Sbjct: 434 KEMETM 439

>KAFR0I01970 Chr9 (401907..403142) [1236 bp, 411 aa] {ON} 
          Length = 411

 Score =  464 bits (1195), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 218/386 (56%), Positives = 277/386 (71%), Gaps = 9/386 (2%)

Query: 48  STPPTAMPLIQIATQLPNLFPLSFEASIRDYSMFQENAESFQSQLLSTLPFYPSPANGRS 107
           S+ P A+PL++I  QLP LFP S + S +DY +++E  E  Q  LLSTLPFYP+ +  + 
Sbjct: 31  SSAPVAIPLVKIIAQLPRLFPRSIDESFKDYRVYKEGPERMQEDLLSTLPFYPNVSKDKV 90

Query: 108 SEILKTPVDDEGNYINEFTIKPMNPXXXXXMKHLIFVHGYGAGLGFFLKNFENIPLLNNN 167
           + I+KT VD+EGNYINEF I P N      +KHLIF+HGYGAG GFFLKN E+IPLL+NN
Sbjct: 91  ARIIKTVVDEEGNYINEFCITPKNTVNSQKLKHLIFIHGYGAGFGFFLKNLESIPLLDNN 150

Query: 168 WCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDWFHQRIKGWLHKRGLLANPKNNLLVAH 227
           WCIHAIDLPG+GFSSR  FPF YP  N   V  WFH+RI+ WL +R LL NPKNN++VAH
Sbjct: 151 WCIHAIDLPGFGFSSRKNFPFKYPTSNTSEVTAWFHERIRRWLEERTLLDNPKNNVIVAH 210

Query: 228 SLGAYISALYANKFPNHFSKLIMCSPAGICPSPKLGQA---PPQWFVKLWDRNISPFSLV 284
           SLGAY+ ALY   +P H  KLIMCSPAG+  S    +A   PP W+ KLWD N+SPF+LV
Sbjct: 211 SLGAYLMALYTQVYPAHLRKLIMCSPAGVSKSQNNSKAVLQPPWWYAKLWDMNLSPFTLV 270

Query: 285 RNSFHLGSKLTSGWTYRRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGSGEYLLSFALKC 344
           R S HLGSKLTSGW+YRRF+  L E +  +E    +H+Y+YAIFN+PGSGEYLL F L+C
Sbjct: 271 RLSKHLGSKLTSGWSYRRFK--LIENRMQFEM---LHRYSYAIFNQPGSGEYLLGFILEC 325

Query: 345 GGDPRLPLEKRLFDNTSSFKANCDWLWLYGDEDWMDLRGGQRASE-FLKKIGMKSDVKVV 403
           GG+PR  LE  LF N  +  +  +W W+YG+ DWMD+ GG+R     L+K    S   +V
Sbjct: 326 GGNPRCSLEDTLFSNNFNVSSKVEWAWIYGENDWMDIEGGRRVHNLLLEKFNRDSKFYMV 385

Query: 404 PSAGHHLYLDNYKHFNNVVIKEMEKM 429
           P+AGHHLYLDN ++FNN++++ ME +
Sbjct: 386 PNAGHHLYLDNIRYFNNIIVQHMENV 411

>Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W
           (REAL)
          Length = 451

 Score =  465 bits (1197), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 224/411 (54%), Positives = 299/411 (72%), Gaps = 17/411 (4%)

Query: 34  VRTSAETTAIINQKSTPPTAMPLIQIATQLPNLFPLSFEASIRDYSMFQENAESFQSQLL 93
           ++ +AE   +  +  + PTA+PL +I  ++P LFP   E S++D+  F +N +SFQ++LL
Sbjct: 43  IKDAAEKRIL--RTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELL 100

Query: 94  STLPFYPSPANGRSSEILKTPVDDEGNYINEFTIKPMNPXX-XXXMKHLIFVHGYGAGLG 152
           +TLPFYP+P+  + S+++KT VDD+GNYINEF I P  P      +KHL+F+HGYGAGLG
Sbjct: 101 ATLPFYPNPSTTKKSKLIKTIVDDDGNYINEFCIYPQVPSVPEADLKHLVFIHGYGAGLG 160

Query: 153 FFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDWFHQRIKGWLHK 212
           FF+KNFE+IPLLNN WC+HAIDLPGYGFSSRPKFPF YP  +   V+DWFH+RI  W  K
Sbjct: 161 FFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEK 220

Query: 213 RGLLANPKNNLLVAHSLGAYISALYANKFPN--HFSKLIMCSPAGIC--------PSPKL 262
           R LL  P+ N+++AHSLG+Y+ ALY  K+     F KLI+CSPAG+            + 
Sbjct: 221 RNLLNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEK 280

Query: 263 GQAPPQWFVKLWDRNISPFSLVRNSFHLGSKLTSGWTYRRFRQFLREGQRGYEQHKAMHK 322
            + PP W+VKLWD+NISPF+LVRNS   GSK+TSGW+YRRF+  L       ++ +A+H+
Sbjct: 281 WKPPPWWYVKLWDKNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHR 340

Query: 323 YTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFD--NTSSFK-ANCDWLWLYGDEDWM 379
           Y Y+IFNK GSGEYLLSFALKCGG+PRLPLE++LF+  N +  K A  +W+WLYGD+DWM
Sbjct: 341 YAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWM 400

Query: 380 DLRGGQRASEFL-KKIGMKSDVKVVPSAGHHLYLDNYKHFNNVVIKEMEKM 429
           D+ GG R S+ L  K+  KS V  VP+AGHHLYLDN+K FN +++ EM+K+
Sbjct: 401 DVNGGLRVSKLLNDKLKQKSSVITVPNAGHHLYLDNHKFFNTIIMNEMQKV 451

>NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454
          Length = 456

 Score =  459 bits (1180), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 227/397 (57%), Positives = 281/397 (70%), Gaps = 11/397 (2%)

Query: 38  AETTAIINQKSTPPTAMPLIQIATQLPNLFPLSFEASIRDYSMFQENAESFQSQLLSTLP 97
           A TT I     TPPTA+PL++I T LP LFP S + SI+DY +FQ++ E  Q  LL TLP
Sbjct: 59  ATTTKINTIAPTPPTAIPLLRIITSLPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLP 118

Query: 98  FYPSPANGRSSEILKTPVDDEGNY-INEFTIKPMNPXX--XXXMKHLIFVHGYGAGLGFF 154
           F+ + A  ++ +ILKT ++D  +Y INEF I P          +KHLIF+HGYGAGLGFF
Sbjct: 119 FFSNGAKFKTGKILKTQIEDNDDYYINEFCITPDTNININSADVKHLIFIHGYGAGLGFF 178

Query: 155 LKNFENIPLLNNNWCIHAIDLPGYGFSSR-PKFPFNYPEHNPIMVEDWFHQRIKGWLHKR 213
           +KN ENIPLLNN WCIHAIDLPGYG+S+R  KFPF YP  + + V++WFH +I  WL KR
Sbjct: 179 IKNLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKR 238

Query: 214 GLLANPKNNLLVAHSLGAYISALYANKFPNHFSKLIMCSPAGICPSP--KLGQAPPQWFV 271
            LL  PKNNL+VAHSLGAY+ A YA KFP+HF KLIMCSPAG+  S   KL  +PP W+ 
Sbjct: 239 NLLNYPKNNLIVAHSLGAYLMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYE 298

Query: 272 KLWDRNISPFSLVRNSFHLGSKLTSGWTYRRFRQFLREGQRGYEQHKAMHKYTYAIFNKP 331
           KLWD N SPFS+VRNS   GSK+TS W+YRRF+         ++Q +A+H+Y Y+IFN+P
Sbjct: 299 KLWDLNFSPFSIVRNSGIYGSKITSAWSYRRFKPL----DLDHKQFEALHRYAYSIFNRP 354

Query: 332 GSGEYLLSFALKCGGDPRLPLEKRLFDNTSSFKANCDWLWLYGDEDWMDLRGGQRASEFL 391
           G GEYLLSF L CGG+PR  LE  LF   +     CDW W+YGD DWMD+ G +R S  +
Sbjct: 355 GCGEYLLSFILSCGGNPRFSLEDTLFQRENLSTELCDWGWIYGDNDWMDINGAKRVSRLI 414

Query: 392 -KKIGMKSDVKVVPSAGHHLYLDNYKHFNNVVIKEME 427
            ++   KSDV V+PSAGHHLYLDNYK FN ++IKEME
Sbjct: 415 NEQQKGKSDVHVIPSAGHHLYLDNYKDFNKLLIKEME 451

>TPHA0O01310 Chr15 complement(258745..260061) [1317 bp, 438 aa] {ON}
           
          Length = 438

 Score =  454 bits (1169), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 219/381 (57%), Positives = 275/381 (72%), Gaps = 7/381 (1%)

Query: 54  MPLIQIATQLPNLFPLSFEASIRDYSMFQENAESFQSQLLSTLPFYPSPANGRSSEILKT 113
           + L ++  Q P LFP SF  S +DY  F  + E+FQ +LL TLP++P P+NG  S+I  T
Sbjct: 59  LSLFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNT 118

Query: 114 PVDDEGNYINEFTIKPMNPXX-XXXMKHLIFVHGYGAGLGFFLKNFENIPLLNNNWCIHA 172
            VDDEG+ INEF + P N       +KHLIFVHGYGAGLGFFLKN ENI LLN+ WC+HA
Sbjct: 119 IVDDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHA 178

Query: 173 IDLPGYGFSSRPKFPFNYPEHNPIMVEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAY 232
           IDLPGYGFS+R KFPF   +H    V +WFH RI+ W+H+R LL + +NN L+AHSLGAY
Sbjct: 179 IDLPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAY 238

Query: 233 ISALYANKFPNHFSKLIMCSPAGICPSPKLGQAPPQ-WFVKLWDRNISPFSLVRNSFHLG 291
           + ALY +K PN   K++MCSPAGI  S  L +  P  WF KLW+RNISPF+LVR+S ++G
Sbjct: 239 LMALYVDKHPNDLQKILMCSPAGIGDSMNLKKKTPAWWFEKLWERNISPFTLVRSSSYIG 298

Query: 292 SKLTSGWTYRRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLP 351
           SKLTSGWTYRRF   L   Q   +Q +A+HKYTY+IFN+ GSGEYLL+FALKCGG PR P
Sbjct: 299 SKLTSGWTYRRFSSLL--SQNNLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGPRYP 356

Query: 352 LEKRLFDNTSS--FKANCDWLWLYGDEDWMDLRGGQRASEFL-KKIGMKSDVKVVPSAGH 408
           LEK LF N      K++ +W+W YGD DWMD  GG R SE L K++  +S+V +VP AGH
Sbjct: 357 LEKTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYIVPRAGH 416

Query: 409 HLYLDNYKHFNNVVIKEMEKM 429
           HLY DN++ FN++++KEME M
Sbjct: 417 HLYFDNHQFFNDLILKEMECM 437

>KLLA0B12914g Chr2 (1126975..1128255) [1281 bp, 426 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
          Length = 426

 Score =  428 bits (1101), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 217/416 (52%), Positives = 282/416 (67%), Gaps = 23/416 (5%)

Query: 23  ISITNLISRAKVRTSAETTAI---------IN--QKSTPPTAMPLIQIATQLPNLFPLSF 71
           I + N + R  V  +A T  +         +N  +KST P  +PL+QI T L  LFPLSF
Sbjct: 21  IGVFNKLQREHVGVTAGTGNVGSTNKKSVRVNTVRKSTAPIGLPLLQIVTNLHKLFPLSF 80

Query: 72  EASIRDYSMFQENAESFQSQLLSTLPFYPSPANGRSSEILKTPVDDEGNYINEFTIKPMN 131
             S++DY  +  N E FQ  LLS LP+YP P+   SS+I+KTP+D  GNYINEF I P+ 
Sbjct: 81  AESLKDYKQYNINKEQFQEDLLSVLPYYPEPSARFSSKIIKTPIDAAGNYINEFQITPIR 140

Query: 132 PXXXXX-MKHLIFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNY 190
           P      +KH+I VHGYGAGLGF+LKNF    LL+ N  +HAIDLPGYGFSSRP FPF+Y
Sbjct: 141 PESDGKPLKHIILVHGYGAGLGFYLKNFN--ALLSENVVVHAIDLPGYGFSSRPMFPFHY 198

Query: 191 PEHNPIMVEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANKFPNHFSKLIM 250
           P+ + + VED+FH  +  W  K+GL++  +NN ++AHS+GAYI +LYANK+  HF KL M
Sbjct: 199 PKDSYLAVEDYFHDALHKWFDKKGLISCWENNYVIAHSMGAYIFSLYANKY-KHFKKLFM 257

Query: 251 CSPAGICPSPKLGQAPPQWFVKLWDRNISPFSLVRNSFHLGSKLTSGWTYRRFRQFLREG 310
           CSP GI  +  +   PP WF+KLWD+NISPFSLVRN+ H+GSKL SGWT RRF       
Sbjct: 258 CSPGGISRNKDM-PPPPWWFLKLWDQNISPFSLVRNAGHVGSKLVSGWTARRFGLH---- 312

Query: 311 QRGYEQHKAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNTSSFKANCDWL 370
              +     +H YTY IFN+PGSGEY+LSF L CGG PR+PLE RLF   +   ++ DW+
Sbjct: 313 ---HPNFDKLHHYTYGIFNQPGSGEYMLSFMLGCGGWPRVPLETRLFTEENFNSSHLDWV 369

Query: 371 WLYGDEDWMDLRGGQRASEFLKKIGMKSDVKVVPSAGHHLYLDNYKHFNNVVIKEM 426
           WLYGD DWMD+ G +R ++FL+K  + + +++VP+AGHHLY DN   FNNV+ KE+
Sbjct: 370 WLYGDSDWMDINGARRINDFLRKKCINTKLEIVPNAGHHLYWDNDSFFNNVLRKEL 425

>CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110w
          Length = 451

 Score =  409 bits (1050), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 203/441 (46%), Positives = 275/441 (62%), Gaps = 33/441 (7%)

Query: 18  AAVNSISITNLISRAKVRTSAETTAIINQKSTPPTAMPLIQIATQLPNLFPLSFEASIRD 77
            A   + +++L  ++      + +AII+  +T PTA PL +I   LP LFP S   S RD
Sbjct: 14  VASKLLRLSSLGEKSSEVVGKDGSAIIH--ATAPTAKPLYEIVRDLPRLFPRSLAESKRD 71

Query: 78  YSMFQENAESFQSQLLSTLPFYPSPANGRSSEILKTPVDDEGNYINEFTIKPMNPXXXXX 137
           Y+ F  N +  Q +LL TLPF+      + + + KT +D +GNYINE  I+P N      
Sbjct: 72  YATFHSNVDLMQLELLRTLPFFERTGYNKRAYLRKTEIDSDGNYINELVIEPANVDPNKK 131

Query: 138 MKHLIFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIM 197
            K LIFVHGYGAGLGF+LKN+E++PLL+++W IHAIDLPGYGFSSR  FPF +P  +  +
Sbjct: 132 RKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPFQFPRDDTSV 191

Query: 198 VEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANKFPNHFSKLIMCSPAGIC 257
           V DWF  R++    KRG   +  +N+++AHS+GAY+ A Y NK+P+   K++MCSPAGI 
Sbjct: 192 VCDWFISRLRTLFEKRGF--DKSDNIVMAHSMGAYLMAFYLNKYPDSVKKMVMCSPAGIS 249

Query: 258 PSP-------------------KLGQAPPQWFVKLWDRNISPFSLVRNSFHLGSKLTSGW 298
            S                       +  P W+ KLWDRNISPF LVR +  LGSK+TSGW
Sbjct: 250 RSQYSINNNITEDISSGKEEIKLKIKKVPWWYTKLWDRNISPFVLVRKTGILGSKITSGW 309

Query: 299 TYRRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLF- 357
           TYRRF+  L   +  YEQ + +H+Y++AIFN  GSGEYLLSF L+CGGDPR PLE  LF 
Sbjct: 310 TYRRFKPILLNKENNYEQFEKLHRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFS 369

Query: 358 --------DNTSSFKANCDWLWLYGDEDWMDLRGGQRAS-EFLKKIGMKSDVKVVPSAGH 408
                   DN     ++C+W+W+YG  DWMD+ G +R + +FL     KS V  +P +GH
Sbjct: 370 SDANKFGIDNAGIKNSSCEWVWVYGANDWMDIHGAERVTKDFLMNNRKKSRVVTIPESGH 429

Query: 409 HLYLDNYKHFNNVVIKEMEKM 429
           HLY DNY  FN+++I EM+ +
Sbjct: 430 HLYFDNYPMFNSLLIDEMKSL 450

>TBLA0F03460 Chr6 (853280..854605) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score =  372 bits (955), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 202/400 (50%), Positives = 250/400 (62%), Gaps = 28/400 (7%)

Query: 48  STPPTAMPLIQIATQLPNLFPLSFEASIRDYSMFQENAESFQSQLLSTLPFYPSPANG-- 105
           ST P A  L QI   LP LFP S   SIRDYS F+ N E FQ +LLS L FYPS  N   
Sbjct: 45  STAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLYNNNS 104

Query: 106 ---------RSSEILKTPVDDEGNYINEFTIKPMNPXXXXXMKHLIFVHGYGAGLGFFLK 156
                    R  +I+KT V+ E  YINEF I P        +KHLI +HGYGAGLGF++ 
Sbjct: 105 NDTSGNDDPRQGQIIKTYVN-ENEYINEFQILPNTSTPYDRLKHLILIHGYGAGLGFYIN 163

Query: 157 NFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIM-----VEDWFHQRIKGWLH 211
             +++ +  +NWCIHA+DLPGYGFSSR KFP  Y   NP +     V DWF +R+K W H
Sbjct: 164 TLQHLSM--DNWCIHAVDLPGYGFSSRLKFP--YGTINPRIYSKKDVLDWFQKRLKTWFH 219

Query: 212 KRGLLANPKNNLLVAHSLGAYISALYANKFPNHFSKLIMCSPAGICPSPKLGQAPPQWFV 271
           K+GLLA+P+NNL+ AHS+GAYI   Y N  P+ F K+IMCSPAG  P+       P W+ 
Sbjct: 220 KKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGFYPASNPLTNIPLWYT 279

Query: 272 KLWDRNISPFSLVRNSFHLGSKLTSGWTYRRFRQFLREGQRGYEQHKAMHKYTYAIFNKP 331
            LWDRN SPFSLVR S  LGSKLTSGW+Y RF  F        E   A+H Y Y+IFN P
Sbjct: 280 YLWDRNYSPFSLVRISGPLGSKLTSGWSYSRF--FHSNQTISNELSLALHTYAYSIFNLP 337

Query: 332 GSGEYLLSFALKCGGDPRLPLEKRLFDNTSSF-----KANCDWLWLYGDEDWMDLRGGQR 386
           GSGEY LS  LK GGDPR PL++  F   S+      ++N ++ WLYG  DW++  GG +
Sbjct: 338 GSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKTGGFK 397

Query: 387 ASEFLKKIGMKSDVKVVPSAGHHLYLDNYKHFNNVVIKEM 426
            S+FL  +  KS+V + P++GHHLY DNY  FN+ + KEM
Sbjct: 398 ISQFLNSLNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEM 437

>SAKL0G19074g Chr7 (1646858..1648156) [1299 bp, 432 aa] {ON}
           conserved hypothetical protein
          Length = 432

 Score =  191 bits (485), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 136/418 (32%), Positives = 183/418 (43%), Gaps = 87/418 (20%)

Query: 70  SFEASIRDYSMFQENAESFQSQLLSTLPFYPSPANGRSSEILKTPVDDEGNYINEFTIKP 129
            F+AS + +       ES +  +LS L FYP     R  E +   +   GN I+EF I+ 
Sbjct: 27  DFKASFKTWKHASSLRES-EENILSMLDFYPEGDESRRCETMDVDIG-TGNSIHEFCIEN 84

Query: 130 MNPXXXXXMKHLIFVHGYGAGLGFFLKNFE---NIPLLNNNWCIHAIDLPGYGFSSRPKF 186
                    + ++ VHGYGA LG F++NF+    IP +     +HAID+ GYG SSRPKF
Sbjct: 85  TKESDRDYCRDMVLVHGYGAALGLFIRNFDGLSQIPGIR----LHAIDMLGYGLSSRPKF 140

Query: 187 P-----------FNYPEHNPIMVEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISA 235
           P               + + ++ ED+F   I+ W HKR L       +LV HSLG Y+S 
Sbjct: 141 PDTGFLTSFWKKREVTKEDVLLAEDFFIDSIETWRHKRHL----DKFVLVGHSLGGYLSC 196

Query: 236 LYANKFPNHFSKLIMCSPAGICPS-------------------PKLGQA----------- 265
            YA K+P    KLI+ SP G+  S                   P + Q            
Sbjct: 197 RYALKYPERVEKLILVSPVGVETSIFDLTKEHTATHEHAAELGPDIAQELKVVPENSTTD 256

Query: 266 -----------------------PPQWFVKLWDRNISPFSLVRNSFHLGSKLTSGWTYRR 302
                                   P+    +W+ NISPF ++R+    G  L S W++RR
Sbjct: 257 KPVQPSSSFHVPNESGHVERIPNLPKIVRIIWENNISPFGILRSLGPWGPLLCSRWSFRR 316

Query: 303 FRQFLREGQRGYEQHKAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNTSS 362
           F      G +  EQ    H Y Y  FN  GSGEY L+  L  G   R+PL      + + 
Sbjct: 317 FSHC---GDK--EQVMKFHDYAYNTFNARGSGEYALTRILAPGVLARIPLL-----SCAP 366

Query: 363 FKANCDWLWLYGDEDWMDLRGGQRASEFLKKIGMKSDVKVVPSAGHHLYLDNYKHFNN 420
               C+ LW+YG  DWM    G    + L K G  +D  VV  AGHHLYLDN   FN 
Sbjct: 367 KNLKCESLWMYGSHDWMSKEAGSVIVKELNKAGNTADYSVVSDAGHHLYLDNPHEFNQ 424

>Ecym_5577 Chr5 (1185997..1187298) [1302 bp, 433 aa] {ON} similar to
           Saccharomyces cerevisiae YGR110W
          Length = 433

 Score =  172 bits (437), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 127/403 (31%), Positives = 186/403 (46%), Gaps = 91/403 (22%)

Query: 89  QSQLLSTLPFYPSPANGRSSEILKTPVDDEGNYINEFTIKPMNPXXXXXMKHLIFVHGYG 148
           +  +L  L FYP   + R+ E+L   +   G+Y++EF I+   P      K ++ VHGYG
Sbjct: 41  EDNVLRMLSFYPDGDSERTCEVLHVDIGG-GDYMHEFCIENKLPMTRDTCKDIVLVHGYG 99

Query: 149 AGLGFFLKNFE---NIPLLNNNWCIHAIDLPGYGFSSRPKFP----FNYPEHNPIMVED- 200
             LG F++NF+    IP +     +HAID+ GYG SSRP+FP    ++Y     ++ ++ 
Sbjct: 100 TALGVFIRNFDELSQIPGVR----LHAIDMLGYGLSSRPRFPRSGFWDYYVKGKVVTKEQ 155

Query: 201 ------WFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANKFPNHFSKLIMCSPA 254
                 +F   ++ W  KR    N  + +LV HSLG Y+S+ YA + P    KL++ SP 
Sbjct: 156 VEEALAFFVDSLEAWREKR----NVDSFVLVGHSLGGYLSSFYALRHPERIDKLVLVSPV 211

Query: 255 GICPS------------PKLGQAPPQ---------------------------------- 268
           G+  S               GQ  P+                                  
Sbjct: 212 GVETSIYDLTAEHTPEHQHAGQLGPEVASEFKEDATEHTTDLSIDSNSPQSSSLHIPNEK 271

Query: 269 ----------WFVK-LWDRNISPFSLVRNSFHLGSKLTSGWTYRRFRQFLREGQRGYEQH 317
                     W VK LW+ N+SPFSL+R    LG K+ + W++RRF        +   + 
Sbjct: 272 GFVEHVPNIPWLVKMLWNTNVSPFSLLRLLGPLGPKICANWSFRRFG-----ACKDTNEL 326

Query: 318 KAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNTSSFKANCDWLWLYGDED 377
              H+Y Y  F   GSGEY +   L  G   R+PL  +L     + K  CD LW+YG  D
Sbjct: 327 MNFHQYAYNNFKAKGSGEYAMMKILAPGALARVPLLSQL---PGALK--CDSLWMYGSND 381

Query: 378 WMDLRGGQRASEFLK-KIGMKSDVKVVPSAGHHLYLDNYKHFN 419
           WM    G    E L+ K   +++ K+V +AGHHLYLDN + FN
Sbjct: 382 WMSKEAGCIIVEELQEKSDYRAEYKIVNNAGHHLYLDNPEEFN 424

>KLTH0C01254g Chr3 complement(113435..114739) [1305 bp, 434 aa] {ON}
           conserved hypothetical protein
          Length = 434

 Score =  165 bits (418), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 126/409 (30%), Positives = 186/409 (45%), Gaps = 82/409 (20%)

Query: 82  QENAESFQSQLLSTLPFYPSPANGRSSEILKTPVDDEGNYINEFTIKPMNPXXXXXMKHL 141
           + +A+  + +LLSTL F+P   + R+ E+L   + ++  +I+EF+I+ +        K L
Sbjct: 36  RADAKENEKKLLSTLEFFPGGDSIRNCELLDVDIGNK-QHIHEFSIQNIESCSRDYCKDL 94

Query: 142 IFVHGYGAGLGFFLKNFEN---IPLLNNNWCIHAIDLPGYGFSSRPKFPFN--------- 189
           + VHGYGA LG F++NF+    IP +N    +HA+D+ G G SSRP+FP           
Sbjct: 95  VMVHGYGAALGLFVRNFDGLSRIPGIN----LHALDMLGCGLSSRPRFPGTGLISSVIKR 150

Query: 190 --YPEHNPIMVEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANKFPNHFSK 247
               +      E++F   ++ W  +R L       +LV HSLG Y+S  YA KFP    K
Sbjct: 151 GRVTKEEVYEAENFFIDSLEKWRQQRKL----DKFVLVGHSLGGYLSCCYALKFPERVEK 206

Query: 248 LIMCSPAGICPS---------PKLGQAP---PQWFVKLWDRNISPFS----LVRNSFHLG 291
           L++ SP G+  S         P    A    P    ++ + +  P +       +SFH+ 
Sbjct: 207 LVLVSPVGVEKSVFDLTKEHTPSHNNASELGPDLSKEVTNSSGRPTTDDPVKTSSSFHVP 266

Query: 292 SK-------------LTSGWTYR---------------------RFRQFLREGQRGYEQH 317
            +              +S WTY                       FR+F        EQ 
Sbjct: 267 DEAGNVERVPNMPWIFSSMWTYNISPFGLLRSAGPAGPLLSSRWSFRRF--SFAENTEQL 324

Query: 318 KAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNTSSFKANCDWLWLYGDED 377
              H+Y Y+IF+  GSGEY L+  L  G   R+PL  R+ +N       CD  W+YG  D
Sbjct: 325 LTFHEYCYSIFSGSGSGEYALTRILAPGVLARVPLLSRVPENL-----KCDSFWMYGSHD 379

