Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0B05434gna 1ON34434414690.0
KLTH0H15048gna 1ON2963475291e-64
Kwal_34.15946na 1ON2793554881e-58
AFR531Wna 1ON2741324383e-51
Ecym_1475na 1ON3491124433e-51
ZYRO0D13992g5.586ON5871163401e-34
AFR461C5.586ON5441163311e-33
Ecym_14045.586ON5621203311e-33
Kpol_1023.635.586ON5561623292e-33
SAKL0G06292g5.586ON5171153255e-33
TDEL0A045305.586ON4841153236e-33
KNAG0B033505.586ON6001113251e-32
Skud_8.555.586ON5351113178e-32
Smik_8.635.586ON5421113179e-32
NDAI0C006905.586ON6501093172e-31
NCAS0H028905.586ON5321113142e-31
Suva_8.625.586ON5451113124e-31
KLTH0G05104g5.586ON5381093115e-31
YHR006W (STP2)5.586ON5411113116e-31
Kwal_47.183375.586ON5361093091e-30
TPHA0K002105.586ON4811583052e-30
NCAS0A079005.586ON3671092984e-30
KAFR0A067205.586ON2351102889e-30
Smik_4.7425.586ON5281222983e-29
NDAI0H011105.586ON4541092963e-29
YDR463W (STP1)5.586ON5191222974e-29
KNAG0C060305.586ON3141112878e-29
CAGL0K06413g5.586ON3591152889e-29
CAGL0E04312g5.586ON6881292915e-28
KLLA0F10109g5.586ON6231102906e-28
Skud_4.7395.586ON5141222878e-28
Suva_2.6395.586ON5161222861e-27
TBLA0E028205.586ON3121182763e-27
KAFR0C057105.586ON4421212717e-26
Kwal_26.93004.222ON3041262032e-17
Smik_12.4624.222ON341581796e-14
YLR375W (STP3)4.222ON343581796e-14
Skud_12.4604.222ON344581796e-14
Suva_10.4914.222ON344581797e-14
SAKL0H03894g4.222ON358651771e-13
SAKL0H26224gsingletonON227851721e-13
KLLA0F07073g4.222ON5581311772e-13
Ecym_27684.222ON431581762e-13
NDAI0J020604.222ON4891171762e-13
ZYRO0B07436g4.222ON343581743e-13
TBLA0I027704.222ON613581763e-13
AFR588W4.222ON319581724e-13
CAGL0H04873g4.222ON451991736e-13
Kpol_337.64.222ON400591726e-13
TDEL0E015204.222ON399581701e-12
KAFR0A061204.222ON3421331691e-12
KNAG0B059404.222ON377581692e-12
Suva_4.2014.222ON503681683e-12
NCAS0J013004.222ON435581673e-12
Skud_4.2064.222ON486681673e-12
CAGL0K04697g4.222ON515581656e-12
Smik_4.1904.222ON489681649e-12
KLTH0D13618g4.222ON414881631e-11
YDL048C (STP4)4.222ON490681631e-11
NCAS0A023604.222ON478581621e-11
TBLA0A082004.222ON350581602e-11
TPHA0B009304.222ON347581566e-11
NDAI0D045104.222ON5601081576e-11
Kpol_472.34.222ON3111311503e-10
TPHA0B023904.222ON3461361246e-07
AEL174W1.326ON6611081034e-04
TPHA0G035102.533ON387781024e-04
KNAG0J008703.281ON28092996e-04
NDAI0K018602.533ON73061990.001
YPR022C8.130ON113371990.001
TBLA0G022302.533ON21682950.002
KLLA0E18547g2.533ON43163960.002
NCAS0F037403.518ON288105940.003
ZYRO0B02002g2.533ON294102940.003
KNAG0D022208.130ON120668950.003
Skud_16.3078.130ON112471940.005
Skud_13.2262.533ON47573930.006
TDEL0F010308.130ON107767930.006
KAFR0A010903.281ON24998890.010
Smik_16.2638.130ON112271910.011
NCAS0B045008.130ON120768900.013
TBLA0I014802.533ON51374890.014
Suva_2.2003.281ON23274870.018
AGL071C2.533ON39661880.018
Skud_4.2973.281ON23174870.018
KNAG0H011803.281ON25491870.020
YMR070W (MOT3)2.533ON49075880.022
NDAI0A075403.298ON37086870.022
NCAS0F009002.533ON52579880.022
YDR043C (NRG1)3.281ON23174860.022
Ecym_72552.533ON54461880.024
Smik_4.2813.281ON23177850.028
SAKL0F16170g7.543ON43741860.031
KAFR0B020508.130ON106369870.037
NCAS0A048002.533ON51164850.053
TDEL0A030702.533ON23988830.059
Smik_13.2492.533ON47367840.067
Kpol_1065.153.281ON22068820.068
CAGL0K02343g8.130ON116278830.094
KNAG0E016003.518ON33860820.10
KLTH0C07172g3.281ON26564810.11
ZYRO0C13508g3.281ON18999800.11
KAFR0B002807.543ON41679820.12
Kpol_1052.183.281ON357118810.14
SAKL0A03476g6.256ON32294810.14
Suva_16.349na 2ON54159810.14
KNAG0H005502.598ON62081810.17
Skud_13.1932.598ON70497800.19
NDAI0F014006.256ON39473800.21
Kwal_14.14574.189ON51557790.28
KLTH0D06842g2.533ON50669790.28
KAFR0B021608.144ON45359790.28
Ecym_21596.256ON46067790.29
TPHA0C025802.598ON36572780.30
Kpol_1052.83.298ON38689780.31
Suva_13.2462.533ON41973780.32
SAKL0A09482g2.533ON38859780.33
Kwal_26.80212.533ON50768780.34
TPHA0M011803.281ON35064780.34
TPHA0A019408.234ON912127780.38
Smik_16.4507.543ON43241770.40
Kpol_1031.428.144ON359110770.41
SAKL0D06776g1.326ON76758780.43
Skud_16.4907.543ON40741770.46
Skud_16.486.256ON39881770.47
TPHA0A039803.281ON31486760.48
Smik_6.4356.256ON38669760.50
NCAS0A106503.281ON29364760.54
NCAS0E006103.518ON40158760.54
KLLA0E13487gna 2ON23059750.57
SAKL0H24464g8.130ON95059770.58
SAKL0B11330g2.598ON49959760.58
YPL230W (USV1)6.256ON39169760.62
NDAI0A074703.281ON26359750.64
NCAS0A021604.189ON41276750.75
NDAI0A056503.281ON33065740.84
KAFR0F039404.189ON45292740.91
KLLA0C17072g8.144ON47471740.93
KNAG0A070402.533ON35269740.95
TBLA0I032803.518ON330101740.96
KNAG0C058102.533ON55464740.97
Smik_13.2072.598ON70387741.0
TDEL0C011108.82ON57924741.0
KAFR0A018602.533ON49066741.1
KAFR0H012903.298ON33079731.1
TBLA0F003708.144ON68761741.1
KLTH0G17336g4.189ON48557741.1
KLLA0A02629g4.189ON55969741.1
CAGL0K03003g2.533ON64760741.2
YGL209W (MIG2)3.518ON38258731.2
YMR037C (MSN2)2.598ON70487741.3
KLLA0F18524g3.281ON35770731.3
SAKL0D03146g3.281ON15765711.3
Skud_7.593.518ON38358731.3
TPHA0D034003.518ON33879731.3
Suva_16.766.256ON39269731.4
Smik_7.543.518ON38258731.4
Suva_7.523.518ON40058731.4
Skud_5.1373.518ON39461731.4
KLTH0H09196g4.80ON46071731.5
Kwal_26.83512.598ON69859731.5
KLTH0D08734g2.598ON67759731.6
NCAS0I015603.281ON26664711.7
NCAS0G012706.256ON27483711.8
NCAS0B046008.144ON547114721.8
KLLA0F26961g2.598ON69459721.8
KAFR0D038901.94ON220542731.9
TBLA0D023008.130ON105135721.9
Kwal_27.109253.281ON26464711.9
AGL246W8.486ON22760711.9
KAFR0C003403.298ON394127722.0
TPHA0C021608.425ON1375102722.4
NDAI0H014002.533ON54165712.4
Kpol_1002.256.256ON29469702.5
Kpol_1013.212.598ON49487712.5
CAGL0K12078g3.281ON46366712.6
Kpol_1018.332.533ON58958712.6
Ecym_28177.543ON43186702.7
KLLA0B03454g7.543ON47282702.8
CAGL0M00594g4.351ON102064712.8
ACL057W8.144ON52070702.9
Ecym_62951.326ON66358703.0
NDAI0E031208.486ON23973693.0
Kpol_1050.193.518ON22175693.1
ZYRO0B01892gna 3ON36785703.1
ABR089C2.598ON57159703.2
NCAS0B028408.425ON115261703.2
CAGL0K02145g8.144ON31773693.3
Kpol_541.398.116ON29125693.5
Kwal_47.172418.144ON40371693.5
Ecym_8387na 4ON17958683.6
KNAG0F017106.256ON41366693.7
AGR031W3.281ON14059673.7
AER159C4.351ON119160703.7
TBLA0B012802.162ON82392703.8
CAGL0K04257g4.189ON54791693.9
KNAG0D037104.80ON45958693.9
NDAI0I029003.518ON52458694.0
YPR186C (PZF1)7.543ON42941694.0
SAKL0G16434gna 5ON29793694.1
SAKL0H11440g8.486ON20588684.3
NDAI0C048608.425ON135061694.3
SAKL0G18062g4.351ON123860694.4
Suva_13.2062.598ON70997694.6
KAFR0C029808.144ON22559684.6
KLLA0C16005g6.256ON33178684.7
ZYRO0A09416g8.425ON134661694.9
Ecym_54242.162ON77597694.9
KLTH0H10538g1.326ON68257685.3
ZYRO0G19140g8.144ON55771685.5
Kpol_529.138.425ON141061685.8
KNAG0J022503.296ON29671675.8
Ecym_23012.598ON76776685.8
KNAG0F039807.543ON37547685.8
ACR264W2.162ON76997686.1
Kpol_1023.1004.351ON91660686.1
KAFR0B063608.425ON62764686.3
SAKL0H20988g4.80ON54871686.3
Kwal_23.54007.543ON42941676.4
TDEL0F055008.425ON120761686.4
Ecym_26543.281ON25764676.4
Suva_16.5187.543ON42747676.5
Ecym_84038.144ON57370686.6
Suva_12.2184.351ON127083686.6
TPHA0A039103.298ON35183676.6
Skud_7.3644.214ON81087686.7
CAGL0M13189g2.598ON54159676.7
TPHA0C041902.533ON41762676.9
Kpol_185.32.598ON64759677.1
SAKL0A10648gsingletonON26133667.2
KNAG0E026101.326ON746101677.2
KLLA0B04477g4.351ON133260687.2
KNAG0D021208.144ON40282677.2
KAFR0C004903.281ON22459667.3
KNAG0J028504.21ON50054677.7
SAKL0H12958g8.425ON112961678.0
CAGL0K09372g3.518ON39655668.1
Smik_10.4204.351ON134872678.3
TPHA0N014602.598ON51961678.4
NDAI0B019308.144ON43669668.4
NCAS0B036008.326ON63566678.5
SAKL0E10714g2.162ON81956678.6
Skud_10.3514.351ON132783678.7
TBLA0A089104.80ON39058668.9
NDAI0B060203.518ON42658669.3
TBLA0H028302.598ON74669669.5
KLTH0G12254g8.326ON74642669.6
KAFR0E029008.486ON18559649.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0B05434g
         (344 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some s...   570   0.0  
KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some ...   208   1e-64
Kwal_34.15946 s34 complement(130149..130988) [840 bp, 279 aa] {O...   192   1e-58
AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if...   173   3e-51
Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar t...   175   3e-51
ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} simi...   135   1e-34
AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}...   132   1e-33
Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}...   132   1e-33
Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa] ...   131   2e-33
SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON} unipro...   129   5e-33
TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.5...   129   6e-33
KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {O...   129   1e-32
Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W (...   126   8e-32
Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)   126   9e-32
NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {O...   126   2e-31
NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {O...   125   2e-31
Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W (...   124   4e-31
KLTH0G05104g Chr7 (412304..413920) [1617 bp, 538 aa] {ON} simila...   124   5e-31
YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}  STP2Transc...   124   6e-31
Kwal_47.18337 s47 complement(787992..789602) [1611 bp, 536 aa] {...   123   1e-30
TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON...   122   2e-30
NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa] ...   119   4e-30
KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5....   115   9e-30
Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463...   119   3e-29
NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586    118   3e-29
YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}  STP1Tran...   119   4e-29
KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5....   115   8e-29
CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some ...   115   9e-29
CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some s...   116   5e-28
KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {...   116   6e-28
Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463...   115   8e-28
Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463...   114   1e-27
TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON...   110   3e-27
KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON} Anc_5...   108   7e-26
Kwal_26.9300 s26 (1156241..1157155) [915 bp, 304 aa] {ON} YLR375...    83   2e-17
Smik_12.462 Chr12 (810413..811438) [1026 bp, 341 aa] {ON} YLR375...    74   6e-14
YLR375W Chr12 (871697..872728) [1032 bp, 343 aa] {ON}  STP3Zinc-...    74   6e-14
Skud_12.460 Chr12 (811208..812242) [1035 bp, 344 aa] {ON} YLR375...    74   6e-14
Suva_10.491 Chr10 (836816..837094,837128..837883) [1035 bp, 344 ...    74   7e-14
SAKL0H03894g Chr8 complement(357602..358678) [1077 bp, 358 aa] {...    73   1e-13
SAKL0H26224g Chr8 (2308056..2308739) [684 bp, 227 aa] {ON} some ...    71   1e-13
KLLA0F07073g Chr6 (675221..676897) [1677 bp, 558 aa] {ON} some s...    73   2e-13
Ecym_2768 Chr2 (1495608..1496903) [1296 bp, 431 aa] {ON} similar...    72   2e-13
NDAI0J02060 Chr10 (505150..506619) [1470 bp, 489 aa] {ON} Anc_4....    72   2e-13
ZYRO0B07436g Chr2 complement(581225..582256) [1032 bp, 343 aa] {...    72   3e-13
TBLA0I02770 Chr9 (650889..652730) [1842 bp, 613 aa] {ON} Anc_4.2...    72   3e-13
AFR588W Chr6 (1496952..1497911) [960 bp, 319 aa] {ON} Syntenic h...    71   4e-13
CAGL0H04873g Chr8 complement(465069..466424) [1356 bp, 451 aa] {...    71   6e-13
Kpol_337.6 s337 (17510..18712) [1203 bp, 400 aa] {ON} (17510..18...    71   6e-13
TDEL0E01520 Chr5 complement(297717..298916) [1200 bp, 399 aa] {O...    70   1e-12
KAFR0A06120 Chr1 complement(1238549..1239577) [1029 bp, 342 aa] ...    70   1e-12
KNAG0B05940 Chr2 (1165682..1166815) [1134 bp, 377 aa] {ON} Anc_4...    70   2e-12
Suva_4.201 Chr4 complement(354498..356009) [1512 bp, 503 aa] {ON...    69   3e-12
NCAS0J01300 Chr10 (225659..226966) [1308 bp, 435 aa] {ON} Anc_4....    69   3e-12
Skud_4.206 Chr4 complement(361956..363416) [1461 bp, 486 aa] {ON...    69   3e-12
CAGL0K04697g Chr11 (459195..460742) [1548 bp, 515 aa] {ON} some ...    68   6e-12
Smik_4.190 Chr4 complement(347829..349298) [1470 bp, 489 aa] {ON...    68   9e-12
KLTH0D13618g Chr4 (1112089..1113333) [1245 bp, 414 aa] {ON} simi...    67   1e-11
YDL048C Chr4 complement(366739..368211) [1473 bp, 490 aa] {ON}  ...    67   1e-11
NCAS0A02360 Chr1 (448263..449699) [1437 bp, 478 aa] {ON} Anc_4.222     67   1e-11
TBLA0A08200 Chr1 complement(2024809..2025861) [1053 bp, 350 aa] ...    66   2e-11
TPHA0B00930 Chr2 complement(212983..214026) [1044 bp, 347 aa] {O...    65   6e-11
NDAI0D04510 Chr4 complement(1057468..1059150) [1683 bp, 560 aa] ...    65   6e-11
Kpol_472.3 s472 complement(4365..5300) [936 bp, 311 aa] {ON} com...    62   3e-10
TPHA0B02390 Chr2 complement(547109..548149) [1041 bp, 346 aa] {O...    52   6e-07
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    44   4e-04
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...    44   4e-04