Query: 378 WMDLRGGQRASEFLKKI--GMKSDVKVVPSAGHHLYLDNYKHFNNVVIK 424
           WM    G      + K    +K+D  VV  AGHHLYLDN + FN  + K
Sbjct: 380 WMSKEAGSVIVRQINKTKGSVKADYSVVSDAGHHLYLDNPEEFNQKLAK 428

>Kwal_14.985 s14 complement(142781..144088) [1308 bp, 435 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 244] FULL
          Length = 435

 Score =  115 bits (287), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 68/191 (35%), Positives = 100/191 (52%), Gaps = 23/191 (12%)

Query: 80  MFQENAESFQSQLLSTLPFYPSPANGRSSEILKTPVDDEGNYINEFTIKPMNPXXXXXMK 139
           M + NA   + QLLSTL F+P   + R  +IL   + D+   I+E  I+ +         
Sbjct: 35  MGKSNARENEKQLLSTLEFFPQGDSTRKCKILDVDIGDK-QTIHELEIENLKTSSRSYAN 93

Query: 140 HLIFVHGYGAGLGFFLKNFE---NIPLLNNNWCIHAIDLPGYGFSSRPKFPF-------- 188
            L+ VHGYGA LG F++NF+   ++P +     +HAID+ G G SSRPKFP         
Sbjct: 94  DLVLVHGYGAALGLFVRNFDGLSSVPGIK----LHAIDMLGCGLSSRPKFPGTGLISSLI 149

Query: 189 ---NYPEHNPIMVEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANKFPNHF 245
              N  +      ED+F   ++ W  KR +    +  +LV HSLG Y+S+ YA K+P   
Sbjct: 150 KRGNVTKEEVYEAEDFFVDSMEKWRKKRQV----EKFVLVGHSLGGYLSSCYALKYPERV 205

Query: 246 SKLIMCSPAGI 256
            KL++ SP G+
Sbjct: 206 EKLVLVSPVGV 216

 Score =  100 bits (250), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 85/160 (53%), Gaps = 18/160 (11%)

Query: 270 FVKLWDRNISPFSLVRNSFHLGSKLTSGWTYRRFRQFLREGQRGYEQHKAMHKYTYAIFN 329
           F  +W  NISPF ++R    +G  ++S W++RRF  F  + +    Q    H+Y Y +F+
Sbjct: 283 FSYMWTYNISPFGILRTLGPVGPLISSNWSFRRF-SFTDDPK----QLLTFHEYCYGVFS 337

Query: 330 KPGSGEYLLSFALKCGGDPRLPLEKRLFDNTSSFKANCDWLWLYGDEDWMDLRGGQRASE 389
             GSGEY L+  L  G   RLPL  R+  N       CD  W+YG +DWM    G   S 
Sbjct: 338 GAGSGEYALTRILAPGVLARLPLLSRMPGNL-----KCDSFWMYGSQDWMSKEAG---SV 389

Query: 390 FLKKIGM-----KSDVKVVPSAGHHLYLDNYKHFNNVVIK 424
            +KK+       K+D  +V  AGHHLYLDN + FN  ++K
Sbjct: 390 MVKKLNESPGLGKADFSIVSDAGHHLYLDNPEEFNRKLLK 429

>Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 174] FULL
          Length = 416

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 87/336 (25%), Positives = 136/336 (40%), Gaps = 76/336 (22%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPF------------- 188
           + VHGY A    F +NF  +     +  ++AIDLP  G S  P  P              
Sbjct: 100 LLVHGYAASSMGFHRNFPGLSQSIKD--LYAIDLPASGLS--PALPLEMRCTQPLDLKIN 155

Query: 189 ------------NYPEHNPIM--VEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYIS 234
                       NY  H  ++   ED++   I+ W H   L   P N  +VAHS G Y+S
Sbjct: 156 MSKDTFSLPYTINYLHHKSLIQNYEDYYLDAIEQWRHDNKL--GPIN--IVAHSFGGYLS 211

Query: 235 ALYANKFPNHFSKLIMCSPAGI----------------------CPSPKL----GQAPPQ 268
             YA KFP+   KL + SP G+                       P+ K     G A P+
Sbjct: 212 FKYAVKFPHAVEKLCLVSPLGVERNIFSVNNQWRSNTSYNLDFENPASKFYIKKGPAIPR 271

Query: 269 WFVKLWDRNISPFSLVRNSFHLGSKLTSGWTYRRFRQFLREGQRGYEQHKAMHKYTYAIF 328
              +          L+RN   LG+KL+  W Y     + R     Y+++     Y     
Sbjct: 272 LVFE------QQTQLLRNLGPLGAKLS--WNYIN-AAYSRVPSLDYKKYVFELLYGKNGL 322

Query: 329 NKPGSGEYLLSFALKCGGDPRLPLEKRLFDNTSSFKANCDWLWLYGDEDWMDLRGGQRAS 388
           N+     ++  F      + R+     L D+   F  +   + +YGD DWM+ R G    
Sbjct: 323 NQTSKDLFIGLF------NNRVLARDPLLDSIQFFGKSAKLMCIYGDHDWMNRRAGMEMV 376

Query: 389 EFLKKIGMKSDVKVVPSAGHHLYLDNYKHFNNVVIK 424
               ++G+++    V S+GH+L+LDN + FN+ +++
Sbjct: 377 NEANQLGIEAKYNEVSSSGHNLFLDNPEEFNDKLVR 412

>Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 85/341 (24%), Positives = 136/341 (39%), Gaps = 74/341 (21%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFP-----------FNY 190
           + +HGY A    F + F+N  L +N   ++AIDLP  G S  P              F +
Sbjct: 74  VLIHGYAASSMAFYRTFKN--LSDNIKDLYAIDLPANGASEAPALQVEGVKKIKSLRFKH 131

Query: 191 PEHN---PIM---------------VEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAY 232
            E +   P++                E +F  RI+ W     L    +   +V HS G Y
Sbjct: 132 VEDDMVTPVLDKRPPAEEIKSHLEQYESYFVDRIEQWRKDNNL----RKINVVGHSFGGY 187

Query: 233 ISALYANKFPNHFSKLIMCSPAGICPSP-------KLGQAPPQWFV----KLWDRNIS-P 280
           IS  YA K+PN   KL + SP G+  S        +     P  F     + + R ++ P
Sbjct: 188 ISFKYALKYPNSIDKLCLISPLGVENSIHAINHKWEANTTYPVTFTDPSSRYYTRKLNVP 247

Query: 281 FSLVRNSFH-------LGSKLTSGWTYRRFRQFLREGQRGYEQH------KAMHKYTYAI 327
             +  N  +       +GSKL S +    + +   +  + Y  H      +++   T  +
Sbjct: 248 QFIFENQLNVLKWMGPIGSKLCSSYISTAYVKVPDQLYKDYLLHSFVGKNQSVQPQTIKV 307

Query: 328 FNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNTSSFKANCDWLWLYGDEDWMDLRGGQRA 387
           F +      L    L    DP       + +N          +++YG+ DWMD   G   
Sbjct: 308 FTQ------LFERNL-IARDP-------IINNVGLLNPATHVMFMYGEHDWMDKYAGYLT 353

Query: 388 SEFLKKIGMKSDVKVVPSAGHHLYLDNYKHFNNVVIKEMEK 428
           +E + K   K+    VP AGH+L+LDN  HF + ++  + K
Sbjct: 354 TESMLKNKAKASYMEVPDAGHNLFLDNPNHFTSSLVSFLSK 394

>YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON}
           ICT1Lysophosphatidic acid acyltransferase, responsible
           for enhanced phospholipid synthesis during organic
           solvent stress; null displays increased sensitivity to
           Calcofluor white; highly expressed during organic
           solvent stress
          Length = 394

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 83/335 (24%), Positives = 131/335 (39%), Gaps = 62/335 (18%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFP-----------FNY 190
           + +HGY A    F + FEN  L +N   ++AIDLP  G S  P              F +
Sbjct: 74  VLIHGYAASSMAFYRTFEN--LSDNIKDLYAIDLPANGASEAPALQVNKTKKIKSLRFKH 131

Query: 191 PEHNPIM------------------VEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAY 232
            E + ++                   E +F  RI+ W     L    +   +V HS G Y
Sbjct: 132 IEDDVVIPVIEKRPPAEDIKSHLEQYESYFVDRIEQWRKDNKL----RKINVVGHSFGGY 187

Query: 233 ISALYANKFPNHFSKLIMCSPAGICPSPKL-------GQAPPQWFV----KLWDRNIS-P 280
           IS  YA K+P+   KL + SP G+  S              P  F     + + R ++ P
Sbjct: 188 ISFKYALKYPDSIEKLCLISPLGVENSIHAITHKWEPNTTYPLTFTDPSSRYYTRKLNVP 247

Query: 281 FSLVRNSFH-------LGSKLTSGWTYRRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGS 333
             +  N  +       +GSKL S +    + +   +  + Y  H  + K           
Sbjct: 248 RFIFENQLNVLKWMGPIGSKLCSNYISTAYVKVPDQIYKDYLLHSFVGKNQTVQPQTIKV 307

Query: 334 GEYLLSFALKCGGDPRLPLEKRLFDNTSSFKANCDWLWLYGDEDWMDLRGGQRASEFLKK 393
             +L    L    DP       + +N          +++YG+ DWMD   G   +E + K
Sbjct: 308 FTHLFERNL-IARDP-------IINNVRFLNPATPVMFMYGEHDWMDKYAGYLTTESMLK 359

Query: 394 IGMKSDVKVVPSAGHHLYLDNYKHFNNVVIKEMEK 428
              K+    VP AGH+L+LDN +HF + ++  + K
Sbjct: 360 NKAKASYVEVPDAGHNLFLDNPQHFASSLVSFLSK 394

>Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 77.4 bits (189), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 83/335 (24%), Positives = 131/335 (39%), Gaps = 62/335 (18%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFP-----------FNY 190
           + +HGY A    F + FE+  L +N   ++AIDLP  G S  P              F +
Sbjct: 74  VLIHGYAASSMAFYRTFES--LSDNIKDLYAIDLPANGASQAPALQVDKTKKIKPLRFKH 131

Query: 191 PEHNPIM------------------VEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAY 232
            E + ++                   E++F  RI+ W     L    +   +V HS G Y
Sbjct: 132 IEDDVVVPVLDKHPPAEDIKSHLEQYENYFVDRIEQWRKDNKL----RRINVVGHSFGGY 187

Query: 233 ISALYANKFPNHFSKLIMCSPAGICPSPKL-------GQAPPQWFV----KLWDRNIS-P 280
           IS  YA K+PN   KL + SP G+  S              P  F     + + R ++ P
Sbjct: 188 ISFKYALKYPNSIDKLCLISPLGVENSIHAIAHKWEPNTTYPLTFTDPSSRYYTRKLNVP 247

Query: 281 FSLVRNSFH-------LGSKLTSGWTYRRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGS 333
             +  N  +       +GSKL S +    + +   +  + Y  H  + K           
Sbjct: 248 QFIFENQLNVLKWMGPIGSKLCSNYISTAYVKVPDQLYKDYLLHSFVGKNQTVQPQTIKV 307

Query: 334 GEYLLSFALKCGGDPRLPLEKRLFDNTSSFKANCDWLWLYGDEDWMDLRGGQRASEFLKK 393
             +L    L    DP       + +N          +++YG+ DWMD   G   +E + K
Sbjct: 308 FTHLFERNL-IARDP-------IINNVGLLNPATHVMFMYGEHDWMDKYAGYLTTESMLK 359

Query: 394 IGMKSDVKVVPSAGHHLYLDNYKHFNNVVIKEMEK 428
              K+    VP AGH+L+LDN  HF + ++  + K
Sbjct: 360 NKAKASYVEVPDAGHNLFLDNPHHFTSSLVSFLSK 394

>Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 82/324 (25%), Positives = 125/324 (38%), Gaps = 62/324 (19%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRP-----------KFPFNY 190
           + +HGY A    F + FE+  L NN   ++AIDLP  G S  P              F +
Sbjct: 74  VLIHGYAASSMAFYRTFES--LSNNIKDLYAIDLPANGASEAPVLQVDKTKKVKSLRFKH 131

Query: 191 PEHNPIM------------------VEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAY 232
            E + ++                   E++F  RI+ W     L    +   +V HS G Y
Sbjct: 132 IEDDVVIPVLDRRPPAEDIKSHLEQYENYFVDRIEQWRKDNKL----RKINVVGHSFGGY 187

Query: 233 ISALYANKFPNHFSKLIMCSPAGICPSPKL-------GQAPPQWFV----KLWDRNIS-P 280
           IS  YA K+PN   KL + SP G+  S              P  F     + + R ++ P
Sbjct: 188 ISFKYALKYPNSIDKLCLISPLGVENSIHAITHKWEPNTTYPLTFTDPSSRYYTRKLNVP 247

Query: 281 FSLVRNSFH-------LGSKLTSGWTYRRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGS 333
             +  N  +       +GSKL S +    + +   +  + Y  H  + K           
Sbjct: 248 RFIFENQLNVLKWMGPIGSKLCSNYISTAYVKVPDQIYKDYLLHSFVGKNQTVQPQTIKV 307

Query: 334 GEYLLSFALKCGGDPRLPLEKRLFDNTSSFKANCDWLWLYGDEDWMDLRGGQRASEFLKK 393
             +L    L    DP       + +N          +++YG+ DWMD   G   +E + K
Sbjct: 308 FTHLFERNL-IARDP-------IINNVGLLNPTMHVMFMYGEHDWMDKYAGYLTTESMLK 359