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    43   6e-04
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...    43   0.001
YPR022C Chr16 complement(603911..607312) [3402 bp, 1133 aa] {ON}...    43   0.001
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...    41   0.002
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...    42   0.002
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    41   0.003
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...    41   0.003
KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8....    41   0.003
Skud_16.307 Chr16 complement(568219..570672,570703..571623) [337...    41   0.005
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...    40   0.006
TDEL0F01030 Chr6 (182054..185287) [3234 bp, 1077 aa] {ON} Anc_8....    40   0.006
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    39   0.010
Smik_16.263 Chr16 complement(479612..482980) [3369 bp, 1122 aa] ...    40   0.011
NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8....    39   0.013
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...    39   0.014
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    38   0.018
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...    39   0.018
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    38   0.018
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    38   0.020
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...    39   0.022
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    38   0.022
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...    39   0.022
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    38   0.022
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...    39   0.024
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    37   0.028
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    38   0.031
KAFR0B02050 Chr2 complement(402767..405958) [3192 bp, 1063 aa] {...    38   0.037
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...    37   0.053
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...    37   0.059
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...    37   0.067
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    36   0.068
CAGL0K02343g Chr11 (209474..212962) [3489 bp, 1162 aa] {ON} simi...    37   0.094
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    36   0.10 
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    36   0.11 
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    35   0.11 
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    36   0.12 
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    36   0.14 
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    36   0.14 
Suva_16.349 Chr16 complement(610937..612562) [1626 bp, 541 aa] {...    36   0.14 
KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598...    36   0.17 
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    35   0.19 
NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256     35   0.21 
Kwal_14.1457 s14 complement(331338..332885) [1548 bp, 515 aa] {O...    35   0.28 
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...    35   0.28 
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    35   0.28 
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    35   0.29 
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    35   0.30 
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    35   0.31 
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...    35   0.32 
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...    35   0.33 
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...    35   0.34 
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    35   0.34 
TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {O...    35   0.38 
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    34   0.40 
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    34   0.41 
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    35   0.43 
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    34   0.46 
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    34   0.47 
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    34   0.48 
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    34   0.50 
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    34   0.54 
NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518     34   0.54 
KLLA0E13487g Chr5 complement(1190615..1191307) [693 bp, 230 aa] ...    33   0.57 
SAKL0H24464g Chr8 complement(2118553..2121405) [2853 bp, 950 aa]...    34   0.58 
SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {...    34   0.58 
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    34   0.62 
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    33   0.64 
NCAS0A02160 Chr1 complement(406753..407991) [1239 bp, 412 aa] {O...    33   0.75 
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    33   0.84 
KAFR0F03940 Chr6 complement(769153..770511) [1359 bp, 452 aa] {O...    33   0.91 
KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weak...    33   0.93 
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...    33   0.95 
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    33   0.96 
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...    33   0.97 
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    33   1.0  
TDEL0C01110 Chr3 complement(188642..190381) [1740 bp, 579 aa] {O...    33   1.0  
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...    33   1.1  
KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON...    33   1.1  
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    33   1.1  
KLTH0G17336g Chr7 (1500141..1501598) [1458 bp, 485 aa] {ON} some...    33   1.1  
KLLA0A02629g Chr1 complement(233822..235501) [1680 bp, 559 aa] {...    33   1.1  
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...    33   1.2  
YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc fin...    33   1.2  
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    33   1.3  
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    33   1.3  
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    32   1.3  
Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W (...    33   1.3  
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    33   1.3  
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    33   1.4  
Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)    33   1.4  
Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)    33   1.4  
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    33   1.4  
KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {...    33   1.5  
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    33   1.5  
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    33   1.6  
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      32   1.7  
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      32   1.8  
NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {O...    32   1.8  
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    32   1.8  
KAFR0D03890 Chr4 complement(752859..759476) [6618 bp, 2205 aa] {...    33   1.9  
TBLA0D02300 Chr4 (581398..584553) [3156 bp, 1051 aa] {ON} Anc_8....    32   1.9  
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    32   1.9  
AGL246W Chr7 (240857..241540) [684 bp, 227 aa] {ON} Syntenic hom...    32   1.9  
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    32   2.0  
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    32   2.4  
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...    32   2.4  
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    32   2.5  
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    32   2.5  
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    32   2.6  
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...    32   2.6  
Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {O...    32   2.7  
KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {...    32   2.8  
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    32   2.8  
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    32   2.9  
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    32   3.0  
NDAI0E03120 Chr5 (662597..663316) [720 bp, 239 aa] {ON} Anc_8.48...    31   3.0  
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    31   3.1  
ZYRO0B01892g Chr2 complement(151888..152991) [1104 bp, 367 aa] {...    32   3.1  
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    32   3.2  
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    32   3.2  
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    31   3.3  
Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON...    31   3.5  
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    31   3.5  
Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON} ...    31   3.6  
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    31   3.7  
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    30   3.7  
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    32   3.7  
TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {O...    32   3.8  
CAGL0K04257g Chr11 complement(392116..393759) [1644 bp, 547 aa] ...    31   3.9  
KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.8...    31   3.9  
NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {O...    31   4.0  
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    31   4.0  
SAKL0G16434g Chr7 (1423039..1423932) [894 bp, 297 aa] {ON} some ...    31   4.1  
SAKL0H11440g Chr8 (982180..982797) [618 bp, 205 aa] {ON} similar...    31   4.3  
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    31   4.3  
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    31   4.4  
Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {...    31   4.6  
KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.14...    31   4.6  
KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some ...    31   4.7  
ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} simil...    31   4.9  
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    31   4.9  
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    31   5.3  
ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]...    31   5.5  
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    31   5.8  
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               30   5.8  
Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar t...    31   5.8  
KNAG0F03980 Chr6 complement(754914..756041) [1128 bp, 375 aa] {O...    31   5.8  
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    31   6.1  
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    31   6.1  
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    31   6.3  
SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]...    31   6.3  
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    30   6.4  
TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON} Anc_...    31   6.4  
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    30   6.4  
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    30   6.5  
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    31   6.6  
Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa] ...    31   6.6  
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    30   6.6  
Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON...    31   6.7  
CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa...    30   6.7  
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    30   6.9  
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    30   7.1  
SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some si...    30   7.2  
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    30   7.2  
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    31   7.2  
KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.1...    30   7.2  
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    30   7.3  
KNAG0J02850 Chr10 complement(545071..546573) [1503 bp, 500 aa] {...    30   7.7  
SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa...    30   8.0  
CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa] ...    30   8.1  
Smik_10.420 Chr10 complement(647997..651776,651798..651836,65184...    30   8.3  
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    30   8.4  
NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144     30   8.4  
NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {O...    30   8.5  
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    30   8.6  
Skud_10.351 Chr10 complement(617553..621332,621389..621469,62146...    30   8.7  
TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa] ...    30   8.9  
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    30   9.3  
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    30   9.5  
KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weak...    30   9.6  
KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON...    29   9.9  

>SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some
           similarities with uniprot|P38704 Saccharomyces
           cerevisiae YHR006W STP2 Transcription factor activated
           by proteolytic processing in response to signals from
           the SPS sensor system for external amino acids activates
           transcription of amino acid permease genes
          Length = 344

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/344 (81%), Positives = 280/344 (81%)

Query: 1   MGYIQFDKVNIPQDNLVSXXXXXXXXXXXXDEREQALQVENDNDKXXXXXXXXXXXTNFN 60
           MGYIQFDKVNIPQDNLVS            DEREQALQVENDNDK           TNFN
Sbjct: 1   MGYIQFDKVNIPQDNLVSLGLLNKQLQKLKDEREQALQVENDNDKSSSVSGQGISSTNFN 60

Query: 61  LGSLDEFLQDEKFGFLLQGVSPSKEHGIEETNNSPGHTTDLEKNDTDASEFWNLFMSGXX 120
           LGSLDEFLQDEKFGFLLQGVSPSKEHGIEETNNSPGHTTDLEKNDTDASEFWNLFMSG  
Sbjct: 61  LGSLDEFLQDEKFGFLLQGVSPSKEHGIEETNNSPGHTTDLEKNDTDASEFWNLFMSGQT 120

Query: 121 XXXXXXXXXXXXXXXXXXFEPSLDEEICGLRFNTMXXXXXXXXXXXXXXXXXXXXXEDRK 180
                             FEPSLDEEICGLRFNTM                     EDRK
Sbjct: 121 DSVSSSILTSSLSNQSSIFEPSLDEEICGLRFNTMTTTNLSSPPSTLSSNTSTLSLEDRK 180

Query: 181 LIPTSLSETPCRTVGTSSTSYKVHKKKHMTRSIRQELIALSPELGAVHREIFQCPHCPSN 240
           LIPTSLSETPCRTVGTSSTSYKVHKKKHMTRSIRQELIALSPELGAVHREIFQCPHCPSN
Sbjct: 181 LIPTSLSETPCRTVGTSSTSYKVHKKKHMTRSIRQELIALSPELGAVHREIFQCPHCPSN 240

Query: 241 FKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIHFVYPVGVVK 300
           FKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIHFVYPVGVVK
Sbjct: 241 FKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIHFVYPVGVVK 300

Query: 301 SQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGLFEVKNEEQ 344
           SQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGLFEVKNEEQ
Sbjct: 301 SQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGLFEVKNEEQ 344

>KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some
           similarities with uniprot|P38704 Saccharomyces
           cerevisiae YHR006W STP2 Transcription factor activated
           by proteolytic processing in response to signals from
           the SPS sensor system for external amino acids activates
           transcription of amino acid permease genes
          Length = 296

 Score =  208 bits (529), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 133/347 (38%), Positives = 167/347 (48%), Gaps = 66/347 (19%)

Query: 1   MGYIQFDKVNIPQDNLVSXXXXXXXXXXXXDEREQALQVENDNDKXXXXXXXXXXXTNFN 60
           MGYIQFDKV++P+DN+VS              +   L                       
Sbjct: 1   MGYIQFDKVDVPEDNVVSLGLLSRQLQKQQLGQLGELA---------------------G 39

Query: 61  LGSLDEFLQDEKFGFLLQ-GVSPSKEHGIE---ETNNSPGHTTDLEKNDTDASEFWNLFM 116
           LG  DE+  +   GF  + G   S E+G E   E      HTT L       ++ W+  +
Sbjct: 40  LG--DEYASEYASGFGREYGGEYSGEYGHEYRGEYARKSVHTT-LSATSASIAQTWHALL 96

Query: 117 SGXXXXXXXXXXXXXXXXXXXXFEPSLDEEICGLRFNTMXXXXXXXXXXXXXXXXXXXXX 176
                                  +PSLDEE CG+RF+T+                     
Sbjct: 97  G------------FDHYDSASDGKPSLDEETCGVRFDTVPAAIAAASMASSSSSSCT--- 141

Query: 177 EDRKLIPTS-LSETPCRTVGTSSTSYKVHKKKHMTRSIRQELIALSPELGAVHREIFQCP 235
           E   L+P S  S T C + G                       ALS   GA  ++ FQC 
Sbjct: 142 ERSALVPASPASSTECGSAGAKPA-------------------ALS---GAAMQQPFQCA 179

Query: 236 HCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIHFVYP 295
            CPS+FKVKGYLTRH+KKHL  KD+ CP+WS DC+CH +GEFSRKDT+KTHLKS+HFVYP
Sbjct: 180 FCPSSFKVKGYLTRHMKKHLVTKDFQCPFWSEDCRCHASGEFSRKDTYKTHLKSVHFVYP 239

Query: 296 VGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGLFEVKNE 342
           VGV KSQR  SKGRCAAC+ EF SN  WL  H+ET  C  L ++K+E
Sbjct: 240 VGVAKSQRGQSKGRCAACYHEFASNAEWLLRHVETRQCEALVKLKHE 286

>Kwal_34.15946 s34 complement(130149..130988) [840 bp, 279 aa] {ON}
           YDR463W (STP1) - Nuclear-localized protein containing
           zinc finger motifs [contig 272] FULL
          Length = 279

 Score =  192 bits (488), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 120/355 (33%), Positives = 166/355 (46%), Gaps = 97/355 (27%)

Query: 1   MGYIQFDKVNIPQDNLVSXXXXXXXXXXXXDEREQALQVENDNDKXXXXXXXXXXXTNFN 60
           MGYIQFD+V++P+DN+VS                                          
Sbjct: 1   MGYIQFDRVDVPEDNVVS------------------------------------------ 18

Query: 61  LGSLDEFLQDEKFGFLLQGVSPSKEHGIEETNNSPGHTTDLEKNDTDASEFWNLFMSGXX 120
           LG L++ L+ ++    +  +        +E ++ P HT  L       ++ W   +    
Sbjct: 19  LGLLNKQLERQRGSVEMGEIGAEMGVTCDEIDSKPVHTR-LCATSASIAQMWESLLG--- 74

Query: 121 XXXXXXXXXXXXXXXXXXFEPSLDEEICGLRFNTMXXXXXXXXXXXXXXXXXXXXXEDRK 180
                              +PSLDEE CGLRF+T+                         
Sbjct: 75  --------FEHYSEVPNAGQPSLDEETCGLRFDTVPS----------------------- 103

Query: 181 LIPTSLSETPCRTVGTSSTSYKV-------HKKKHMTR---SIRQELIALSPELGAVHR- 229
            + +  ++       +S+ SY V       H+  + TR    +  +  +      A++  
Sbjct: 104 -VESFCTDADLAASASSTCSYSVVDDLDHVHQPGNGTRPPACLETQPSSFGDTPSAINTP 162

Query: 230 --------EIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKD 281
                    +FQC  CPSNFKVKGYLTRH+KKHL  KD+ CP+WS DC+CH +GEFSRKD
Sbjct: 163 AAAAAASTAMFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKD 222

Query: 282 TFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGL 336
           T+KTHLKSIHFVYPVGV KSQRS S GRCAAC+QEF +N  WL +H+E+  C GL
Sbjct: 223 TYKTHLKSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGL 277

>AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if
           syntenic homolog of Saccharomyces cerevisiae YHR006W
           (STP2)
          Length = 274

 Score =  173 bits (438), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 101/132 (76%), Gaps = 2/132 (1%)

Query: 213 IRQELIALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCH 272
           +  E  A SP   A    +++C +CPSNFKV+GYLTRHLKKH+P KD+ CPYWS DC+CH
Sbjct: 138 VAVEAPAQSPTF-ARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCH 196

Query: 273 TTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGI 332
           ++GEFSRKDTF+THLKSIHFVYPVG  K+QR+ S GRCAAC+++F +N  WL  HI+ G 
Sbjct: 197 SSGEFSRKDTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGR 256

Query: 333 CRGLFEVKNEEQ 344
           C   F+++ +E+
Sbjct: 257 CTE-FKLRQDEK 267

>Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar to
           Ashbya gossypii AFR531W
          Length = 349

 Score =  175 bits (443), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 92/112 (82%), Gaps = 1/112 (0%)

Query: 231 IFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSI 290
           I++CP+CPS+FKV+GYLTRHLKKH+PNK + CPYWS DC+CH +GEFSRKDTF+THLKSI
Sbjct: 233 IYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSI 292

Query: 291 HFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGLFEVKNE 342
           HFVYPVG  K+QR+ S GRCAAC++ F SN  WL  HI+   C+  F++K E
Sbjct: 293 HFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKD-FKIKLE 343

>ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} similar
           to uniprot|Q00947 Saccharomyces cerevisiae YDR463W STP1
           and uniprot|P38704 Saccharomyces cerevisiae YHR006W STP2
           Transcription factor
          Length = 587

 Score =  135 bits (340), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 80/116 (68%), Gaps = 4/116 (3%)

Query: 225 GAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYW----SPDCKCHTTGEFSRK 280
           GA    +F C +C + FK++GYLTRH+KKH   K YHCP++     P+ +CH +G FSR+
Sbjct: 197 GANSEGLFVCHYCDAKFKIRGYLTRHIKKHAIQKAYHCPFFMGEAPPELRCHNSGGFSRR 256

Query: 281 DTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGL 336
           DT+KTHL++ HF+YP GV  S+R+ S G C  C Q FE+   W+ +HIE+G CRGL
Sbjct: 257 DTYKTHLRTRHFIYPKGVKPSERNKSAGNCGQCGQSFENTDKWVEQHIESGECRGL 312

>AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR463W
           (STP1)
          Length = 544

 Score =  132 bits (331), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 80/116 (68%), Gaps = 4/116 (3%)

Query: 227 VHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWS----PDCKCHTTGEFSRKDT 282
           + +E F C +C + F+++GYLTRH+KKH   K YHCP+++    P+ +CHTTG FSR+DT
Sbjct: 147 LSKERFVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSHVPPETRCHTTGGFSRRDT 206

Query: 283 FKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGLFE 338
           +KTHL+S HF+YP GV    R  S G CA C + FE+   W+ +HIE+G C GL E
Sbjct: 207 YKTHLRSRHFIYPEGVKTQDRGKSCGHCAHCGKWFENTSTWIEKHIESGYCTGLPE 262

>Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}
           similar to Ashbya gossypii AFR461C
          Length = 562

 Score =  132 bits (331), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 82/120 (68%), Gaps = 4/120 (3%)

Query: 223 ELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWS----PDCKCHTTGEFS 278
           E G   +E + C +C + F+++GYLTRH+KKH   K YHCP+++    P+ +CHTTG FS
Sbjct: 154 EDGEGGKEKYVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNGCSPPETRCHTTGGFS 213

Query: 279 RKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGLFE 338
           R+DT+KTHL+S HF+YP GV    R+ S G CA C + FE+   W+ +HIE+G C GL E
Sbjct: 214 RRDTYKTHLRSRHFIYPEGVKTQDRNRSPGHCAHCGKWFENTSKWIEKHIESGYCTGLPE 273

>Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa]
           {ON} complement(144388..146058) [1671 nt, 557 aa]
          Length = 556

 Score =  131 bits (329), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 97/162 (59%), Gaps = 6/162 (3%)

Query: 183 PTSLSETPC--RTVGTSSTSYKVHKKKHMTRSIRQELIALSPELGAVHREIFQCPHCPSN 240
           P SL  TP    ++   STS     + +   +  +     + +L + +   F C +C ++
Sbjct: 129 PASLPHTPSTMSSLTPRSTSISSINRSNTLSTSSRGPTTTNKKLDSKNDGEFVCHYCDAS 188

Query: 241 FKVKGYLTRHLKKHLPNKDYHCPYWS----PDCKCHTTGEFSRKDTFKTHLKSIHFVYPV 296
           F+++GYLTRH+KKH   K Y CP+++    PD +CHT+G FSR+DT+KTHLK  HF+YP 
Sbjct: 189 FRIRGYLTRHIKKHAIQKAYCCPFYNKSSPPDIRCHTSGGFSRRDTYKTHLKVRHFMYPD 248

Query: 297 GVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGLFE 338
           GV    RS S G CA C + FE+   W+ +HIETG C+GL E
Sbjct: 249 GVKPQDRSKSSGHCAQCGEFFENTENWVEQHIETGNCKGLPE 290

>SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON}
           uniprot|Q875P4 Saccharomyces kluyveri STP1
          Length = 517

 Score =  129 bits (325), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 79/115 (68%), Gaps = 4/115 (3%)

Query: 228 HREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWS----PDCKCHTTGEFSRKDTF 283
            R  + C +C + F+++GYLTRH+KKH   K YHCP+++    P+ +CHTTG FSR+DT+
Sbjct: 158 QRGKYVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSKLPPESRCHTTGGFSRRDTY 217

Query: 284 KTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGLFE 338
           KTHLKS HF+YP G+   +R+ S G C+ C + FE+   W+  HIETG C GL E
Sbjct: 218 KTHLKSRHFIYPKGIKTQERNKSSGNCSHCGEWFENTEKWIENHIETGDCTGLPE 272

>TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.586
           YHR006W
          Length = 484

 Score =  129 bits (323), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 56/115 (48%), Positives = 78/115 (67%), Gaps = 4/115 (3%)

Query: 226 AVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSP----DCKCHTTGEFSRKD 281
           A  +E+F C +C + F+++GYLTRH+KKH   K YHCP++S     D +CH +G FSR+D
Sbjct: 132 AKDKEVFVCHYCDAKFRIRGYLTRHIKKHAIQKAYHCPFFSAEAPQDMRCHNSGGFSRRD 191

Query: 282 TFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGL 336
           T+KTHL++ HF YP GV    R+ S G C+ C Q FE+   W+ +HIETG C+ L
Sbjct: 192 TYKTHLRARHFTYPKGVKPQDRTKSSGHCSQCEQFFENTDQWVEQHIETGECKAL 246

>KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {ON}
           Anc_5.586 YHR006W
          Length = 600

 Score =  129 bits (325), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 75/111 (67%), Gaps = 4/111 (3%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSP----DCKCHTTGEFSRKDTFKTHL 287
           + C +C + FK++GYLTRH+KKH  +K YHCP+++     + KCH TG FSR+DT+KTHL
Sbjct: 199 YICHYCDATFKIRGYLTRHIKKHAIDKAYHCPFFNATLGTELKCHNTGGFSRRDTYKTHL 258

Query: 288 KSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGLFE 338
           K+ HFVYP GV  S RS S G CA C   FES   W+ EHIE G C  L E
Sbjct: 259 KTRHFVYPNGVKPSDRSKSNGTCAHCGDYFESADKWIKEHIEGGQCSSLPE 309

>Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W
           (REAL)
          Length = 535

 Score =  126 bits (317), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 75/111 (67%), Gaps = 4/111 (3%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYW----SPDCKCHTTGEFSRKDTFKTHL 287
           + C +C + F+++GYLTRH+KKH   K YHCP++    S + +CHT+G FSR+DT+KTHL
Sbjct: 205 YVCHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDDSISQELRCHTSGGFSRRDTYKTHL 264

Query: 288 KSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGLFE 338
           KS HF YP GV    R+ S G CA C + F ++  W+  HIE G C+GL E
Sbjct: 265 KSRHFNYPEGVKPQDRNKSSGACAQCGEHFSTSESWVENHIEAGSCKGLPE 315

>Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)
          Length = 542

 Score =  126 bits (317), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 75/111 (67%), Gaps = 4/111 (3%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYW----SPDCKCHTTGEFSRKDTFKTHL 287
           + C +C + F+++GYLTRH+KKH   K YHCP++    S + +CHT+G FSR+DT+KTHL
Sbjct: 204 YICHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDNSISQELRCHTSGGFSRRDTYKTHL 263

Query: 288 KSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGLFE 338
           KS HF YP GV    R+ S G CA C + F ++  W+  HIE G C+GL E
Sbjct: 264 KSRHFTYPEGVKPQDRNKSSGACAQCGEYFHTSESWVENHIEAGSCKGLPE 314

>NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {ON} 
          Length = 650

 Score =  126 bits (317), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 51/109 (46%), Positives = 77/109 (70%), Gaps = 4/109 (3%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWS----PDCKCHTTGEFSRKDTFKTHL 287
           F C +C + F+++GYLTRH+KKH   K YHCP+++    P+ +CH +G FSR+DT+KTHL
Sbjct: 273 FVCHYCDAKFRIRGYLTRHIKKHAIEKAYHCPFFNNDALPELRCHNSGGFSRRDTYKTHL 332

Query: 288 KSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGL 336
           K+ HF+YP GV    R+ S G C+ C + F S  +W+++H+E+G C+ L
Sbjct: 333 KARHFIYPKGVKPQDRNKSSGHCSQCGEFFNSTDIWISKHLESGNCKAL 381

>NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {ON}
           Anc_5.586
          Length = 532

 Score =  125 bits (314), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 74/111 (66%), Gaps = 4/111 (3%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDC----KCHTTGEFSRKDTFKTHL 287
           F C +C + F+++GYLTRH+KKH   K YHCP+++ D     +CH TG FSR+DT+KTHL
Sbjct: 183 FICHYCDAKFRIRGYLTRHIKKHAVEKAYHCPFFNSDILSESRCHNTGGFSRRDTYKTHL 242

Query: 288 KSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGLFE 338
           K+ HFVYP G+    R+ S G C+ C Q F +   W+  HIE+G C GL E
Sbjct: 243 KARHFVYPKGMKPQDRAKSSGHCSQCGQSFTTADDWIKNHIESGDCHGLPE 293

>Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W
           (REAL)
          Length = 545

 Score =  124 bits (312), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 74/111 (66%), Gaps = 4/111 (3%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYW----SPDCKCHTTGEFSRKDTFKTHL 287
           + C +C S F+++GYLTRH+KKH   K YHCP++    S + +CH +G FSR+DT+KTHL
Sbjct: 204 YICHYCDSRFRIRGYLTRHIKKHAKRKAYHCPFFDGSISQELRCHNSGGFSRRDTYKTHL 263

Query: 288 KSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGLFE 338
           KS HF YP G+    R+ S G CA C + F S+  W+  HIE G C+GL E
Sbjct: 264 KSRHFNYPEGIKPQYRNKSSGACAQCGEYFSSSESWVENHIEAGSCKGLPE 314

>KLTH0G05104g Chr7 (412304..413920) [1617 bp, 538 aa] {ON} similar
           to uniprot|Q00947 Saccharomyces cerevisiae YDR463W STP1
           and uniprot|P38704 Saccharomyces cerevisiae YHR006W STP2
           Transcription factor
          Length = 538

 Score =  124 bits (311), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 53/109 (48%), Positives = 75/109 (68%), Gaps = 4/109 (3%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDC----KCHTTGEFSRKDTFKTHL 287
           F C +C + F ++GYLTRH+KKH   K Y+CPY++ D     +CHTTG FSR+DT+KTHL
Sbjct: 159 FVCHYCNAKFYIRGYLTRHIKKHAVEKAYYCPYFNADAPKDQRCHTTGGFSRRDTYKTHL 218

Query: 288 KSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGL 336
           +S HF+ P GV   +++ S GRCA C ++F+    W+  H+E G C+GL
Sbjct: 219 RSRHFICPKGVRSQEKAKSSGRCAHCNEQFDKTDDWIKSHVEAGECKGL 267

>YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}
           STP2Transcription factor, activated by proteolytic
           processing in response to signals from the SPS sensor
           system for external amino acids; activates transcription
           of amino acid permease genes
          Length = 541

 Score =  124 bits (311), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 54/111 (48%), Positives = 74/111 (66%), Gaps = 4/111 (3%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYW----SPDCKCHTTGEFSRKDTFKTHL 287
           + C +C + F+++GYLTRH+KKH   K YHCP++    S + +CHT+G FSR+DT+KTHL
Sbjct: 204 YICHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDNSISQELRCHTSGGFSRRDTYKTHL 263

Query: 288 KSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGLFE 338
           KS HF YP GV    R+ S G C  C + F ++  W+  HIE G C+GL E
Sbjct: 264 KSRHFTYPEGVKPQDRNKSPGVCTQCGEHFSTSESWVENHIEAGSCKGLPE 314

>Kwal_47.18337 s47 complement(787992..789602) [1611 bp, 536 aa] {ON}
           YDR463W (STP1) - Nuclear-localized protein containing
           zinc finger motifs [contig 196] FULL
          Length = 536

 Score =  123 bits (309), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 54/109 (49%), Positives = 75/109 (68%), Gaps = 4/109 (3%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDC----KCHTTGEFSRKDTFKTHL 287
           F C +C + F ++GYLTRH+KKH   K Y+CP+++ D     +CHTTG FSR+DT+KTHL
Sbjct: 157 FVCHYCNAEFYIRGYLTRHIKKHAVEKAYYCPFFNADAPKDARCHTTGGFSRRDTYKTHL 216

Query: 288 KSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGL 336
           +S HFV P GV   +++ S GRCA C + FE+   W+  H+E G C+GL
Sbjct: 217 RSRHFVCPKGVRSQEKAKSSGRCAHCNEHFENTDDWIKGHVEAGECKGL 265

>TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON}
           Anc_5.586 YHR006W
          Length = 481

 Score =  122 bits (305), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 64/158 (40%), Positives = 91/158 (57%), Gaps = 12/158 (7%)

Query: 186 LSETPCRTV-GTSSTSYKVHKKKHMTRSIRQELIALSPELGAVHREIFQCPHCPSNFKVK 244
           + ETP   + GT S+  K    + +  S+   L +    +G      F C +C + F+++
Sbjct: 59  IPETPASAISGTPSSDMKSPSNRSVGSSL--SLYSNQKTMGE-----FVCHYCDAVFRIR 111

Query: 245 GYLTRHLKKHLPNKDYHCPYW----SPDCKCHTTGEFSRKDTFKTHLKSIHFVYPVGVVK 300
           GYLTRH+KKH   K +HCP++    S   KCHTTG FSR+DT+K HLK  HF+YP GV  
Sbjct: 112 GYLTRHIKKHAIQKAFHCPFYNDSASSKLKCHTTGGFSRRDTYKAHLKIRHFMYPTGVKP 171

Query: 301 SQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGLFE 338
             R  S G C+ C + F++   W+  HIE+G C+GL E
Sbjct: 172 RDRHKSSGYCSQCGEFFKTTERWVETHIESGNCKGLPE 209

>NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa]
           {ON} Anc_5.586
          Length = 367

 Score =  119 bits (298), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 52/109 (47%), Positives = 75/109 (68%), Gaps = 4/109 (3%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWS----PDCKCHTTGEFSRKDTFKTHL 287
           + C +C + F++KGYLTRH+KKH   K YHCP++S    P+ +CH +G FSR+DT+KTHL
Sbjct: 96  YVCHYCQAKFRIKGYLTRHIKKHAVEKAYHCPFFSTESPPELRCHNSGGFSRRDTYKTHL 155

Query: 288 KSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGL 336
           K+ H ++P G+   +R+ SKG CA C + F +   W+  HIE+G C GL
Sbjct: 156 KARHILFPKGIRPHERNKSKGHCAQCGEFFTNFENWVELHIESGDCSGL 204

>KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5.586
           YHR006W
          Length = 235

 Score =  115 bits (288), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 77/110 (70%), Gaps = 4/110 (3%)

Query: 231 IFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWS----PDCKCHTTGEFSRKDTFKTH 286
           ++ C +C ++F+++GYLTRH+KKH   K YHCP+++     + KCH +G FSR+DT+KTH
Sbjct: 34  MYVCHYCDASFRIRGYLTRHIKKHSIEKAYHCPFYNEHQPSELKCHNSGGFSRRDTYKTH 93

Query: 287 LKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGL 336
           LKS H +YP GV +++R+ S G CA C + F++   W+  HIE+G C  L
Sbjct: 94  LKSRHILYPKGVKQNERNKSTGHCAQCGEFFQNLDHWVETHIESGECTAL 143

>Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463W
           (REAL)
          Length = 528

 Score =  119 bits (298), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 80/122 (65%), Gaps = 7/122 (5%)

Query: 230 EIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWS----PDCKCHTTGEFSRKDTFKT 285
           E F C +C + F+++GYLTRH+KKH   K YHCP+++    PD +CH +G FSR+DT+KT
Sbjct: 158 EEFICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNNATPPDLRCHNSGGFSRRDTYKT 217

Query: 286 HLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGL---FEVKNE 342
           HLK+ H +YP GV    R+ S G CA C + F +   ++  HIE+G C+ L   +  KNE
Sbjct: 218 HLKARHVLYPKGVRPQDRNKSSGHCAQCGEYFSTIENFVESHIESGDCKALPQGYTKKNE 277

Query: 343 EQ 344
           ++
Sbjct: 278 KR 279

>NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586
          Length = 454

 Score =  118 bits (296), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 53/109 (48%), Positives = 72/109 (66%), Gaps = 4/109 (3%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWS----PDCKCHTTGEFSRKDTFKTHL 287
           + C HC + F++KGYLTRHLKKH   K Y CP+++    P+ +CH +G FSR+DT+KTHL
Sbjct: 100 YVCHHCNAQFRIKGYLTRHLKKHATEKAYTCPFFNTDSPPELRCHNSGGFSRRDTYKTHL 159