Query: 394 IGMKSDVKVVPSAGHHLYLDNYKH 417
              K+    VP AGH+L+LDN  H
Sbjct: 360 NKAKASYIEVPDAGHNLFLDNPHH 383

>KNAG0G02140 Chr7 complement(484440..485666) [1227 bp, 408 aa] {ON} 
          Length = 408

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 82/338 (24%), Positives = 125/338 (36%), Gaps = 74/338 (21%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKF--------PFNYPE- 192
           + +HGY A    F  N   +    ++ C+  +DLP  G S  P          P ++ E 
Sbjct: 84  VLIHGYAASSMAFHLNVAGLSNAFSDLCV--VDLPANGLSREPPMLGPKVKGQPVHWKEL 141

Query: 193 -----------------------HNPIMVEDWFHQRIKGWLHKRGLLANPKNNLLVAHSL 229
                                   +P + ED+F  RI+ W    G      N  +V HS 
Sbjct: 142 DKKTGSLTVVCEPPSKMSSSGVLDDPGVYEDYFVDRIEKWRLAHGF----DNINVVGHSF 197

Query: 230 GAYISALYANKFPNHFSKLIMCSPAGICPSPKLGQAPPQWFV-KLWDRN---------IS 279
           G Y+S  YA K+  H  KL++ SP G+     +     +W V K +D             
Sbjct: 198 GGYMSFKYAIKYSKHVDKLVLLSPLGV--ERNIDSVSNKWDVGKTYDLTDIDATSPLYYR 255

Query: 280 PFSL-----------VRNSFHLGSKLTSGWTYRRFRQFLREGQRGYEQHKAMHKYTYAIF 328
           PF++           +R    LG+ +       R+         G   H  +H   Y   
Sbjct: 256 PFTVPGYLFNNQLNVLRKMGPLGNHMAKRAIASRYSNV-----PGTAYHAYLHHVFYGAH 310

Query: 329 NKPGSGEYLLSFALKCGGDPRLPLEKRLFDNTSSFKANCDWLWLYGDEDWMDLRGGQRAS 388
             P +     +         R PL     DN    K N   + +YGD DWM+   G    
Sbjct: 311 TFPSANITAFTHLFTRQLLARDPL----LDNIQRLKVN-KLMMVYGDHDWMNKEAGYGMV 365

Query: 389 EFLKK---IGMKSDVKVVPSAGHHLYLDNYKHFNNVVI 423
           + + K   +  K+    +PSAGH+L+LDN   FN ++I
Sbjct: 366 QEINKERYVPAKAVYAELPSAGHNLFLDNPSGFNKLLI 403

>Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON}
           YDR125C (REAL)
          Length = 446

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 86/332 (25%), Positives = 134/332 (40%), Gaps = 68/332 (20%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNW-CIHAIDLPGYGFSSRPKFPFNYPEHNPI---- 196
           + +HGY A     +  F N P L+ +   +++IDLP  G SS P    N     P+    
Sbjct: 123 LLIHGYAASS---MSYFRNYPGLSKHIRDLYSIDLPASGLSSIPSLEINATTPLPLDIKF 179

Query: 197 ----------------------MVEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYIS 234
                                 M ED++  RI+ W     L    K N+ V HS GAY+S
Sbjct: 180 IGKNKFKIPYTINANHHKFVIQMFEDFYLDRIEQWRIDNKL---GKMNI-VGHSFGAYLS 235

Query: 235 ALYANKFPNHFSKLIMCSPAGICPSPKLGQAPPQWFVKLWDRNISPFSLV----RNSFHL 290
             YA K+PN   KL + SP G+  +         W V    R+ SP+++      + F+ 
Sbjct: 236 FKYAVKYPNSVEKLCLVSPLGVERNI--------WSVNNNFRSNSPYTIDFENPSSKFYS 287

Query: 291 GSKLTSGWTYRRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGS---GEYLLSFALKCGGD 347
              +   + +++  Q LR    G    K    Y  A +++  S    EY+       GG 
Sbjct: 288 KRNIIPRYLFQQQFQILR--MMGPLGAKLCWNYILAAYSRVPSLAYKEYIFELFYGKGGI 345

Query: 348 PRLPLE-------------KRLFDNTSSFKANCDWLWLYGDEDWMDLRGGQRASEFLKKI 394
           P +  E               L D+ +S       L +YG  DWM+   G    + L  +
Sbjct: 346 PAVTTEIFEGLFSRSILARDPLMDSLNSLNVR-KLLVVYGQYDWMNKNAGMLMVKELNNL 404

Query: 395 G---MKSDVKVVPSAGHHLYLDNYKHFNNVVI 423
           G    K+    +P +GH+L+LDN + FN  ++
Sbjct: 405 GDHFEKATYTEIPFSGHNLFLDNPESFNQSIV 436

>Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {ON}
           complement(108945..110234) [1290 nt, 430 aa]
          Length = 429

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 94/361 (26%), Positives = 147/361 (40%), Gaps = 97/361 (26%)

Query: 131 NPXXXXXMKHLIFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNY 190
           NP         + +HGY A    + + F  +     N  ++AIDLP +G S+ P  P ++
Sbjct: 92  NPEASLVDTPTLLIHGYAASSLAYFRTFSGLSDKIKN--LYAIDLPSFGLSNAP--PLDF 147

Query: 191 PEH-NPIMV-----------------------------EDWFHQRIKGWLHKRGLLANPK 220
            E  + I +                             ED++ ++I+ W     L    K
Sbjct: 148 KEKVSDIKIKLSDDNTKFKISDSNRVDSLDLKKLIGKYEDYYVEKIEDWRKANKL---EK 204

Query: 221 NNLLVAHSLGAYISALYANKFPNHFSKLIMCSPAGICPSP---------------KLGQA 265
            NL V HS G YIS  YA K+P+  ++L + SP G+  +                 L   
Sbjct: 205 INL-VGHSFGGYISFKYAIKYPDAINRLCLVSPLGMESNIHSVNNNFETKKEYPLDLEDP 263

Query: 266 PPQWFVKLWDRNISPFSLVRNSFH-------LGSKLTSGW---TYRR-----FRQFLREG 310
             +++ K  +R I  F L +N  +       +GSKL   +   +YRR     F+++L E 
Sbjct: 264 SSRFYAK--ERRIPNF-LFKNQLNVLRWMGPIGSKLCWNYINASYRRVPNPLFKEYLFEL 320

Query: 311 QRGYEQHKAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNTSSFKANCDWL 370
             G      M   T  IF        L + +L    DP       + D+ S  KA    L
Sbjct: 321 LYG---KGGMPSVTIDIFTN------LFTRSL-LARDP-------IMDSISKLKAE-KVL 362

Query: 371 WLYGDEDWMDLRGGQRASEFLKKIGMKSDVKV--------VPSAGHHLYLDNYKHFNNVV 422
            LYG+ DWM+   G    E L ++   +++          VP AGH+L+LDN + FN+ V
Sbjct: 363 LLYGEHDWMNNLAGYNMVESLNQLKPNNNISTIDYANYVEVPDAGHNLFLDNPQFFNSAV 422

Query: 423 I 423
           +
Sbjct: 423 L 423

>Suva_2.288 Chr2 complement(496577..497884) [1308 bp, 435 aa] {ON}
           YDR125C (REAL)
          Length = 435

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 90/338 (26%), Positives = 137/338 (40%), Gaps = 66/338 (19%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRP----------------- 184
           + +HGY A    + +N+  +     N  +++IDLP  G SS P                 
Sbjct: 112 LLIHGYAASSMSYFRNYSGLSKHFQN--LYSIDLPASGLSSIPPLEVNTTTPLPLDIKFI 169

Query: 185 -----KFPF--NYPEHNPI--MVEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISA 235
                K P+  N   H  +  M ED++  RI+ W     L    K N+ V HS G Y+S 
Sbjct: 170 GKNKFKIPYTINASHHKFVIQMFEDFYIDRIEQWRIDNKL---DKMNI-VGHSFGGYLSF 225

Query: 236 LYANKFPNHFSKLIMCSPAGICPSPKLGQAPPQWFVKLWDRNISPFSLVRNSFHL-GSKL 294
            YA K+PN   KL + SP G+  +         W V   + N+S  +L    F    SK 
Sbjct: 226 KYAVKYPNSVEKLCLVSPLGVERNI--------WSV---NNNLSSNTLYTTDFKDPSSKF 274

Query: 295 TSGW----TYRRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGS---GEYLLSFALKCGGD 347
            S       Y    QF      G    K    Y  A +++  S    EY+       GG 
Sbjct: 275 YSKGHLIPKYLFEEQFKLLRLMGPLGAKVCWNYIMAAYSRVTSLAFKEYIFELFYGKGGI 334

Query: 348 PRLPLE--KRLFD----------NTSSFKANCDWLWLYGDEDWMDLRGGQRASEFLKKIG 395
           P +  +  K LF           ++ ++      L +YG  DWM+   G    E + K+G
Sbjct: 335 PEVTTDIFKGLFSRSILARDPILDSLNYLNVKKLLVVYGQYDWMNKNAGMLLVENVNKLG 394

Query: 396 ---MKSDVKVVPSAGHHLYLDNYKHFNNVVIKEMEKMS 430
               ++    VPS+GH+L+LDN + FN  ++  + + S
Sbjct: 395 NGLERASYLEVPSSGHNLFLDNPESFNQSIVSFLSEKS 432

>Smik_4.371 Chr4 complement(662692..663999) [1308 bp, 435 aa] {ON}
           YDR125C (REAL)
          Length = 435

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 86/341 (25%), Positives = 129/341 (37%), Gaps = 86/341 (25%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPI----- 196
           + +HGY A    F +N+  +     N  +++IDLP  G SS P    N     P+     
Sbjct: 112 LLIHGYAASSMSFFRNYPGLSKHIQN--LYSIDLPASGLSSIPPLEINATTPLPLDIEFT 169

Query: 197 ---------------------MVEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISA 235
                                M ED++  +I+ W     L    K N+ V HS G Y+S 
Sbjct: 170 GKNKFKIPYTINLNHHKFVIQMYEDFYLDKIEQWRIDNKL---GKVNI-VGHSFGGYLSF 225

Query: 236 LYANKFPNHFSKLIMCSPAGICPSPKLGQAPPQWFVKLWDRNISPFSLVRNSFHLGSKLT 295
            YA K+PN   KL + SP G+                  +RNI     + N+F   +  T
Sbjct: 226 KYAAKYPNSVEKLCLVSPLGV------------------ERNIWS---INNNFRSNTLYT 264

Query: 296 SGWT---------------YRRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGS---GEYL 337
            G+                Y   RQF      G    K    Y  A +++  S    EY+
Sbjct: 265 IGFEDPSSKFYSKRNMIPKYLFERQFQLLRMMGPVGAKLCWNYIMAAYSRVPSLAYKEYI 324

Query: 338 LSFALKCGGDPRLPLE--KRLFD----------NTSSFKANCDWLWLYGDEDWMDLRGGQ 385
                  GG P +  E  K LF           ++  +      + +YG  DWM+ + G 
Sbjct: 325 FELFYGKGGIPEVTTEIFKGLFSRCILAKDPLMDSLHYLNVRKLMVVYGQYDWMNKKAGM 384

Query: 386 RASEFLKKIG---MKSDVKVVPSAGHHLYLDNYKHFNNVVI 423
              E L  +G    K+    +PS+GH+L+LDN   FN  ++
Sbjct: 385 LMVENLNSLGNCLEKASYLEIPSSGHNLFLDNPLSFNQSIV 425

>KLTH0G13178g Chr7 (1131579..1132826) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 415

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 84/346 (24%), Positives = 134/346 (38%), Gaps = 99/346 (28%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWCI---HAIDLPGYGFSSRPKFPFNYPEHNPIMV 198
           + +HGY A    F +NFE +     + CI   +AIDLP  G S          E  P+ +
Sbjct: 100 LLLHGYAASSMAFHRNFEGL-----SKCIRDLYAIDLPANGLSPPQPLEIRCTEPQPLKI 154

Query: 199 E-------------------------DWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYI 233
           E                         D++   ++ W     L   P N  +VAHS G YI
Sbjct: 155 EISNDTFKLPYTINSLHHKSAIQNFEDYYLDALEQWRLDNKL--GPIN--IVAHSFGGYI 210

Query: 234 SALYANKFPNHFSKLIMCSPAGI----------------------CPSPKL----GQAPP 267
           S  YA K+P+   +L + SP G+                       P+ K     G A P
Sbjct: 211 SFRYAVKYPHAVKRLCLLSPLGVERNIFSVNNNWRSNTQYKLDFENPASKFYIRKGPAIP 270

Query: 268 QWFVKLWDRNISPFSLVRNSFHLGSKLTSGWTY----------RRFRQFLREGQRGYEQH 317
               +L  +      ++R    LG++L   W Y           +++Q++ E   G    
Sbjct: 271 PAIFELQTK------VLRGLGPLGARLC--WNYITAAYARVPSLKYKQYIFEMFYG---K 319

Query: 318 KAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNTSSFKANCDWLWLYGDED 377
            A+ + +  IF    +   L         DP       L D+    ++    L +YGD D
Sbjct: 320 NALTQTSKDIFTGLFTNRLL-------ARDP-------LLDSLCHVRSK-KLLLMYGDHD 364

Query: 378 WMDLRGGQRASEFLKKIGMKSDVKVVPSAGHHLYLDNYKHFNNVVI 423
           WM+ + G       KK+G+ +    V S+GH+L+LDN +  N +++
Sbjct: 365 WMNRKAGLEMVTEAKKLGIDAQYGEVSSSGHNLFLDNPEESNELIV 410

>YDR125C Chr4 complement(701397..702758) [1362 bp, 453 aa] {ON}
           ECM18Protein of unknown function, similar to Rlp24p
          Length = 453

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 81/333 (24%), Positives = 128/333 (38%), Gaps = 70/333 (21%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPI----- 196
           + +HGY A    F +N+  +     N  +++ID+P  G SS P    N     P+     
Sbjct: 130 LLIHGYAASSMSFFRNYPGLSKHIRN--LYSIDMPASGLSSVPSLEINTTTPLPLDIKFI 187

Query: 197 ---------------------MVEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISA 235
                                M ED++  RI+ W     L    K N+ V HS G Y+S 
Sbjct: 188 GENKFKVPYTINANHNKFVIQMYEDFYLDRIEQWRIDNKL---GKMNV-VGHSFGGYLSF 243

Query: 236 LYANKFPNHFSKLIMCSPAGI---------------CPSPKLGQAPPQWFVKLWDRNISP 280
            YA K+PN  +KL + SP G+                 +        +++ K   RN+ P
Sbjct: 244 KYAVKYPNSVNKLCLVSPLGVERNIWSVNNNFHSNTLYTIDFKNPNSKFYSK---RNMIP 300

Query: 281 FSLVRNSFH-------LGSKLTSGWTYRRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGS 333
             L    FH       LG+KL   W Y     + R     Y++      Y + +F   G 
Sbjct: 301 KYLFEQQFHILRMMGPLGAKLC--WNYI-MAAYSRVPSLAYKE------YIFELFYGKGG 351

Query: 334 GEYLLSFALKCGGDPRLPLEKRLFDNTSSFKANCDWLWLYGDEDWMDLRGGQ---RASEF 390
              + +   K      +  +  L D+          L +YG  DWM+ + G    +    
Sbjct: 352 IPEVTTDIFKALFSRCILAKDPLMDSLQYLNVK-KLLIVYGQYDWMNKKAGMFMVKELNN 410

Query: 391 LKKIGMKSDVKVVPSAGHHLYLDNYKHFNNVVI 423
           LK     +    +PS+GH+L+LDN + FN  ++
Sbjct: 411 LKNCLEGASYLEIPSSGHNLFLDNPESFNQSIV 443

>TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {ON}
           Anc_8.284 YDR125C
          Length = 434

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 83/340 (24%), Positives = 131/340 (38%), Gaps = 71/340 (20%)

Query: 131 NPXXXXXMKHLIFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFN- 189
           NP         + +HGY A    + +NF  +     +  ++AIDLP  G S+   F  N 
Sbjct: 105 NPAATAITTPTLLIHGYAASSMAYYRNFTGLSQTVTD--LYAIDLPANGLSAEQPFKLNG 162

Query: 190 ---------YPEHNPIMV----------------EDWFHQRIKGWLHKRGLLANPKNNLL 224
                    Y +++   V                E ++  +I+ W   R +    K NL 
Sbjct: 163 DKPRSLKVKYLDNDKFSVQHVIDESGTKQMIQQCESYYLDKIEEW---RKVNKLEKINL- 218

Query: 225 VAHSLGAYISALYANKFPNHFSKLIMCSPAGICPSPKLGQAPPQWFVKLWDRNISPFSLV 284
           V HS G Y+S  YA K+PN   KL + SP G+  S             ++  N       
Sbjct: 219 VGHSFGGYLSFKYALKYPNSIEKLCLVSPLGVETS-------------IYSVNNKLEKNT 265

Query: 285 RNSFHLGSKLTSGWTYRR-FRQFLREGQR------GYEQHKAMHKYTYAIFNKPGSGEYL 337
           + +  L    ++ +T RR   +F+ + Q       G    K    Y  + +++    EY 
Sbjct: 266 KYALDLEDPTSNFYTRRREIPKFIFKNQSEILRWMGPLGAKMCWNYILSAYSRIPEMEYK 325

Query: 338 -LSFALKCGGDPRLPLEKRLF---------------DNTSSFKANCDWLWLYGDEDWMDL 381
              F L  G     P  +++F               D+    +A    L +YGD DWM+ 
Sbjct: 326 SYIFELLYGKGGIAPTARQIFTNLFTRNLLAKDPIMDSLGQLQAK-KVLLVYGDHDWMNK 384

Query: 382 RGGQRASEFLKKIGMKSDVKV--VPSAGHHLYLDNYKHFN 419
             G +  E L  I   +  +   VP +GH+L+LDN   FN
Sbjct: 385 YAGYKLVERLNTIRNNTSAQYIEVPESGHNLFLDNPTFFN 424

>TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.284
           YDR125C
          Length = 405

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 84/353 (23%), Positives = 136/353 (38%), Gaps = 88/353 (24%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFP-------------- 187
           + VHGY      + +NF  +     +  +++IDLP +G S  P+ P              
Sbjct: 65  LLVHGYATSSLAYYRNFAGLSSYIKD--LYSIDLPTFGLSKTPELPTRKVTKNLKVTLSN 122

Query: 188 ---------------------------FNYPEHNPIMVEDWFHQRIKGWLHKRGLLANPK 220
                                      +N  +    + E+++  RI+ W  +  L    K
Sbjct: 123 SNDKSDDPKKITSFQLSKDDIKHNEKYYNETKKELEINENYYIDRIEKWRIENKL---DK 179

Query: 221 NNLLVAHSLGAYISALYANKFPNHFSKLIMCSPAGICPSP-------------KLGQAPP 267
            NL V HS G Y+S  YA K+P+   KL + SP G+  +              ++ +  P
Sbjct: 180 INL-VGHSFGGYLSYKYATKYPDSIEKLCLVSPLGMESNIYSINNKFENDKIYEIEEEDP 238

Query: 268 QWFVKLWDRNISPFSLVRNSFHL-------GSKLTSGWTYRRFRQFLREGQRGYEQHKAM 320
                   R I  F L  N  ++       GS LT  W Y +   + R     Y+ +  +
Sbjct: 239 SSIFFTNTRTIPKF-LFNNQLNVLRWLGPVGSTLT--WKYIK-ASYRRVDDALYKDY--I 292

Query: 321 HKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNTSSFKANCDWLWLYGDEDWMD 380
           H+    I+ K G  E  +          +L  +  + D     KA  + L LYG EDWM+
Sbjct: 293 HE---LIYGKGGMEETTIK-TFTNLFTTKLLAKDPITDTVDKLKAK-NVLLLYGQEDWMN 347

Query: 381 LRGGQRASEFLKKIGMKSDVKV----------VPSAGHHLYLDNYKHFNNVVI 423
              G + ++ L ++   +  KV          VP AGH+L+LDN   FN  ++
Sbjct: 348 NYAGYQMTKKLNELKGYNTSKVGELNYATYMEVPEAGHNLFLDNPSFFNKALL 400

>KNAG0H03120 Chr8 (586146..587450) [1305 bp, 434 aa] {ON} Anc_8.284
           YDR125C
          Length = 434

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 81/339 (23%), Positives = 139/339 (41%), Gaps = 76/339 (22%)

Query: 141 LIFVHGYGAGLGFFLKNFENIPLLNNNWC--IHAIDLPGYGFS----------------- 181
           ++ +HGY +    + +NF  +    ++ C  ++AIDLP  G S                 
Sbjct: 111 VLLIHGYASSSMSYFRNFRGL----SSQCKDVYAIDLPANGLSREISLSEDADLKDLVKY 166

Query: 182 --------SRPKFPFNYPEHNPI------MVEDWFHQRIKGWLHKRGLLANPKNNL-LVA 226
                   S  +     P +N +      ++ED++   I+ W      + N  + L LV 
Sbjct: 167 SLQVKGLDSPGQVKVTKPYNNKLCATQLRILEDYYVDEIERWR-----VENQIDQLHLVG 221

Query: 227 HSLGAYISALYANKFPNHFSKLIMCSPAGI----------CPSPKLGQ------APPQWF 270
           HS G YIS  YA K+P +  KL + SP G+           P   + Q      + P + 
Sbjct: 222 HSFGGYISYKYALKYPQNVMKLALISPLGVERNLYSVNNHLPQDSIVQGTFEDPSSPSYL 281

Query: 271 VKL-WDRNI--SPFSLVRNSFHLGSKLTSGWTYRRFRQFLREGQRGYEQHKAMHKYTYAI 327
            KL   R I  +   ++R    +G++L   W Y     + +   R ++++     Y    
Sbjct: 282 RKLEVPRYIFENQLKILRWGGPMGARLC--WNYIT-SAYAKVPSREFKEYLFELFYGDGG 338

Query: 328 FNKPGSGEYLLSFALKC-GGDPRLPLEKRLFDNTSSFKANCDWLWLYGDEDWMDLRGGQR 386
             K     ++L F       DP       + D+ +  K   D ++ YG  DWM+   G R
Sbjct: 339 ITKTALTTFILLFTRNLLARDP-------IMDSIAELKVK-DVMFQYGQYDWMNKNAGAR 390

Query: 387 ASEFLKKIGMKSDVKV--VPSAGHHLYLDNYKHFNNVVI 423
           A+E L+K    +      +P +GH+L+LD+ + FN  +I
Sbjct: 391 AAELLRKQPYNNSALYLEIPESGHNLFLDSPQSFNFSLI 429

>NCAS0B05120 Chr2 complement(953798..954988) [1191 bp, 396 aa] {ON} 
          Length = 396

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 67/272 (24%), Positives = 112/272 (41%), Gaps = 40/272 (14%)

Query: 178 YGFSSRPKFPFNYPEHNPIM--VEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISA 235
           Y F   P   ++      ++  +E+++   I+ W  +R      K NL V HS G Y+S 
Sbjct: 137 YVFKVAPPHAYDAQREKQVIDKLENYYLDVIEKW--RRANYGLDKFNL-VGHSFGGYLSF 193

Query: 236 LYANKFPNHFSKLIMCSPAGICPSPK----LGQAPPQWFVKLWD--------RNISPFSL 283
            YA K+P    KL + SP G+  + +    +     ++ + L +        + + P  L
Sbjct: 194 KYAIKYPEVVDKLCLVSPLGVASNIRSVNNVFDTKKEYVMDLQNPGSMLYNRQRMIPNFL 253

Query: 284 VRNSFHL-------GSKLTSGWTYRRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGSGEY 336
             N  ++       GSKLT  +    + +      + Y        Y Y     P     
Sbjct: 254 FNNQLNVLKWMGPVGSKLTRKYINSAYVKVPTMDYKDYL-------YEYFQMGVPQVNVD 306

Query: 337 LLSFALKCGGDPRLPLEKRLFDNTSSFKANCDWLWLYGDEDWMDLRGGQRASEFLKKIGM 396
           + +         R P+     DN +  K+   ++ +YGD DWMD   G    + + KI  
Sbjct: 307 IFTKLFSRNLMARDPI----MDNMNRLKS-TRFMMMYGDNDWMDKFSGYTLVQNINKIKN 361

Query: 397 KSDVKV----VPSAGHHLYLDNYKHFNNVVIK 424
             D K     +P AGH+L+LDN + F+N +IK
Sbjct: 362 NFDRKATYVEIPDAGHNLFLDNPEDFSNNLIK 393

>KAFR0B02830 Chr2 complement(578530..579705) [1176 bp, 391 aa] {ON}
           Anc_8.284 YDR125C
          Length = 391

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 88/346 (25%), Positives = 128/346 (36%), Gaps = 51/346 (14%)

Query: 119 GNYINEFTIKPMNPXXXXXMKHLIFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGY 178
            N INE+     NP         + +HGY A    F + F  +    +   ++AIDLPG 
Sbjct: 51  NNEINEWHFH--NPNASKIKTPTLLIHGYAASSMAFHRTFNRLS--TDIKDLYAIDLPGN 106

Query: 179 GFSSRPKFP--------------------------FNYPEHNPIMVEDWFHQRIKGWLHK 212
           G SS P+                                + N    E+++  RI  W   
Sbjct: 107 GLSSAPELSDVIKMKDLKITLNKSKDGFTLKKAIDLEIEKANLAKYENYYLSRIDEWRKF 166

Query: 213 RGLLANPKNNLLVAHSLGAYISALYANKFPNHFSKLIMCSPAGICPSPKLGQAPPQWFVK 272
            G+    K N+ + HS G +IS  YA   PN  + LI+ SP G+  +        +   K
Sbjct: 167 HGI---EKLNV-IGHSFGGFISFKYAITHPNQVNDLILVSPLGMEKNIHSLNNNFELETK 222

Query: 273 LWDRNISPFSLV-RNSFHLGSKLTSG------WTY----RRFRQFLREGQRGYEQHKAMH 321
                 +P SL    SF++ S L +       W      R  RQ++    +      A  
Sbjct: 223 YTLDFENPASLYYARSFNVPSILFNNQLNILRWMGPLGGRMARQYIDMAYKKVPD-VAYK 281

Query: 322 KYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNTSSFKANCDWLWLYGDEDWMDL 381
            Y Y +F    S   +            L     + DN    +A    L +YG+ DWMD 
Sbjct: 282 NYLYYVFYDGKSFPKVTINNFTNMFSKNLLARDPIMDNLLKLRAKKVML-VYGEHDWMDK 340

Query: 382 RGGQRASEFLKKIGMKSDVKV----VPSAGHHLYLDNYKHFNNVVI 423
             G    E L K   K    V    +P AGH+L+LDN   F+  V+
Sbjct: 341 YAGYNMVELLSKSNYKLKDTVHYVEIPDAGHNLFLDNPTDFSENVV 386

>KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]
           {ON} similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125C ECM18 Protein of unknown function, similar to
           Rlp24p
          Length = 409

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 91/359 (25%), Positives = 143/359 (39%), Gaps = 83/359 (23%)

Query: 122 INEFTIKPMNPXXXXXMKHLIFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFS 181
           IN++ I   NP         + +HGY A    F +NFE + L   +  ++A+DLPG G S
Sbjct: 72  INQWRIS--NPTAKAVGVPTLMIHGYAASSMTFFRNFEQLSLSLKD--VYAVDLPGNGLS 127