Query: 288 KSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGL 336
           KS H ++P GV    R+ S G CA C   F+S   W+  HIE+G C+ L
Sbjct: 160 KSRHILFPKGVRPQDRNKSVGHCAQCGDFFDSCENWVETHIESGKCKAL 208

>YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}
           STP1Transcription factor, undergoes proteolytic
           processing by SPS (Ssy1p-Ptr3p-Ssy5p)-sensor component
           Ssy5p in response to extracellular amino acids;
           activates transcription of amino acid permease genes and
           may have a role in tRNA processing
          Length = 519

 Score =  119 bits (297), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 80/122 (65%), Gaps = 7/122 (5%)

Query: 230 EIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWS----PDCKCHTTGEFSRKDTFKT 285
           E F C +C + F+++GYLTRH+KKH   K YHCP+++    PD +CH +G FSR+DT+KT
Sbjct: 158 EEFICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNSATPPDLRCHNSGGFSRRDTYKT 217

Query: 286 HLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGL---FEVKNE 342
           HLK+ H +YP GV    R+ S G CA C + F +   ++  HIE+G C+ L   +  KNE
Sbjct: 218 HLKARHVLYPKGVKPQDRNKSSGHCAQCGEYFSTIENFVENHIESGDCKALPQGYTKKNE 277

Query: 343 EQ 344
           ++
Sbjct: 278 KR 279

>KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5.586
           YHR006W
          Length = 314

 Score =  115 bits (287), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 53/111 (47%), Positives = 73/111 (65%), Gaps = 4/111 (3%)

Query: 230 EIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSP----DCKCHTTGEFSRKDTFKT 285
           E F C +C + F+++GYLTRH+KKH   K + CP++      D +CH +G FSR+DT+KT
Sbjct: 59  EPFVCHYCDARFRMRGYLTRHIKKHAIEKAFRCPFFQRGQPRDLQCHPSGGFSRRDTYKT 118

Query: 286 HLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGL 336
           HLK  H +YP GV  S R+ S G C AC +  ES   W+ +HIE+G C+GL
Sbjct: 119 HLKVKHVLYPPGVRPSDRNRSGGHCTACGEYTESLHEWVEQHIESGACQGL 169

>CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some
           similarities with uniprot|Q00947 Saccharomyces
           cerevisiae YDR463w STP1
          Length = 359

 Score =  115 bits (288), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 75/115 (65%), Gaps = 6/115 (5%)

Query: 229 REIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWS----PDCKCHTTGEFSRKDTFK 284
           +E F C +C + FK++GYLTRH+KKH   K Y+CPY++    PD +CH  G FSR+DT+K
Sbjct: 38  QEEFVCHYCDARFKIRGYLTRHIKKHALQKAYYCPYYNEKAPPDLRCHNNGGFSRRDTYK 97

Query: 285 THLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNV-VWLNEHIETGICRGLFE 338
            H+K+ H +YP GV   +R  S G C+ C  E+  NV  W+ +H+E+G C  L E
Sbjct: 98  AHMKTRHIMYPSGVKSQERFKSSGHCSHC-GEYSPNVEFWVEDHVESGQCTALPE 151

>CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some
           similarities with uniprot|P38704 Saccharomyces
           cerevisiae YHR006w SPT2 or uniprot|Q00947 Saccharomyces
           cerevisiae YDR463w STP1
          Length = 688

 Score =  116 bits (291), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 54/129 (41%), Positives = 80/129 (62%), Gaps = 5/129 (3%)

Query: 212 SIRQELIALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWS----P 267
           SI+++  A S  L    +E F C +C + F+++GYLTRH+KKH   K YHCP+++    P
Sbjct: 179 SIKKDTKAKSETLDDDEKE-FVCHYCDAKFRIRGYLTRHIKKHAIEKAYHCPFYNGQEVP 237

Query: 268 DCKCHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEH 327
             +CH +G FSR+DT+KTH+K+ H +YP GV  + R+ S G CA C         ++ +H
Sbjct: 238 SKRCHNSGGFSRRDTYKTHMKARHLIYPEGVNFASRNESSGHCAKCGGFIAKAATYVEDH 297

Query: 328 IETGICRGL 336
           IE+G C  L
Sbjct: 298 IESGQCPAL 306

>KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {ON}
           weakly similar to uniprot|Q00947 Saccharomyces
           cerevisiae YDR463W STP1 Transcription factor activated
           by proteolytic processing in response to signals from
           the SPS sensor system for external amino acids activates
           transcription of amino acid permease genes and may have
           a role in tRNA processing
          Length = 623

 Score =  116 bits (290), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 67/110 (60%), Gaps = 4/110 (3%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDC----KCHTTGEFSRKDTFKTHL 287
           F C +C + FK++GYLTRH+KKH   K YHCP+W        +CH+TG FSR+D++KTHL
Sbjct: 242 FVCHYCDAEFKMRGYLTRHIKKHAIEKAYHCPFWDASLPSEKRCHSTGGFSRRDSYKTHL 301

Query: 288 KSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGLF 337
           +S HF+YP  V    R  S G C  C + F+S   W+  HIE   C  + 
Sbjct: 302 RSRHFIYPDNVKNVDRVNSHGHCGRCKKHFDSTNEWIEHHIENRECEAIL 351

>Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463W
           (REAL)
          Length = 514

 Score =  115 bits (287), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 79/122 (64%), Gaps = 7/122 (5%)

Query: 230 EIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWS----PDCKCHTTGEFSRKDTFKT 285
           E F C +C + F+++GYLTRH+KKH   K YHCP+++    PD +CH +G FSR+DT+KT
Sbjct: 158 EEFICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNGATPPDLRCHNSGGFSRRDTYKT 217

Query: 286 HLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGL---FEVKNE 342
           HLK+ H +Y  GV    R+ S G CA C + F +   ++  HIE+G C+ L   +  KNE
Sbjct: 218 HLKARHVLYSKGVKPQDRNKSSGHCAQCGEYFSTIENFVESHIESGDCKALPQGYTKKNE 277

Query: 343 EQ 344
           ++
Sbjct: 278 KR 279

>Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463W
           (REAL)
          Length = 516

 Score =  114 bits (286), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 78/122 (63%), Gaps = 7/122 (5%)

Query: 230 EIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWS----PDCKCHTTGEFSRKDTFKT 285
           E F C +C + F+++GYLTRH+KKH   K YHCP+++    PD +CH +G FSR+DT+KT
Sbjct: 158 EEFICHYCDATFRIRGYLTRHIKKHAIRKAYHCPFFNCATPPDLRCHNSGGFSRRDTYKT 217

Query: 286 HLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGL---FEVKNE 342
           HLK+ H +Y  GV    R+ S G CA C + F     ++  HIE+G C+ L   +  KNE
Sbjct: 218 HLKARHVLYSKGVKPQDRNKSSGHCAQCGEYFPVIENFVENHIESGDCKALPQGYTKKNE 277

Query: 343 EQ 344
           ++
Sbjct: 278 KR 279

>TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON}
           Anc_5.586 YHR006W
          Length = 312

 Score =  110 bits (276), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 77/118 (65%), Gaps = 7/118 (5%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWS----PDCKCHTTGEFSRKDTFKTHL 287
           + C +C ++F++  YLTRH+KKH   K + CP+++     D +CH +G FSRKDTFK HL
Sbjct: 13  YICHYCDASFRLMSYLTRHIKKHAIEKAFKCPFYNEKLPADLRCHVSGGFSRKDTFKMHL 72

Query: 288 KSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGL---FEVKNE 342
           K  HF+YP G+ +++RS   G CA C + F ++  W++ HI TG C+ L   F +K+E
Sbjct: 73  KCRHFIYPKGIKQNERSKYSGNCAQCGEFFHNSNDWMDNHISTGQCKSLPQGFRMKSE 130

>KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON}
           Anc_5.586 YHR006W
          Length = 442

 Score =  108 bits (271), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 71/121 (58%), Gaps = 4/121 (3%)

Query: 220 LSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDC----KCHTTG 275
            +PE      E F C +C + FK++GYLTRH++KH   K + CPY++       +CH+TG
Sbjct: 110 FTPENKKNDEEAFICHYCDAKFKIRGYLTRHIRKHAIEKAFKCPYFNATLPKTLRCHSTG 169

Query: 276 EFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRG 335
            FSR+DTFK HLKS HF++P  V    +++S G C  C   F     W+N+H+    CR 
Sbjct: 170 GFSRRDTFKIHLKSRHFIFPNDVKVPNKTHSGGNCKHCQGSFSDIETWINDHVGLRRCRA 229

Query: 336 L 336
           +
Sbjct: 230 I 230

>Kwal_26.9300 s26 (1156241..1157155) [915 bp, 304 aa] {ON} YLR375W
           (STP3) - Involved in pre-tRNA splicing [contig 72] FULL
          Length = 304

 Score = 82.8 bits (203), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 61/126 (48%), Gaps = 27/126 (21%)

Query: 233 QCPHCPSNFKVKGYLTRHLKKHLPNKD------------YHCPYWS----PDCK------ 270
           +CP C   F     L RH K+H  ++D            + CPY S    PD +      
Sbjct: 174 KCPVCGRGFTRHNDLLRHRKRHWKDEDNSCSSYNPNQGTFRCPYKSRIAYPDSRSKGLAS 233

Query: 271 -----CHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLN 325
                CH TG+FSR DTFK HL+++HF YP G  K  R +  G+C  C QEF S   WLN
Sbjct: 234 LGTTSCHATGKFSRCDTFKNHLRALHFEYPPGTRKKDRGHVPGKCKHCGQEFASVNTWLN 293

Query: 326 EHIETG 331
            H+  G
Sbjct: 294 THVGKG 299

>Smik_12.462 Chr12 (810413..811438) [1026 bp, 341 aa] {ON} YLR375W
           (REAL)
          Length = 341

 Score = 73.6 bits (179), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 33/58 (56%), Positives = 39/58 (67%)

Query: 271 CHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHI 328
           CH TG FSR DTFK HLK++HF YP G  K  R+   GRC  C  +FE+  VWLNEH+
Sbjct: 275 CHQTGVFSRCDTFKNHLKALHFEYPPGTKKKDRNVVPGRCKHCGLKFENVDVWLNEHV 332

>YLR375W Chr12 (871697..872728) [1032 bp, 343 aa] {ON}
           STP3Zinc-finger protein of unknown function, possibly
           involved in pre-tRNA splicing and in uptake of
           branched-chain amino acids
          Length = 343

 Score = 73.6 bits (179), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 33/58 (56%), Positives = 39/58 (67%)

Query: 271 CHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHI 328
           CH TG FSR DTFK HLK++HF YP G  K  R+   GRC  C  +FE+  VWLNEH+
Sbjct: 277 CHQTGVFSRCDTFKNHLKALHFEYPPGTKKKDRNVVPGRCKHCGLKFENVDVWLNEHV 334

>Skud_12.460 Chr12 (811208..812242) [1035 bp, 344 aa] {ON} YLR375W
           (REAL)
          Length = 344

 Score = 73.6 bits (179), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 33/58 (56%), Positives = 39/58 (67%)

Query: 271 CHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHI 328
           CH TG FSR DTFK HLK++HF YP G  K  R+   GRC  C  +FE+  VWLNEH+
Sbjct: 278 CHQTGVFSRCDTFKNHLKALHFEYPPGTKKKDRNVVPGRCKHCGLKFENVDVWLNEHV 335

>Suva_10.491 Chr10 (836816..837094,837128..837883) [1035 bp, 344 aa]
           {ON} YLR375W (REAL)
          Length = 344

 Score = 73.6 bits (179), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 33/58 (56%), Positives = 39/58 (67%)

Query: 271 CHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHI 328
           CH TG FSR DTFK HLK++HF YP G  K  R+   GRC  C  +FE+  VWLNEH+
Sbjct: 278 CHQTGVFSRCDTFKNHLKALHFEYPPGTKKKDRNIVPGRCKHCGLKFENVDVWLNEHV 335

>SAKL0H03894g Chr8 complement(357602..358678) [1077 bp, 358 aa] {ON}
           similar to uniprot|Q7LH06 Saccharomyces cerevisiae
           YDL048C STP4 Protein involved in pre-tRNA splicing and
           in uptake of branched-chain amino acids
          Length = 358