Query: 182 SR-----------PKFPFN-------YPEHNPI----------MVEDWFHQRIKGWLHKR 213
                         +  FN       +   NP+            ED++   ++ W  + 
Sbjct: 128 KELPLSVDSMQKPDRVEFNETVKGQYFRLQNPVDEEKYKKHLAHYEDYYVDALEKWRKEN 187

Query: 214 GLLANPKNNLLVAHSLGAYISALYANKFPNHFSKLIMCSPAGICPSP------------- 260
            L    K N LV HS G Y++  Y+ K+P++  KL + SP G+  S              
Sbjct: 188 KL---SKIN-LVGHSYGGYLTFKYSLKYPDNVHKLCLVSPLGVERSIFSIHNHLEPERDY 243

Query: 261 KLGQAPPQWFVKLWDRNISPFSL------VRNSFHLGSKLTSGW---TYRR-----FRQF 306
           ++    P        RNI    L      +R    LG+K   G+   +Y R     +R++
Sbjct: 244 EIQSEDPSKSNYSNKRNIPKLILQYQNKALRWMGPLGAKACWGYVNSSYGRVPSVPYREY 303

Query: 307 LREGQRGYEQHKAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNTSSFKAN 366
           + +   G      M   +  IFN+      L S +L    DP       + D+    K  
Sbjct: 304 VFQLVFG---KGIMTDTSIRIFNQ------LFSRSL-LAYDP-------IMDSLDKVKV- 345

Query: 367 CDWLWLYGDEDWMDLRGGQRASEFLKKIGMKSD--VKVVPSAGHHLYLDNYKHFNNVVI 423
              + +YG+ DWM+   G+ A E    I    D    +V  AGH+L LDN   FN+ ++
Sbjct: 346 SKLMLVYGEHDWMNKVAGRLAIEEFNSIRKSYDGTFDIVSRAGHNLVLDNPSEFNSKLV 404

>CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa]
           {ON} similar to uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 386

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 86/355 (24%), Positives = 136/355 (38%), Gaps = 92/355 (25%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRP---------KFPFNYPE 192
           + VHGYGA    + + F   PL  +   ++AIDLP  G S  P         K  F   E
Sbjct: 48  LLVHGYGASSMAYHRCF--APLSRHIRDLYAIDLPANGLSEAPPLVAEGEAPKAKFKIEE 105

Query: 193 HNPIMV----------------------------------EDWFHQRIKGWLHKRGLLAN 218
           +   +V                                  ED++ + I+ W         
Sbjct: 106 NKFTVVQGARRAAEPVTDAQVDQELMLRTHREKRRYLQQYEDYYVESIEQW--------R 157

Query: 219 PKNNL----LVAHSLGAYISALYANKFPNHFSKLIMCSPAGICPSP-------------K 261
            +NNL    LV HS G Y+S  YA K+P   +KL + SP G+  +              +
Sbjct: 158 KENNLDKFNLVGHSFGGYLSYKYALKYPESVNKLCLLSPLGMERNIHSINNTFEENVVYE 217

Query: 262 LGQAPPQWFVKLWDRNI------SPFSLVRNSFHLGSKLTSGWTYRRFRQFLREGQRGYE 315
           L ++ P  ++    R        + FS++R    +G KL   +    + +   +  + Y 
Sbjct: 218 LQESDPSSYLYTRKRKAPKFLFENQFSVLRWMGPIGDKLCLSFINSSYAKVPSQAYKDYL 277

Query: 316 QHKAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNTSSFKANCDWLWLYGD 375
               + K  +A  N   + ++L + +L    DP       + D     K   D    YGD
Sbjct: 278 FESFLGKKHFAKQN-VHALKHLFTRSL-LARDP-------IMDTIDKLKVP-DVSVFYGD 327

Query: 376 EDWMDLRGGQRASEFLKKI------GMKSDVKVVPSAGHHLYLDNYKHFNNVVIK 424
            DWM+   G    E LKK       G  +    VP AGH+L+LDN  +F+  +++
Sbjct: 328 HDWMNSYAGYLMVERLKKFRVASTSGGSASYLEVPDAGHNLFLDNPDYFSKKLVQ 382

>SAKL0H16500g Chr8 (1450828..1452087) [1260 bp, 419 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 419

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 84/343 (24%), Positives = 132/343 (38%), Gaps = 88/343 (25%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPI-MVED 200
           + +HGY A    F +NF  +     N  ++AIDLP  G S     P       P+ M  +
Sbjct: 100 LLLHGYAAASMGFHRNFAGLSSRIQN--LYAIDLPANGLSPGSSQPLVVSCGEPLPMKAE 157

Query: 201 WFHQRIK-----GWLHKRGLLANPKNNLL-----------------VAHSLGAYISALYA 238
           + + R K      +LH++  +   ++  L                 VAHS G Y+S  YA
Sbjct: 158 FSNDRFKIPYTLEYLHQKSFIQQLEDYYLNSIEQWRIDNKLNKINIVAHSFGGYLSTKYA 217

Query: 239 NKFPNHFSKLIMCSPAGICPSPKLGQAPPQWFVKLW-DRNI------------------- 278
            K+P+   +L + SP G+     +      W    W D N                    
Sbjct: 218 IKYPHAVERLCLVSPLGV--ERNIHSVNNHWCSNTWYDLNYEDPGSKYYMRRMRGIPSTV 275

Query: 279 --SPFSLVRNSFHLGSKLTSGWTY----------RRFRQFLRE---GQRGYEQHKAMHKY 323
             S   L+R    LG+KL   W Y           ++++++ E   G+ G  Q  AM  +
Sbjct: 276 FQSQVKLLRLLGPLGAKLC--WNYINAAYSRVKNEKYKEYVFELFYGKEGVTQ-TAMDIF 332

Query: 324 TYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNTSSFKANCDWLWLYGDEDWMDLRG 383
           T  +F +    +  L  +L+     RL L                    YG+ DWM+   
Sbjct: 333 T-NLFTRQLLAKDPLMDSLQHLHVGRLMLA-------------------YGEHDWMNKYA 372

Query: 384 GQRASEFLKKIGMKSDV---KVVPSAGHHLYLDNYKHFNNVVI 423
           G   ++    +  KSD     V+ S+GH+++LDN   FN  VI
Sbjct: 373 GVLMTKEFNHLRGKSDAATYTVISSSGHNMFLDNPDEFNEKVI 415

>NDAI0J01210 Chr10 (282384..283634) [1251 bp, 416 aa] {ON} Anc_8.284
          Length = 416

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 88/340 (25%), Positives = 135/340 (39%), Gaps = 86/340 (25%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFS-------------------- 181
           + +HGY A    F + F   PL NN   ++AIDLP  G S                    
Sbjct: 98  LLLHGYAASSMSFYRTFA--PLSNNFKNLYAIDLPANGLSVAIPLKITKQRKRLYEVKYK 155

Query: 182 SRPKFPFNYP----EHNPIM--VEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISA 235
              KF  +YP    E  P++   E+++   ++ W     +  N +   LV HS G Y S 
Sbjct: 156 ENNKFSISYPVPIEEQKPLIEQYENYYLDAMRSW----QVANNIEKFNLVGHSFGGYFSF 211

Query: 236 LYANKFPNHFSKLIMCSPAGICPSPKLGQAPPQWFVKLWDRNISPFSLVRNSFHLG---- 291
            YA +FP+  +KL + SP G+                  + NI  FS + N F       
Sbjct: 212 KYALRFPDSINKLCLVSPLGM------------------ESNI--FS-IHNKFEENKIYN 250

Query: 292 ---SKLTSGWTYRRFR--QFLREGQRGYEQH------KAMHKYTYAIFNKPGSGEYL-LS 339
              +  TS +  ++F+   +L E Q    +       +    Y  + + +  S EY    
Sbjct: 251 VNLTDPTSPFYGKKFQIPNYLFENQLDVIRKLGPFGARLCWNYILSAYKRVPSMEYKEYL 310

Query: 340 FALKCGGDPRLPLEKRLFDN--TSSFKA------NCDWLWL------YGDEDWMDLRGGQ 385
           F L  G     P+   LF N  T +  A      + D L L      YG+ DWM+   G 
Sbjct: 311 FELFYGNRQVSPILCELFTNLLTRNLLARDPILDSIDQLQLSNVLVMYGEHDWMNRYAGY 370

Query: 386 RASEFLKKIGMKSDVK---VVPSAGHHLYLDNYKHFNNVV 422
                L  I    +      VP+AGH+L+LDN ++F++ +
Sbjct: 371 CMVSRLNNIRRTPNTAQYLQVPAAGHNLFLDNPEYFSSAL 410

>NCAS0B03710 Chr2 (664097..665389) [1293 bp, 430 aa] {ON} Anc_8.284
          Length = 430

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 81/320 (25%), Positives = 121/320 (37%), Gaps = 62/320 (19%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKF----------PFNYP 191
           + +HGY A    F + F  +PL  +   ++A DLPG G S    F             Y 
Sbjct: 112 LLLHGYAASSLCFFRTF--VPLSRSIKNLYATDLPGNGLSKNKSFFSVMYGNEYMKVKYE 169

Query: 192 EHNPIMV----------------EDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISA 235
           E+N   +                ED++   I+ W     L   PK NL V HS G Y+S 
Sbjct: 170 ENNKFSIKYLNSLKDQTNSIKHSEDYYIDAIREWQLSNNL---PKINL-VGHSFGGYLSF 225

Query: 236 LYANKFPNHFSKLIMCSPAGICPSP-KLGQAPPQWFVKLWDRNISPFSLVRNSFHLGSKL 294
            YA ++P++ +KL + SP G+  +   +  +  + ++   D +    S    +F +   L
Sbjct: 226 KYALRYPDNVNKLCLVSPLGVESNLYSVNNSLKENYLYDVDYSDPKSSYYSRNFAIPKSL 285

Query: 295 TSGWTYRRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGS---GEYLLSFALKCGGDPRLP 351
             G       QF      G    +    Y  + + +  S    EYL  F L  G   +L 
Sbjct: 286 FEG-------QFGILRWMGPIGARVCWNYILSSYKRVPSMKYKEYL--FHLLFGNAKKLV 336

Query: 352 LEKRLFDN-------------TSSFKANCDWLW-LYGDEDWMDLRGGQRASEFLKKIGMK 397
              + F N              S  K  C+ L  +YG  DWM+   G      L      
Sbjct: 337 TSAKTFTNLFTRNLLAKDPIMDSIEKLQCEKLMVMYGQHDWMNKYAGYCLIAKLNNYRST 396

Query: 398 SDV---KVVPSAGHHLYLDN 414
            D      +P AGH+L LDN
Sbjct: 397 KDAGYFTEIPEAGHNLILDN 416

>AGR062C Chr7 complement(833212..834366) [1155 bp, 384 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR099C
           (ICT1) and YDR125C (ECM18)
          Length = 384

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 79/333 (23%), Positives = 128/333 (38%), Gaps = 90/333 (27%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSR-PKFPFNYPEHNPIM--- 197
           + +HGY +    F +N   +        ++A+DLPG G S   P  P             
Sbjct: 86  VLLHGYASSAVSFHRNLAALGAQVEQ--LYALDLPGNGMSQELPLGPAAARALARRCGAR 143

Query: 198 -----VEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANKFPNHFSKLIMCS 252
                + D++   ++ W    GL    +      HS G Y++  YA + P    +L + S
Sbjct: 144 ADIRALADYYLDALERWRAANGL----ETLNAAGHSFGGYLAFKYALRHPARVQRLCLVS 199

Query: 253 PAGI----------------------CPSPKLGQA---PPQWFVKLWDRNISPFSLVRNS 287
           P G+                        SP   +A   PP  F +          ++R  
Sbjct: 200 PLGVEAQTAGRRMPGRATRRRTRPPTPASPHYTRAAALPPLLFEQ-------QLRVLRWL 252

Query: 288 FHLGSKLTSGWTYRRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGSGEYLLSFALKCGGD 347
             LG+ L   W Y     F R   R +      H+YT+A+ ++          AL+    
Sbjct: 253 GPLGAHLL--WQYVN-ASFSRVPGREF------HRYTFALLHR---------LALR---- 290

Query: 348 PRLPLEKRLF---------------DNTSSFKANCDWLWLYGDEDWMDLRGGQRASEFLK 392
              PL ++LF               D+ +  K     L LYGD DWMD R G+     L 
Sbjct: 291 ---PLPRKLFTGLFTNALLARDPLLDSLAELKVPNVQL-LYGDHDWMDARAGRALVAELN 346

Query: 393 KIGMKSD--VKVVPSAGHHLYLDNYKHFNNVVI 423
            +  + D  + +VP+AGH+L+LDN + F++ ++
Sbjct: 347 ALRGRPDASLAIVPAAGHNLFLDNPEDFHSWLL 379

>KAFR0B05380 Chr2 (1107049..1108284) [1236 bp, 411 aa] {ON}
           Anc_8.284 YDR125C
          Length = 411

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 88/385 (22%), Positives = 140/385 (36%), Gaps = 79/385 (20%)

Query: 88  FQSQLLSTLPFYPSPANGRSSEILKTPVDDEGNYINEFTIKPMNPXXXXXMKHLIFVHGY 147
           FQ  ++  +P Y   +N  +SE L     ++ ++ N        P         + +HG+
Sbjct: 50  FQDAIMKKVPSYAEKSNVITSEGL-----NQWHFHNSKCRNVTVPT--------LLLHGF 96

Query: 148 GAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPF------------------- 188
            +    F +NF  +    +   ++AIDLP  G S      F                   
Sbjct: 97  ASSSMSFFRNFTGLS--QDIMDLYAIDLPANGLSRSLSTKFYRVSPKETRKFDMLDDIHF 154

Query: 189 ------NYPEHNPIM--VEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANK 240
                 NY     ++   ED++   I+ W     L    K N+ VAHS G Y+S  YA K
Sbjct: 155 QLLSHGNYHAEKELIQKCEDYYIDTIERWRRSNEL---HKINI-VAHSFGGYLSFKYALK 210

Query: 241 FPNHFSKLIMCSPAG-------------ICPSPKLGQAPPQWFVKLWDRNI------SPF 281
           +P   +KL + SP G             +  +  + +  P     + +  I      + F
Sbjct: 211 YPESINKLCLVSPLGVEANIYSINNNFNVGETYTVNRLDPSSCCYINENEIPKYVFDNLF 270

Query: 282 SLVRNSFHLGSKLTSGWTYRRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGSGEYLLSFA 341
            ++R S  +G+KL   W Y     + R     ++      +Y + +    G         
Sbjct: 271 KILRLSGPIGAKLC--WNY-VLSSYSRISSLDFK------RYVFELLYGKGGMTATAINL 321

Query: 342 LKCGGDPRLPLEKRLFDNTSSFKANCDWLWLYGDEDWMDLRGGQRASEFLKKIGMKSDVK 401
                  RL     L D+  S   N   L LYG+ DWM    G+      K     S  K
Sbjct: 322 FTQLFTTRLLARDPLMDSAHSLSCN-GILLLYGEYDWMAKNAGKSLLTNCKADNKGSASK 380

Query: 402 V----VPSAGHHLYLDNYKHFNNVV 422
                VP +GH+L+LDN   FN  +
Sbjct: 381 TKYLEVPKSGHNLFLDNPAFFNKSI 405

>CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {ON}
           similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125c ECM18 or uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 423

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 80/336 (23%), Positives = 122/336 (36%), Gaps = 91/336 (27%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNW-CIHAIDLPGYGFSSRPKFPFNYPEHNPIMVE- 199
           + +HGY A    F   F +IP LN +   ++ IDLPG G S  P       +  P+ +E 
Sbjct: 110 VLIHGYAATSTAF---FRSIPYLNRDIKDLYTIDLPGNGLSFTPSLDLEVSKPLPLKIEN 166

Query: 200 --------------------------DWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYI 233
                                     D++  RI+ W     L    K N+ VAHS G Y+
Sbjct: 167 IDDGNEFQLPYVIDSAHHRYVLQKLLDYYVDRIEQWRLDNKL---GKINV-VAHSYGGYL 222

Query: 234 SALYANKFPNHFSKLIMCSPAGICPSPKLGQAPPQWFVKLWDRNISPFSLVRNSFHLGSK 293
           S  YA K+P + + L + SP G+                  +RNI     + N FH  + 
Sbjct: 223 SFNYALKYPANINTLGLISPLGV------------------ERNIYS---INNEFHSRTI 261

Query: 294 LTSGWT-------YRRFR--QFLREGQ--------------------RGYEQHKAMH--K 322
               W         R+F+   +L + Q                      Y +  ++    
Sbjct: 262 YKREWNDCNSMFYDRKFKLNDYLFQKQLKPLRWLGPIGAKLCWNYIRSAYARVPSIDYKD 321

Query: 323 YTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNTSSFKANCDWLWLYGDEDWMDLR 382
           YT+  F   G      S          L     L D+ S  +     + +YG  DWM+  
Sbjct: 322 YTFETFYGRGGLPEQTSQIFTSLLTSSLLARDPLLDHVSQLQV-PKLIMMYGQYDWMNKN 380

Query: 383 GGQRASEFLKKIGMKSDVKVVPSAGHHLYLDNYKHF 418
           GG+  ++         D   +P+AGH+L+LDN   F
Sbjct: 381 GGKLMTQIFNGETKYID---IPNAGHNLFLDNPSDF 413

>Ecym_4285 Chr4 (612053..613270) [1218 bp, 405 aa] {ON} similar to
           Ashbya gossypii AGR062C
          Length = 405

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 85/327 (25%), Positives = 131/327 (40%), Gaps = 58/327 (17%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWC-IHAIDLPGYGFSSRPKFPFNY-------PEH 193
           + +HGY      + +N   +P L+     ++ IDLP  G S       +        PE 
Sbjct: 87  LLLHGYATSSMCYHRN---MPQLSEGIKHLYTIDLPANGLSKELPLELDIAKPIVFKPEF 143

Query: 194 NPIMVEDWFHQRIKGWLHKRGL------------LANPKNNL----LVAHSLGAYISALY 237
           N +  E      I G  H+  +            L   KN+L    LV HS G YIS  Y
Sbjct: 144 NSVKSEFHIPYTIDGLHHRCAIQKLEDYYIDSIELWRRKNSLGAINLVGHSFGGYISFKY 203

Query: 238 ANKFPNHFSKLIMCSPAGICPSPKLGQAPPQWFVKLWDRNISPFSLVR---NSFHLGSK- 293
           + K+P +  KL + SP G+     +      W      R+  P+S+     +S H  +K 
Sbjct: 204 SIKYPQNVKKLCLISPIGV--ERNIYSVHNNW------RSNCPYSIDYEDPSSKHFANKT 255

Query: 294 LTSGWTYRRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGSGEYL-LSFALKCGGDPRLPL 352
           +   + +    + LR    G    K   KY  A+++K  +  YL   F L  G +     
Sbjct: 256 MIPEFVFNEQTKLLR--LMGPLGAKLGWKYINAVYSKVPNFLYLEFIFTLIYGKNVMTDT 313

Query: 353 EKRLFDN--TSSFKAN------------CDWLWLYGDEDWMDLRGGQ-RASEFLKKIGMK 397
            + +F    T+S  A                L LYG+ DW+  + G+    EF K+    
Sbjct: 314 SRNIFTYLFTNSLLARDPMLDSLEHLHVDKLLMLYGEHDWVRSQPGKMMVEEFNKQRSHP 373

Query: 398 S-DVKVVPSAGHHLYLDNYKHFNNVVI 423
           S  + VVP A H+L+LDN   FN  ++
Sbjct: 374 SGTLTVVPDASHNLFLDNPVFFNVALL 400

>NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON} 
          Length = 427

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 79/335 (23%), Positives = 127/335 (37%), Gaps = 90/335 (26%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNY-PEHNPIMV-- 198
           + +HGY      F + F   PL      ++AID P  G S  P    N+  +H P  V  
Sbjct: 107 LLLHGYATSSIAFFRTFG--PLSKQIRDLYAIDFPANGLSKAPPLNVNHLKKHTPYKVKF 164

Query: 199 -------------------------EDWFHQRIKGWLHKRGLLANPKNNL-LVAHSLGAY 232
                                    E+++   ++ W      L N      LV HS G Y
Sbjct: 165 KDDNTKFQISHTVDVQLQKETIEHYENYYLDAVRKWQ-----LTNKIEKFNLVGHSFGGY 219

Query: 233 ISALYANKFPNHFSKLIMCSPAGI----------------------CPSPKLGQAPPQWF 270
            +  YA ++P+   KL + SP G+                       P+ K      Q  
Sbjct: 220 FAYKYALRYPDSVDKLCLVSPLGVERNIYSVNNNFEDKKVYNLELEDPTSKYYGRTFQIP 279

Query: 271 VKLWDRNISPFSLVRNSFHLGSKLTSGW---TYRR-----FRQFLREGQRGYEQHKAMHK 322
             L++     F ++R    LG + T  +   +YRR     F++++ E   G       ++
Sbjct: 280 KCLFE---GQFDILRKFGPLGPRFTWNYINSSYRRVPSMEFKEYIFELLYG-------NR 329

Query: 323 YTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNTSSFKANCDWLWLYGDEDWMDLR 382
            T  I  +  S   ++S  L    DP       + D+    KA  + + +YG EDWM+ +
Sbjct: 330 KTSPILTEVFSN--IVSRNL-LARDP-------ILDSIDELKA-SNVMLMYGQEDWMNSQ 378

Query: 383 GGQRASEFLKKIGMKSDVKV---VPSAGHHLYLDN 414
            G    + L +I    +      VP+AGH+L+LDN
Sbjct: 379 AGYLMVKELNEIRENPNAASYVEVPNAGHNLFLDN 413

>ZYRO0D06666g Chr4 (576172..577314) [1143 bp, 380 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 380

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 78/333 (23%), Positives = 119/333 (35%), Gaps = 68/333 (20%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVE-- 199
           + +HGY A    + + F+   L +    ++ IDLP  G S       +     P+ VE  
Sbjct: 62  LLIHGYAASSMAYYRTFQG--LTDKISDLYTIDLPSNGLSKELPLILDGQTPPPLKVEIH 119

Query: 200 -------------------------DWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYIS 234
                                    D++   I+ W    G+    + NL V HS G YI+
Sbjct: 120 KDGSKFKIIERVDAEHCRSVVKQYEDYYLDSIELWRKHNGI---GRFNL-VGHSFGGYIA 175

Query: 235 ALYANKFPNHFSKLIMCSPAGICPSPKLGQAPPQWFVKLWDRNISPFSLVRNSFHLGSKL 294
             YA K+P    +L + SP G+     +      W        +     + ++       
Sbjct: 176 FKYAVKYPKAVEQLGLISPLGV--ESNIYSVNNDW-------KLDTVYEMESTDPASRMY 226

Query: 295 TSGWT-----YRRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGSGEY---LLSFALKCGG 346
              W      + R  + LR    G    K    Y  A +NK  + EY   +       GG
Sbjct: 227 GKNWEIPKVLFERQTELLR--WMGPIGAKLCWNYITAAYNKLPTMEYKDYVFELLYGNGG 284

Query: 347 DPR-------------LPLEKRLFDNTSSFKANCDWLWLYGDEDWMDLRGGQRASEFLKK 393
            P+             L     + D+     A    L LYGD DWM+   G R  E L +
Sbjct: 285 IPKTARKVFGGLFTRSLLARDPIMDSMDKLGAR-KVLLLYGDSDWMNNYAGYRMVELLNQ 343

Query: 394 IGMK--SDVKVVPSAGHHLYLDNYKHFNNVVIK 424
              K  +    VP A H+L+LDN   FN+ +I+
Sbjct: 344 KRGKGYATYDEVPDARHNLFLDNPDSFNDKLIQ 376

>NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON}
           Anc_8.524 YBR204C
          Length = 362

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 59/138 (42%), Gaps = 23/138 (16%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDW 201
           +F+HG G  L  F      + L  N +   A+DLPG+G S        Y ++N   V   
Sbjct: 93  LFIHGLGGVLEQFEPLLRLLDLNENKFL--ALDLPGFGKSDE------YEDYNMFDVISI 144

Query: 202 FHQRIKGWLHKRGLLANPKNNLLVAHSLGAYIS--ALYANKFPNHFSKLIMCSPAGICPS 259
            H  +   + +R       N +LV HS+G YIS    Y +     F KL+  SP    P 
Sbjct: 145 IHTIVDRLIPER----TTSNIVLVGHSMGCYISLHLFYKSYTRFSFKKLVFLSP----PK 196

Query: 260 PKLGQAPP-----QWFVK 272
           P+L Q        QW ++
Sbjct: 197 PQLDQLEKTNRKMQWLLR 214

>TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.284
           YDR125C
          Length = 421

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 61/154 (39%), Gaps = 45/154 (29%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKF--------------- 186
           + +HGY A    + K F    L  +   ++ IDLPG+G S+ PK                
Sbjct: 54  VLIHGYAASSMAYYKTFR--YLTGSIKDLYTIDLPGFGLSASPKIIINDHNRKKSQFDIK 111

Query: 187 ----------PFNYPEHNPIMVE--------------DWFHQRIKGWLHKRGLLANPKNN 222
                      F+  + N  ++E              D++  RI+ W     L    K N
Sbjct: 112 LIDSKDSNNNKFSISKKNLKLLENGNIEDKAFISAFDDYYIDRIEKWRKFNNL---GKIN 168

Query: 223 LLVAHSLGAYISALYANKFPNHFSKLIMCSPAGI 256
           + + HS G YIS  YA K+P+    L + SP G+
Sbjct: 169 V-IGHSFGGYISFKYAIKYPDSIENLCLVSPFGM 201

 Score = 33.9 bits (76), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 7/59 (11%)

Query: 370 LWLYGDEDWMDLRGGQRASEFLKKIGMKSDVKV-----VPSAGHHLYLDNYKHFNNVVI 423
           L  YG+ DWM+   G   +E L    +K D K      VP++GH+L LD+ K F+  +I
Sbjct: 360 LLFYGENDWMNKEAGFLMAEKLNI--LKGDSKYANWIEVPNSGHNLILDDPKFFSKNLI 416

>TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8.524
           YBR204C
          Length = 372

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 58/118 (49%), Gaps = 18/118 (15%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDW 201
           IF+HG G  L  FL   +   L N ++   A+DLPG+G S      FN  E+N   + ++
Sbjct: 93  IFIHGLGGSLEQFLPLLKLTDLSNKSFI--AVDLPGFGQS-----EFN-DEYN---IANY 141

Query: 202 FHQRIKGWLH----KRGLLANPKNNLLVAHSLGAYISALYANKFPNHF--SKLIMCSP 253
               I G+L      R L  N K  +L  HS+G Y++  +  ++   +   K+++ +P
Sbjct: 142 SMSSIIGFLKSQVFSRYLTTNTK-IILTGHSMGCYLALHFYQQYKTEYQIQKIVLLAP 198

>SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {ON}
           similar to uniprot|P38139 Saccharomyces cerevisiae
           YBR204C Hypothetical ORF
          Length = 392