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 41/65 (63%), Gaps = 2/65 (3%)

Query: 271 CHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIET 330
           CH TG FSR DTFK HLK++HF YP G  K  R    GRC  C ++F +  +WLNEH+  
Sbjct: 292 CHATGIFSRCDTFKNHLKALHFEYPPGTKKKDRGSVHGRCKHCGEKFANVDIWLNEHV-- 349

Query: 331 GICRG 335
           G C G
Sbjct: 350 GKCCG 354

>SAKL0H26224g Chr8 (2308056..2308739) [684 bp, 227 aa] {ON} some
           similarities with uniprot|Q7LH06 Saccharomyces
           cerevisiae YDL048C STP4 Protein involved in pre-tRNA
           splicing and in uptake of branched-chain amino acids
          Length = 227

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/85 (43%), Positives = 47/85 (55%), Gaps = 8/85 (9%)

Query: 255 LPNKDYH------CPYWSPDCKCHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKG 308
           L NK YH       P ++ DC  H TG F+R DT+K HLK++HF YP G+ K  R +S G
Sbjct: 135 LDNKLYHPQNLGQVPMYATDC--HKTGLFTRVDTYKYHLKALHFEYPDGISKQDREFSPG 192

Query: 309 RCAACFQEFESNVVWLNEHIETGIC 333
            C  C   F S   WL +HI +  C
Sbjct: 193 HCKHCHAHFPSVHAWLQDHILSHKC 217

>KLLA0F07073g Chr6 (675221..676897) [1677 bp, 558 aa] {ON} some
           similarities with uniprot|Q7LH06 Saccharomyces
           cerevisiae YDL048C STP4 Protein involved in pre-tRNA
           splicing and in uptake of branched-chain amino acids
          Length = 558

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 66/131 (50%), Gaps = 17/131 (12%)

Query: 204 HKKKHMTRSIRQELIALSPELGAVH--REIFQCPHCPS----NFKVKGYLTRHLKKHLPN 257
           HKK H    + QE +    +L  +H  +  ++CP   +    + K+KG            
Sbjct: 429 HKKLHWKDDLNQESMDFVEKLKCLHELKGTYKCPFNSNLINLDLKLKGSDM--------- 479

Query: 258 KDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEF 317
           K    P+ + +C  H+TG FSR DTFK HLK++HF YP G  K  R+   G C  C Q+F
Sbjct: 480 KTADLPFETSNC--HSTGVFSRCDTFKNHLKALHFEYPPGTKKKDRANVAGHCKHCGQKF 537

Query: 318 ESNVVWLNEHI 328
           ES   WL +H+
Sbjct: 538 ESIETWLKDHV 548

>Ecym_2768 Chr2 (1495608..1496903) [1296 bp, 431 aa] {ON} similar to
           Ashbya gossypii AFR588W
          Length = 431

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (68%)

Query: 271 CHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHI 328
           CH TG FSR DT+K HLK++HF YP G  K +R+   GRC  C  +F++  VWLNEHI
Sbjct: 365 CHITGVFSRCDTYKNHLKALHFEYPPGTKKRERANIHGRCKHCGMKFDNVDVWLNEHI 422

>NDAI0J02060 Chr10 (505150..506619) [1470 bp, 489 aa] {ON} Anc_4.222
          Length = 489

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 66/117 (56%), Gaps = 11/117 (9%)

Query: 214 RQELIALSPELGAVH--REIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKC 271
           R+E +     L A+H  +  F+CP+  +  ++   L  + ++ +  +  HC         
Sbjct: 373 RKEQVTNEEHLKALHQMKGTFECPYNATLIQLDMELYPYKQQLINFEAIHC--------- 423

Query: 272 HTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHI 328
           H +G FSR+DTFK HLK++HF+YP G  K++R+   G C  C  +F++  +WL+EH+
Sbjct: 424 HKSGIFSRRDTFKNHLKALHFLYPPGTKKNERNKVPGTCKHCGMKFDNVDIWLSEHV 480

>ZYRO0B07436g Chr2 complement(581225..582256) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q7LH06 Saccharomyces cerevisiae
           YDL048C STP4 Protein involved in pre-tRNA splicing and
           in uptake of branched-chain amino acids
          Length = 343

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 33/58 (56%), Positives = 37/58 (63%)

Query: 271 CHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHI 328
           CH TG FSR DTFK HLK++HF YP G  K  RS   GRC  C   F +  +WLNEHI
Sbjct: 277 CHQTGVFSRCDTFKNHLKALHFEYPPGTKKRDRSVVPGRCKHCGLRFANVDLWLNEHI 334

>TBLA0I02770 Chr9 (650889..652730) [1842 bp, 613 aa] {ON} Anc_4.222
           YDL048C
          Length = 613

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 38/58 (65%)

Query: 271 CHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHI 328
           CH TG FSR DTFK HLK++HF YP G  +  R +S G+C  C Q F +  VWLN H+
Sbjct: 547 CHQTGVFSRCDTFKNHLKALHFEYPQGTKRKDRLFSSGKCKHCGQNFPNVDVWLNYHV 604

>AFR588W Chr6 (1496952..1497911) [960 bp, 319 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR375W (STP3) and
           YDL048C (STP4)
          Length = 319

 Score = 70.9 bits (172), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 40/58 (68%)

Query: 271 CHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHI 328
           CH TG FSR DT+K HLK++HF YP G  K +R+   GRC  C  +F++  +WLNEH+
Sbjct: 253 CHITGVFSRCDTYKNHLKALHFEYPPGTKKRERAKIHGRCKHCGMKFDNVDMWLNEHV 310

>CAGL0H04873g Chr8 complement(465069..466424) [1356 bp, 451 aa] {ON}
           some similarities with uniprot|Q05937 Saccharomyces
           cerevisiae YLR375w STP3 or uniprot|Q07351 Saccharomyces
           cerevisiae YDL048c STP4
          Length = 451

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 49/99 (49%), Gaps = 20/99 (20%)

Query: 250 HLKK-HLPNKDYHCPYWSP-------------------DCKCHTTGEFSRKDTFKTHLKS 289
           HLK  H     Y CPY S                      +CH TG FSR DTFK HLK+
Sbjct: 344 HLKSLHCIKGTYECPYNSALIELDLELYPYKGKEVNFITTQCHKTGVFSRCDTFKNHLKA 403

Query: 290 IHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHI 328
           +HF YP G  +S+RS+  G+C  C   F +   W+NEH+
Sbjct: 404 LHFEYPQGTRRSERSFVSGKCKHCNMSFANVDEWINEHV 442

>Kpol_337.6 s337 (17510..18712) [1203 bp, 400 aa] {ON}
           (17510..18712) [1203 nt, 401 aa]
          Length = 400

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 38/59 (64%)

Query: 271 CHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIE 329
           CH TG FSR DT+K HLK++HF YP G  K+ RS   G+C  C + F +  VWL  HIE
Sbjct: 334 CHATGVFSRCDTYKNHLKALHFEYPPGTKKANRSIVPGKCKHCGKNFPNVDVWLKTHIE 392

>TDEL0E01520 Chr5 complement(297717..298916) [1200 bp, 399 aa] {ON}
           Anc_4.222 YDL048C
          Length = 399

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 37/58 (63%)

Query: 271 CHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHI 328
           CH TG FSR DTFK HLK++HF YP G  K  R+   GRC  C  +F +   WLNEH+
Sbjct: 333 CHQTGVFSRCDTFKNHLKALHFEYPPGTKKRDRTVVAGRCKHCGIKFANVDTWLNEHV 390

>KAFR0A06120 Chr1 complement(1238549..1239577) [1029 bp, 342 aa]
           {ON} Anc_4.222 YDL048C
          Length = 342

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 57/133 (42%), Gaps = 37/133 (27%)

Query: 233 QCPHCPSNFKVKGYLTRHLKKHLPNK------------------DYHCPYWSP------- 267
           +CP C   F     L RH K+H  ++                   + CPY S        
Sbjct: 201 RCPVCERGFARNNDLIRHKKRHWKDEINVAGEHDQLKSLHQIKGTFKCPYNSTLIQLDME 260

Query: 268 ------------DCKCHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQ 315
                          CH TG FSR DTFK HLK++HF YP G  K  R+   GRC  C  
Sbjct: 261 IYPFKSKSLNFETSNCHQTGIFSRCDTFKNHLKALHFEYPPGTKKKDRNVVSGRCKHCGL 320

Query: 316 EFESNVVWLNEHI 328
           +F++  VWL++H+
Sbjct: 321 KFDNVEVWLSDHV 333

>KNAG0B05940 Chr2 (1165682..1166815) [1134 bp, 377 aa] {ON}
           Anc_4.222 YDL048C
          Length = 377

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 38/58 (65%)

Query: 271 CHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHI 328
           CH+TG FSR DTFK HLK++HF YP G  K +R+   GRC  C  +F +   WL EH+
Sbjct: 311 CHSTGVFSRCDTFKNHLKALHFEYPPGTKKKERTVVPGRCRNCGVKFPNVDTWLTEHV 368

>Suva_4.201 Chr4 complement(354498..356009) [1512 bp, 503 aa] {ON}
           YDL048C (REAL)
          Length = 503

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 264 YWSPDCKCHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVW 323
           Y+ P   CH TG FSR DTFK HLK++HF YP    K  RS   G+C  C  +F +  VW
Sbjct: 431 YFEP-INCHQTGVFSRCDTFKNHLKALHFEYPPKTKKEDRSIVPGKCKHCGLQFPNVDVW 489

Query: 324 LNEHIETG 331
           LN+H+  G
Sbjct: 490 LNKHVGKG 497

>NCAS0J01300 Chr10 (225659..226966) [1308 bp, 435 aa] {ON} Anc_4.222
          Length = 435

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%)

Query: 271 CHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHI 328
           CH +G FSR DTFK HLK++HF YP G  K++R+   G C  C + F +  VWL++H+
Sbjct: 369 CHPSGIFSRGDTFKNHLKALHFQYPAGTKKTERNSVPGNCKHCGKHFANVEVWLHDHV 426

>Skud_4.206 Chr4 complement(361956..363416) [1461 bp, 486 aa] {ON}
           YDL048C (REAL)
          Length = 486

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 264 YWSPDCKCHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVW 323
           Y+ P   CH TG FSR DTFK HLK++HF YP    K  RS   G+C  C  +F +  VW
Sbjct: 414 YFEP-INCHQTGVFSRCDTFKNHLKALHFEYPPKTKKEDRSIVPGKCKHCGLQFPNVDVW 472

Query: 324 LNEHIETG 331
           LN+H+  G
Sbjct: 473 LNKHVGKG 480

>CAGL0K04697g Chr11 (459195..460742) [1548 bp, 515 aa] {ON} some
           similarities with uniprot|Q07351 Saccharomyces
           cerevisiae YDL048c STP4 or uniprot|Q05937 Saccharomyces
           cerevisiae YLR375w STP3
          Length = 515

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (65%)

Query: 271 CHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHI 328
           CH TG FSR DTFK HLK++HF YP    + QRS   G+C  C  +F +  +WLN+H+
Sbjct: 448 CHPTGVFSRCDTFKNHLKALHFEYPQKTKREQRSQVPGKCKHCGMKFPNVDIWLNQHV 505

>Smik_4.190 Chr4 complement(347829..349298) [1470 bp, 489 aa] {ON}
           YDL048C (REAL)
          Length = 489

 Score = 67.8 bits (164), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 264 YWSPDCKCHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVW 323
           Y+ P   CH TG FSR DTFK HLK++HF YP    K  R    G+C  C  +F +  VW
Sbjct: 417 YFEP-INCHQTGVFSRCDTFKNHLKALHFEYPPKTKKEDRGIVPGKCKHCGLQFPNVDVW 475

Query: 324 LNEHIETG 331
           LN+H+  G
Sbjct: 476 LNKHVGKG 483

>KLTH0D13618g Chr4 (1112089..1113333) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q7LH06 Saccharomyces cerevisiae YDL048C STP4
           Protein involved in pre-tRNA splicing and in uptake of
           branched-chain amino acids
          Length = 414

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/88 (39%), Positives = 43/88 (48%), Gaps = 19/88 (21%)