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 69/165 (41%), Gaps = 20/165 (12%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDW 201
           +F+HG G  L  F    + + LLN  +   ++DLPG+G S                VE +
Sbjct: 133 VFIHGLGGTLAQFEPLLKLLSLLNKGF--FSMDLPGFGSSDE--------------VESY 176

Query: 202 FHQRIKGWLHKRGLLANPKNNL-LVAHSLGAYISALYANKFPNHFS--KLIMCSPAGICP 258
               I   + K      P  NL L+ HS+G Y++  + + F   +S  +L++ +P  +  
Sbjct: 177 GMLEIVAIVQKTFAKLTPSRNLVLIGHSMGCYLAIHFCSAFQEQYSFQELVLLAPPSL-D 235

Query: 259 SPKLGQAPPQWFVKLWDRNISPFSLVRNSFHLGSKLTSGWTYRRF 303
            P++ +   +  + L  R    F + R  F     L S    + F
Sbjct: 236 LPQVERTSTRVLMSLLFRWPWMFDIYRTQFDQSRGLRSSGIVQFF 280

>KLTH0E12188g Chr5 (1082142..1083152) [1011 bp, 336 aa] {ON} similar
           to uniprot|P38139 Saccharomyces cerevisiae YBR204C
           Hypothetical ORF
          Length = 336

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 69/173 (39%), Gaps = 36/173 (20%)

Query: 107 SSEILKTPVDDEGNYINE----FTIKPMNPXXXXXMKH-------LIFVHGYGAGLGFFL 155
           S+ ILK P+D E +++ E      +          +KH        +F HG G  L  F 
Sbjct: 36  STAILKEPLDFENSFLAEHERFLQVGTTRLRTSHNIKHQHGEGPIYLFFHGLGGNLTQFE 95

Query: 156 KNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDWFHQ-RIKGWLHKRG 214
                +  LN  +   A+DLPG+G S                 +D +   ++   +H   
Sbjct: 96  PLLRLLGELNEGFV--AMDLPGFGLSEE---------------QDGYQMLQVTQVIHDAF 138

Query: 215 L-LANPKNNLLVAHSLGAYISALYANKFPNHFS--KLIMCSPAGICPSPKLGQ 264
           L + + K  +LV HS+G ++   +A  F   F     +  SP    P+P L Q
Sbjct: 139 LQITDHKKIILVGHSMGCHLVLHFAILFGLEFDIKDSVFLSP----PAPTLPQ 187

>KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {ON}
           Anc_8.524 YBR204C
          Length = 356

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 54/123 (43%), Gaps = 16/123 (13%)

Query: 142 IFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDW 201
           IF+HG G  L  F    + + L    +   AIDLPG+G S       +YP    I V   
Sbjct: 86  IFIHGLGGSLDQFFPLLKLLDLSEKYFV--AIDLPGFGKSDEHT---DYP---MIQVVKH 137

Query: 202 FHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANKFPNHF--SKLIMCSPAGICPS 259
               I   L++  L  +     L+ HS+G Y++  +   F   +   K+++ +P    P 
Sbjct: 138 IDAVISELLNEARLAFDTVR--LIGHSMGCYLTLHFMTLFSKKYRIGKVVLLAP----PK 191

Query: 260 PKL 262
           P++
Sbjct: 192 PEM 194

>Kwal_23.6592 s23 (1658078..1658572) [495 bp, 164 aa] {ON} [contig
           358] FULL
          Length = 164

 Score = 33.1 bits (74), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 47/112 (41%), Gaps = 22/112 (19%)

Query: 153 FFLKNFEN--------IPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDWFHQ 204
           F+L++F          IPLL  ++ + A+DLPG G S +P   ++              Q
Sbjct: 18  FYLRSFPESWYAWRNVIPLLAESYWVIAVDLPGQGDSDKPGDGYD-------------TQ 64

Query: 205 RIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANKFPNHFSKLIMCSPAGI 256
            +   LH            L AH +GA+++  Y+  F     ++ +   AGI
Sbjct: 65  TLANKLHILIQSLGLSRYFLAAHDVGAWVAFPYSLLFGEEIERMALLD-AGI 115

>CAGL0M07854g Chr13 (785153..785470) [318 bp, 105 aa] {ON} similar
           to uniprot|P47093 Saccharomyces cerevisiae YJR022w
           pre-mRNA splicing factor
          Length = 105

 Score = 31.6 bits (70), Expect = 0.97,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 3/44 (6%)

Query: 388 SEFLKKIGMKSDVKVVPSAGH--HLYLDNYKHFNNVVIKEMEKM 429
           S  LK+  +  D+ VV +AG   H+ LD Y  + N+V+KE +K+
Sbjct: 2   SPLLKQY-LNKDIVVVTTAGEVMHVVLDGYDKYTNLVVKEGDKI 44

>Kwal_26.9628 s26 (1300688..1301449) [762 bp, 254 aa] {ON} YNR064C -
           Hypothetical ORF [contig 363] PARTIAL
          Length = 254

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 41/96 (42%), Gaps = 14/96 (14%)

Query: 161 IPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDWFHQRIKGWLHKRGLLANPK 220
           IPLL  ++ + A+DLPG G S +P   ++              Q +   LH         
Sbjct: 53  IPLLAESYWVIAVDLPGQGDSDKPGDGYD-------------TQTLANKLHILIQSLGLS 99

Query: 221 NNLLVAHSLGAYISALYANKFPNHFSKLIMCSPAGI 256
              L AH +GA+++  Y+  F     ++ +   AGI
Sbjct: 100 RYFLAAHDVGAWVAFPYSLLFGEEIERMALLD-AGI 134

>Kwal_43.16490 s43 (51..911) [861 bp, 286 aa] {ON} YNR064C -
           Hypothetical ORF [contig 357] PARTIAL
          Length = 286

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 41/96 (42%), Gaps = 14/96 (14%)

Query: 161 IPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDWFHQRIKGWLHKRGLLANPK 220
           IPLL  ++ + A+DLPG G S +P   ++              Q +   LH         
Sbjct: 36  IPLLAESYWVIAVDLPGQGDSDKPGDGYD-------------TQTLANKLHILIQSLGLS 82

Query: 221 NNLLVAHSLGAYISALYANKFPNHFSKLIMCSPAGI 256
              L AH +GA+++  Y+  F     ++ +   AGI
Sbjct: 83  RYFLAAHDVGAWVAFPYSLLFGEEIERMALLD-AGI 117

>Skud_14.400 Chr14 complement(717609..718490) [882 bp, 293 aa] {ON}
           YNR064C (REAL)
          Length = 293

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 3/45 (6%)

Query: 141 LIFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPK 185
           ++ +HG+ +    F +N   IPLL + + + A DLPG+GFS  P 
Sbjct: 32  IVLLHGFPSSSNMF-RNL--IPLLASQFHVIAPDLPGFGFSETPD 73

>Kwal_26.6639 s26 complement(252..1163) [912 bp, 303 aa] {ON}
           YNR064C - Hypothetical ORF [contig 294] FULL
          Length = 303

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 41/96 (42%), Gaps = 14/96 (14%)

Query: 161 IPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDWFHQRIKGWLHKRGLLANPK 220
           IPLL  ++ + A+DLPG G S +P   ++              Q +   LH         
Sbjct: 53  IPLLAESYWVIAVDLPGQGDSDKPGDGYD-------------TQTLANKLHILIQSLGLS 99

Query: 221 NNLLVAHSLGAYISALYANKFPNHFSKLIMCSPAGI 256
              L AH +GA+++  Y+  F     ++ +   AGI
Sbjct: 100 RYFLAAHDVGAWVAFPYSLLFGEEIERMALLD-AGI 134

>Kwal_48.19391 s48 (3319..3870) [552 bp, 183 aa] {ON} YNR064C -
           Hypothetical ORF [contig 322] FULL
          Length = 183

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 41/96 (42%), Gaps = 14/96 (14%)

Query: 161 IPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDWFHQRIKGWLHKRGLLANPK 220
           IPLL  ++ + A+DLPG G S +P   ++              Q +   LH         
Sbjct: 53  IPLLAESYWVIAVDLPGQGDSDKPGDGYD-------------TQTLANKLHILIQSLGLS 99

Query: 221 NNLLVAHSLGAYISALYANKFPNHFSKLIMCSPAGI 256
              L AH +GA+++  Y+  F     ++ +   AGI
Sbjct: 100 RYFLAAHDVGAWVAFPYSLLFGEEIERMALLD-AGI 134

>Ecym_4738 Chr4 (1440812..1443427) [2616 bp, 871 aa] {ON} similar to
           Ashbya gossypii AAL127W
          Length = 871

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 41/100 (41%), Gaps = 12/100 (12%)

Query: 321 HKYTYAIFNKPGSGEYL----LSFALKCGGDPRLPLEKRL----FDNTSSFKANCD---- 368
           H+Y      KP   E L    LS   K G D  L L +R       +T  FK N D    
Sbjct: 479 HRYLSTGDVKPEEDEVLYPVFLSLKTKDGVDNNLVLNERSITIELKDTEFFKVNTDQAGN 538

Query: 369 WLWLYGDEDWMDLRGGQRASEFLKKIGMKSDVKVVPSAGH 408
           ++  Y D+ W  L           + G+ +DVK + S+G+
Sbjct: 539 YITAYHDDRWKTLSTQANLLSVEDRTGLVADVKSLASSGY 578

>Suva_14.424 Chr14 complement(736902..737771) [870 bp, 289 aa] {ON}
           YNR064C (REAL)
          Length = 289

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 6/51 (11%)

Query: 141 LIFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRP---KFPF 188
           ++ +HG+      F +N   IPLL  ++ + A DLPG+GFS  P   KF F
Sbjct: 32  IVLLHGFPTSSNMF-RNL--IPLLAGHFHVIAPDLPGFGFSETPDDYKFTF 79

>KLLA0A10395g Chr1 complement(908097..908981) [885 bp, 294 aa] {ON}
           similar to uniprot|P53750 Saccharomyces cerevisiae
           YNR064C
          Length = 294

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 3/45 (6%)

Query: 141 LIFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPK 185
           ++ +HGY      F      IPL+++ + + A DLPG+GF+  P+
Sbjct: 33  IVLLHGYPTSSTMFR---HLIPLISDKFHVIAPDLPGFGFTEVPE 74

>YNR064C Chr14 complement(749136..750008) [873 bp, 290 aa] {ON}
           Epoxide hydrolase, member of the alpha/beta hydrolase
           fold family; may have a role in detoxification of
           epoxides
          Length = 290

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 6/52 (11%)

Query: 141 LIFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRP---KFPFN 189
           ++ +HG+      F +N   IPLL   + I A DLPG+GF+  P   KF F+
Sbjct: 32  ILLLHGFPTSSNMF-RNL--IPLLAGQFHIIAPDLPGFGFTETPENYKFSFD 80

>TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.524
           YBR204C
          Length = 378

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 50/235 (21%), Positives = 89/235 (37%), Gaps = 37/235 (15%)

Query: 29  ISRAKVRTSAETTAIINQKSTPPTAMPLIQIATQLPNLFPLSFEASIRDYSMFQENAESF 88
           +S+  +RT  E     N +  P + + +  I  +  +         + +  + ++N   F
Sbjct: 1   MSQNNIRTEVENAC--NLEGQPLSKLSIEDIVNKYVDSETRQGNPRLYETLLLEQNQLDF 58

Query: 89  QSQLLS------TLPFYPSPANGRSSEILKTPVDDEGNYINEFTIKPMNPXXXXXMKHLI 142
           Q++ L       TLP   +  N RS   + + V          T KP+           +
Sbjct: 59  QTKFLKDHSHIITLP-NRNNLNIRSCNNVGSEV---------LTNKPI----------YV 98

Query: 143 FVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDWF 202
           F+ G G  L  +      + +LN  +     DLPG+G S        Y   N I V    
Sbjct: 99  FLPGLGGSLDQYEPLLRLMDILNEKFI--GFDLPGFGGSEEDTSEGGY---NMIKVCHII 153

Query: 203 HQRIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANKFPN----HFSKLIMCSP 253
           ++ ++  + +     +     LV HS+G Y+   + N F        S+LI+ SP
Sbjct: 154 NEALQSIITQNYSTRDTIELRLVGHSMGCYLVLHFFNSFQTKTEYKISQLILTSP 208

>TDEL0G00150 Chr7 complement(22315..23214) [900 bp, 299 aa] {ON} 
          Length = 299

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 4/51 (7%)

Query: 141 LIFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPK-FPFNY 190
           ++ +HG+ +    F +N   IPLL   + + A D+PG+GF+  P+ + FN+
Sbjct: 38  ILLLHGFPSSSNMF-RNL--IPLLAARFYVVAPDIPGFGFTEYPEDYEFNF 85

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 40/95 (42%), Gaps = 13/95 (13%)

Query: 67  FPLSFEASIRDYSMFQENAESFQSQLLS---TLPFYPSPANGRSSEILKTPVDDEGNYIN 123
           F  SF+  IR  S + + AE    Q L    T    PS  N R    L+TP D   N   
Sbjct: 71  FIDSFKQPIRPNSDYIDAAELDYEQALENGITTSVSPSAPNLRKLNQLRTPTDANDNKAL 130

Query: 124 EFTIKPMNPXXXXXMKHLIFVH-GYGAGLGFFLKN 157
           + TI+P         +H++ +  G G G G  + N
Sbjct: 131 KQTIRP---------RHVVMISLGTGIGTGLLVGN 156

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,901,172
Number of extensions: 2213843
Number of successful extensions: 4943
Number of sequences better than 10.0: 77
Number of HSP's gapped: 4890
Number of HSP's successfully gapped: 112
Length of query: 431
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 319
Effective length of database: 40,638,807
Effective search space: 12963779433
Effective search space used: 12963779433
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)