Query: 260 YHCPYWSP-------------------DCKCHTTGEFSRKDTFKTHLKSIHFVYPVGVVK 300
           +HCPY S                      +CH TG FSR DTFK HLK++HF YP G  K
Sbjct: 318 FHCPYKSALIALDMDAYPGKRRELAFETSECHQTGVFSRCDTFKNHLKALHFEYPPGTKK 377

Query: 301 SQRSYSKGRCAACFQEFESNVVWLNEHI 328
             RS   GRC  C + F +   WL+ H+
Sbjct: 378 KDRSSVPGRCKQCGRHFANVGEWLSSHV 405

>YDL048C Chr4 complement(366739..368211) [1473 bp, 490 aa] {ON}
           STP4Protein containing a Kruppel-type zinc-finger
           domain; has similarity to Stp1p, Stp2p, and Stp3p;
           predicted to be a transcription factor
          Length = 490

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 264 YWSPDCKCHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVW 323
           Y+ P   CH TG FSR DTFK HLK++HF YP    K  R    G+C  C  +F +  VW
Sbjct: 418 YFEP-INCHQTGVFSRCDTFKNHLKALHFEYPPKTKKEDRGVVPGKCKHCGLQFPNVDVW 476

Query: 324 LNEHIETG 331
           LN+H+  G
Sbjct: 477 LNKHVGKG 484

>NCAS0A02360 Chr1 (448263..449699) [1437 bp, 478 aa] {ON} Anc_4.222
          Length = 478

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (63%)

Query: 271 CHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHI 328
           CH TG FSR DT+K HLK++HF YP    K  R+   G C  C  +FE+  VWLN+H+
Sbjct: 412 CHQTGVFSRCDTYKNHLKALHFEYPPKTKKEDRAVMPGNCKHCGMKFENVDVWLNKHV 469

>TBLA0A08200 Chr1 complement(2024809..2025861) [1053 bp, 350 aa]
           {ON} Anc_4.222 YDL048C
          Length = 350

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 36/58 (62%)

Query: 271 CHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHI 328
           CH TG FSR DTFK HLK++HF YP G  K  R    GRC  C  +F++  VWL  H+
Sbjct: 284 CHQTGVFSRCDTFKNHLKALHFEYPPGTKKKDRLLVSGRCKHCGLKFKNVDVWLKTHV 341

>TPHA0B00930 Chr2 complement(212983..214026) [1044 bp, 347 aa] {ON}
           Anc_4.222 YDL048C
          Length = 347

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 36/58 (62%)

Query: 271 CHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHI 328
           CH TG FSR DT+K HLK++HF YP G  K  RS   GRC  C ++F +   WL  H+
Sbjct: 281 CHQTGIFSRCDTYKNHLKALHFEYPPGTKKVNRSAVAGRCRHCGKKFPNVNYWLKNHV 338

>NDAI0D04510 Chr4 complement(1057468..1059150) [1683 bp, 560 aa]
           {ON} Anc_4.222
          Length = 560

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 56/108 (51%), Gaps = 10/108 (9%)

Query: 223 ELGAVH--REIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRK 280
           +L ++H  +  F+CP+  S   +   +    KK + N       ++P   CH TG FSR 
Sbjct: 452 QLKSLHQIKGAFKCPYNKSLINLDMEIYPEKKKEVLN-------FTP-LSCHQTGVFSRC 503

Query: 281 DTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHI 328
           DT+K HLK++HF YP    K  R    GRC  C   F +  VWLN+H+
Sbjct: 504 DTYKNHLKALHFEYPPRTRKEDRGVVPGRCKHCGMGFVNVDVWLNKHV 551

>Kpol_472.3 s472 complement(4365..5300) [936 bp, 311 aa] {ON}
           complement(4365..5300) [936 nt, 312 aa]
          Length = 311

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 66/131 (50%), Gaps = 15/131 (11%)

Query: 204 HKKKHMTRSI---RQELIALSPELGAVHR--EIFQCPHCPSNFKVKGYLTRHLKKHLPNK 258
           H+K+H+ + +   +  L++    L A+H   +IF+CP+      +   L +H  K  P  
Sbjct: 181 HQKEHVQKDLLTAKDPLMSEHDRLVALHNTGDIFRCPYNEKLINIDLELYKH--KFQPKT 238

Query: 259 DYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSY-SKGRCAACFQEF 317
            Y          CH+TG F RKDT + HL++ HF Y    +  ++S  S G C AC + F
Sbjct: 239 AY-------VKNCHSTGLFLRKDTLRNHLRAHHFNYADLTLPKRKSITSPGNCGACGKWF 291

Query: 318 ESNVVWLNEHI 328
           E+   W +EH+
Sbjct: 292 ENTTTWTDEHV 302

>TPHA0B02390 Chr2 complement(547109..548149) [1041 bp, 346 aa] {ON} 
          Length = 346

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 64/136 (47%), Gaps = 20/136 (14%)

Query: 204 HKKKHMTRSIRQEL--------IALSPELGAVHR--EIFQCPHCPSNFKVKGYLTRHLKK 253
           HKK+H+ +++ Q++        +    +L  +H    +F+CP+      +   L ++  K
Sbjct: 211 HKKEHVQKALIQDVNSQDAYSDLTNKSKLTQLHNIGNVFRCPYNEKVIDLDLSLHKYKVK 270

Query: 254 HLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIHFVYPVGVVK-SQRSYSKGRCAA 312
                    P  S    CH  G F RKDT + HL+S HF Y    +   +++ + GRC  
Sbjct: 271 ---------PASSQVANCHHNGMFFRKDTLRNHLRSHHFDYDKKELSVKEKACASGRCRF 321

Query: 313 CFQEFESNVVWLNEHI 328
           C +  E+  +W +EH+
Sbjct: 322 CNEWHENAKIWADEHV 337

>AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL056C (ZAP1)
          Length = 661

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 47/108 (43%), Gaps = 21/108 (19%)

Query: 182 IPTSLSETPCRTVGTSSTSYKVHKKKHMTRSIRQELIALSPELGAVHREIFQCPHCPSNF 241
           +P+  S   C   G +         KH T+  RQ+L A  P  G    +   CPHCP  F
Sbjct: 507 VPSGRSAYQCNWAGCT---------KHFTQ--RQKLFA--PHQGTHRHKPCSCPHCPKTF 553

Query: 242 KVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS 289
                L +H++ H   + +HC Y    C+     +FS   + + H+++
Sbjct: 554 STDDILAQHIRTHSGERPFHCHY----CR----KQFSTSSSLRVHIRT 593

>TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.533
           YMR070W
          Length = 387

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 37/78 (47%), Gaps = 8/78 (10%)

Query: 214 RQELIALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHT 273
           +Q+  A S  +   ++ IF+C  C   FK K +L RHL  H  N+ Y CP+    C    
Sbjct: 236 QQDSFAFSDNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW----C---- 287

Query: 274 TGEFSRKDTFKTHLKSIH 291
             +  RKD    H+K  H
Sbjct: 288 LSKHKRKDNLLQHMKLKH 305

>KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {ON}
           Anc_3.281 YBR066C
          Length = 280

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 42/92 (45%), Gaps = 22/92 (23%)

Query: 224 LGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT- 282
           + + HR+ FQC  C   F   G+L+RH K H   K+Y CP+ S          FSR D  
Sbjct: 205 ISSKHRK-FQCKTCSMAFTTSGHLSRHNKIHTGEKNYVCPHES------CGQRFSRHDNC 257

Query: 283 ---FKTHLKSIHFVYPVGVVKSQRSYSKGRCA 311
              ++THLK           K QR   KG+ A
Sbjct: 258 IQHYRTHLK-----------KKQRQAKKGKVA 278

>NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {ON}
           Anc_2.533
          Length = 730

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 30/61 (49%), Gaps = 8/61 (13%)

Query: 231 IFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSI 290
           +FQC +C  +FK   +L RHL  H P + Y CP+    C      +  RKD    HLK  
Sbjct: 559 VFQCSYCVKSFKRFSWLKRHLLAHSPERHYSCPW----C----LSKHKRKDNLLQHLKLK 610

Query: 291 H 291
           H
Sbjct: 611 H 611

>YPR022C Chr16 complement(603911..607312) [3402 bp, 1133 aa] {ON}
           Putative transcription factor, as suggested by
           computational analysis; green fluorescent protein
           (GFP)-fusion protein localizes to both the cytoplasm and
           the nucleus and is induced in response to the
           DNA-damaging agent MMS
          Length = 1133

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 31/71 (43%), Gaps = 2/71 (2%)

Query: 220 LSPELGAVHREIFQCPH--CPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEF 277
           LSP   +   E F+CPH  C   F  + +L+RH   H P + Y C Y  P         F
Sbjct: 19  LSPNSSSSPAERFRCPHPECNKTFSRQEHLSRHKLNHWPKEIYVCSYVLPTTNAPCNKTF 78

Query: 278 SRKDTFKTHLK 288
            RKD    H K
Sbjct: 79  VRKDLLIRHEK 89

>TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.533
           YMR070W
          Length = 216

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 30/82 (36%), Gaps = 8/82 (9%)

Query: 210 TRSIRQELIALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDC 269
            R   QEL  L            +CP C   FK K +L RH+  H   + Y CP+     
Sbjct: 91  VRPTEQELQVLLYNSSMNEMAYHKCPQCEKRFKRKSWLKRHMLSHSEERQYSCPW----- 145

Query: 270 KCHTTGEFSRKDTFKTHLKSIH 291
                    RKD    H+K  H
Sbjct: 146 ---CISRHKRKDNLLQHMKLKH 164

>KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]
           {ON} some similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 431

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 29/63 (46%), Gaps = 8/63 (12%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIH 291
           +QC  C   F+ K +L RHL  H   K +HCP+ S   K        RKD    HLK  H
Sbjct: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHK--------RKDNLLQHLKLKH 357

Query: 292 FVY 294
             Y
Sbjct: 358 TQY 360

>NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON}
           Anc_3.518
          Length = 288

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 45/105 (42%), Gaps = 14/105 (13%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIH 291
           F+CP C   F    +  RH++ H   K + C +       H    FSR D  K H++ IH
Sbjct: 17  FRCPICSRGFHRLEHKKRHVRTHTGEKPHPCTF------AHCGKSFSRGDELKRHIR-IH 69

Query: 292 FVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGL 336
              P   ++        + AA  Q+ E+N+  LN H    + + +
Sbjct: 70  LGLPSRRIRK-------KAAAKPQDIENNIPQLNIHSSNILLKAI 107

>ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 294

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 42/102 (41%), Gaps = 21/102 (20%)

Query: 234 CPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIHFV 293
           CP C  +FK K +L RHL  H P + + CP+           +  RKD    H+K  H  
Sbjct: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--------CLSKHKRKDNLLQHMKLKHTE 245

Query: 294 YPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRG 335
           Y +  +++Q     G                N++I T +C G
Sbjct: 246 YVLEKLRNQNVGIDGEVR-------------NDNIRTLLCEG 274

>KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8.130
           YPR022C
          Length = 1206

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 30/68 (44%), Gaps = 1/68 (1%)

Query: 222 PELG-AVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRK 280
           PE G +V R +   P C   F  + +L RH   H P + + CPY  P+        F RK
Sbjct: 61  PEDGTSVDRYVCPHPDCNKTFSRQEHLARHKLNHWPKEIFRCPYVFPNTDIRCNKTFVRK 120

Query: 281 DTFKTHLK 288
           D    H K
Sbjct: 121 DLLGRHAK 128

>Skud_16.307 Chr16 complement(568219..570672,570703..571623) [3375
           bp, 1124 aa] {ON} YPR022C (REAL)
          Length = 1124

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 31/71 (43%), Gaps = 2/71 (2%)

Query: 220 LSPELGAVHREIFQCPH--CPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEF 277
           LSP   +   E F+CPH  C   F  + +L+RH   H P + Y C +  P         F
Sbjct: 19  LSPNSSSSSVERFRCPHPECNKTFSRQEHLSRHKLNHWPKEIYVCSFVLPTTNAPCNKTF 78

Query: 278 SRKDTFKTHLK 288
            RKD    H K
Sbjct: 79  VRKDLLIRHEK 89

>Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)
           [1428 bp, 475 aa] {ON} YMR070W (REAL)
          Length = 475

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 34/73 (46%), Gaps = 8/73 (10%)

Query: 222 PELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKD 281
           P   + HR I QC  C  +FK K +L RHL  H   + + CP+      C +  +  RKD
Sbjct: 318 PTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW------CLSRQK--RKD 369

Query: 282 TFKTHLKSIHFVY 294
               H+K  H  Y
Sbjct: 370 NLLQHMKLKHTNY 382

>TDEL0F01030 Chr6 (182054..185287) [3234 bp, 1077 aa] {ON} Anc_8.130
           YPR022C
          Length = 1077

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 31/67 (46%), Gaps = 2/67 (2%)

Query: 224 LGAVHREIFQCPH--CPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKD 281
           L A     F+CPH  C  +F  + +L+RH   H P + + C Y  P+        F RKD
Sbjct: 37  LSASTSGRFKCPHPACDKSFTRQEHLSRHKLNHWPKEIFKCSYVFPNTGLACNRTFVRKD 96

Query: 282 TFKTHLK 288
               H+K
Sbjct: 97  LLARHVK 103

>KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON}
           Anc_3.281 YBR066C
          Length = 249

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 46/98 (46%), Gaps = 19/98 (19%)

Query: 202 KVHKKKHMTR-----SIRQELIALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLP 256
           KV  K+   R     SI+++++  S E     R  + C  C   F   G+L RH + H  
Sbjct: 141 KVSNKRQYRRTPQRDSIKKKMLRESLE----QRRKYICKTCSKGFTTSGHLARHNRIHTG 196

Query: 257 NKDYHCPYWSPDCKCHTTGEFSRKDT----FKTHLKSI 290
            K++ CP+    C+      FSR+D     ++TH KSI
Sbjct: 197 EKNHECPFEG--CQ----QRFSRQDNCLQHYRTHFKSI 228

>Smik_16.263 Chr16 complement(479612..482980) [3369 bp, 1122 aa]
           {ON} YPR022C (REAL)
          Length = 1122

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 31/71 (43%), Gaps = 2/71 (2%)

Query: 220 LSPELGAVHREIFQCPH--CPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEF 277
           L+P   +   E F+CPH  C   F  + +L+RH   H P + Y C +  P         F
Sbjct: 19  LAPNSISSPAERFRCPHPECNKTFSRQEHLSRHKLNHWPKEIYVCSFVHPTTNAPCNKTF 78

Query: 278 SRKDTFKTHLK 288
            RKD    H K
Sbjct: 79  VRKDLLIRHEK 89

>NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8.130
          Length = 1207

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 30/68 (44%)

Query: 221 SPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRK 280
           S +L    R I   P C  +F  + +L+RH   H P + + CP+  P+        F RK
Sbjct: 33  SAKLAVTERYICPHPDCNKSFTRQEHLSRHKLNHWPKEIFVCPFIFPNTNITCNKTFVRK 92

Query: 281 DTFKTHLK 288
           D    H K
Sbjct: 93  DLLIRHQK 100

>TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.533
           YMR070W
          Length = 513

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 34/74 (45%), Gaps = 8/74 (10%)

Query: 221 SPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRK 280
           +P+       IFQC  C  +FK K +L RHL  H   +++ CP     C C    +  RK
Sbjct: 329 APQSAINQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP-----C-C--LSKHKRK 380

Query: 281 DTFKTHLKSIHFVY 294
           D    HLK  H  Y
Sbjct: 381 DNLIQHLKLKHLDY 394

>Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}
           YDR043C (REAL)
          Length = 232

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 32/74 (43%), Gaps = 10/74 (13%)

Query: 219 ALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFS 278
            LS E     R  + C  C   F   G+L RH + H   K++ CPY         T  FS
Sbjct: 162 TLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKG------CTQRFS 215

Query: 279 RKDT----FKTHLK 288
           R D     ++THLK
Sbjct: 216 RHDNCLQHYRTHLK 229

>AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR070W
           (MOT3)
          Length = 396

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 28/61 (45%), Gaps = 8/61 (13%)

Query: 231 IFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSI 290
           I +C  C   FK K +L RHL  H   K Y CP+      CH+     RKD    HLK  
Sbjct: 184 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW------CHS--RHKRKDNLSQHLKLK 235

Query: 291 H 291
           H
Sbjct: 236 H 236

>Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}
           YDR043C (REAL)
          Length = 231

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 32/74 (43%), Gaps = 10/74 (13%)

Query: 219 ALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFS 278
            LS E     R  + C  C   F   G+L RH + H   K++ CPY         T  FS
Sbjct: 161 TLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKG------CTQRFS 214

Query: 279 RKDT----FKTHLK 288
           R D     ++THLK
Sbjct: 215 RHDNCLQHYRTHLK 228

>KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.281
           YBR066C
          Length = 254

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 15/91 (16%)

Query: 207 KHMTRSIRQELIALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWS 266
           K + R+ R++L A         R  + C  C   F   G+L RH + H   K++ CP+  
Sbjct: 165 KPLARNSREDLSAT-----LEQRRKYLCTTCTKGFTTSGHLARHKRIHTGEKNHLCPFE- 218

Query: 267 PDCKCHTTGEFSRKDT----FKTHLKSIHFV 293
             CK      FSR+D     ++TH K+  F 
Sbjct: 219 -GCK----QRFSRQDNCLQHYRTHFKNFTFT 244

>YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}
           MOT3Transcriptional repressor and activator with two
           C2-H2 zinc fingers; involved in repression of a subset
           of hypoxic genes by Rox1p, repression of several DAN/TIR
           genes during aerobic growth, and repression of
           ergosterol biosynthetic genes in response to
           hyperosmotic stress; contributes to recruitment of the
           Tup1p-Cyc8p general repressor to promoters; involved in
           positive transcriptional regulation of CWP2 and other
           genes; can form the [MOT3+] prion
          Length = 490

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 8/75 (10%)

Query: 220 LSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSR 279
           L P   + H+ I QC  C  +FK K +L RHL  H   + + CP+      C +  +  R
Sbjct: 334 LVPAPSSDHKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW------CLSRQK--R 385

Query: 280 KDTFKTHLKSIHFVY 294
           KD    H+K  H  Y
Sbjct: 386 KDNLLQHMKLKHTNY 400

>NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON}
           Anc_3.298
          Length = 370

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 6/86 (6%)

Query: 226 AVHREI--FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTF 283
           ++  EI  + C HC   FK    L  H+  H  NK Y CPY   +C+     + +    +
Sbjct: 250 SISEEIAKYGCKHCNKRFKRPSSLNTHMNIHTGNKPYVCPYE--ECRKSFNAKSNMLRHY 307

Query: 284 KTHLK--SIHFVYPVGVVKSQRSYSK 307
           K H K  S  ++ P G + +++  SK
Sbjct: 308 KLHFKLNSGAYILPNGEISAEKPTSK 333

>NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {ON}
           Anc_2.533
          Length = 525

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 33/79 (41%), Gaps = 10/79 (12%)

Query: 215 QELIALSPELGAVHRE--IFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCH 272
           Q  +  SP  G    E  ++ C  C  NFK + +L RHL  H   + Y CP+    C   
Sbjct: 369 QRFVTPSPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPW----C--- 421

Query: 273 TTGEFSRKDTFKTHLKSIH 291
                 R+D    H+K  H
Sbjct: 422 -LSRHKRRDNLLQHMKLKH 439

>YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}
           NRG1Transcriptional repressor that recruits the
           Cyc8p-Tup1p complex to promoters; mediates glucose
           repression and negatively regulates a variety of
           processes including filamentous growth and alkaline pH
           response
          Length = 231

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 32/74 (43%), Gaps = 10/74 (13%)

Query: 219 ALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFS 278
            LS E     R  + C  C   F   G+L RH + H   K++ CPY         T  FS
Sbjct: 161 TLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKG------CTQRFS 214

Query: 279 RKDT----FKTHLK 288
           R D     ++THLK
Sbjct: 215 RHDNCLQHYRTHLK 228

>Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}
           similar to Ashbya gossypii AGL071C
          Length = 544

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 28/61 (45%), Gaps = 8/61 (13%)

Query: 231 IFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSI 290
           I +C  C   FK K +L RHL  H   K Y CP+      CH+     RKD    HLK  
Sbjct: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW------CHS--RHKRKDNLSQHLKLK 336

Query: 291 H 291
           H
Sbjct: 337 H 337

>Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}
           YDR043C (REAL)
          Length = 231

 Score = 37.4 bits (85), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 33/77 (42%), Gaps = 10/77 (12%)

Query: 219 ALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFS 278
            LS E     R  + C  C   F   G+L RH + H   K++ CPY         T  FS
Sbjct: 161 TLSDEEDLELRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKG------CTQRFS 214

Query: 279 RKDT----FKTHLKSIH 291
           R D     ++THLK  H
Sbjct: 215 RHDNCLQHYRTHLKKEH 231

>SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]
           {ON} similar to uniprot|P39933 Saccharomyces cerevisiae
           YPR186C PZF1 Transcription factor IIIA (TFIIIA) with
           putative Zn-fingers
          Length = 437

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 226 AVHREI--FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPY 264
            VH+ I  F+C HC   F  K +L RH+  H  NK +HC Y
Sbjct: 78  TVHQGIKPFKCDHCERTFAKKSHLERHMFTHSDNKPFHCSY 118

>KAFR0B02050 Chr2 complement(402767..405958) [3192 bp, 1063 aa] {ON}
           Anc_8.130 YPR022C
          Length = 1063

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 30/69 (43%), Gaps = 2/69 (2%)

Query: 222 PELGAVHREIFQCPH--CPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSR 279
           P +     E F CPH  C  +F  + +L+RH   H P + Y C +  P+        F R
Sbjct: 9   PTIKKSGSERFYCPHPDCNKSFTRQEHLSRHKLNHWPKQIYTCHFKFPNSSIICDKTFVR 68

Query: 280 KDTFKTHLK 288
           KD    H K
Sbjct: 69  KDLLTRHEK 77

>NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {ON}
           Anc_2.533
          Length = 511

 Score = 37.4 bits (85), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 8/64 (12%)

Query: 231 IFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSI 290
           ++QC  C  +F+   +L RHL  H   + Y CP      KC    +  RKD    HLK  
Sbjct: 386 VYQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCP------KC--VSKHKRKDNLLQHLKLK 437

Query: 291 HFVY 294
           H  +
Sbjct: 438 HTAF 441

>TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.533
           YMR070W
          Length = 239

 Score = 36.6 bits (83), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 39/88 (44%), Gaps = 14/88 (15%)

Query: 225 GAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFK 284
           G VH+    C  C  +FK K +L RHL  H P + + CP+           +  RKD   
Sbjct: 131 GYVHK----CHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--------CLSKHKRKDNLL 178

Query: 285 THLKSIHFVYPVGVVKSQRSY--SKGRC 310
            H+K  H  Y +  ++    Y  ++G C
Sbjct: 179 QHMKLKHTDYVLQELRLNNVYVSTEGSC 206

>Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 aa]
           {ON} YMR070W (REAL)
          Length = 473

 Score = 37.0 bits (84), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 228 HREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHL 287
           H+ I QC  C  +FK K +L RHL  H   + + CP+      C +  +  RKD    H+
Sbjct: 334 HKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW------CLSRQK--RKDNLLQHM 385

Query: 288 KSIHFVY 294
           K  H  Y
Sbjct: 386 KLKHTNY 392

>Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON}
           (43237..43899) [663 nt, 221 aa]
          Length = 220

 Score = 36.2 bits (82), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 32/68 (47%), Gaps = 10/68 (14%)

Query: 224 LGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT- 282
           L    R  F+C  C   F   G+LTRH + H   K++ CP+   + +      FSR D  
Sbjct: 153 LSIEKRRRFECKTCGRKFTTSGHLTRHNRIHTGEKNHVCPFEGCNLR------FSRNDNS 206

Query: 283 ---FKTHL 287
              +KTHL
Sbjct: 207 LQHYKTHL 214

>CAGL0K02343g Chr11 (209474..212962) [3489 bp, 1162 aa] {ON} similar
           to uniprot|Q12139 Saccharomyces cerevisiae YPR022c
          Length = 1162

 Score = 36.6 bits (83), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 36/78 (46%), Gaps = 2/78 (2%)

Query: 213 IRQELIALSPELGAVHREIFQCPH--CPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCK 270
           +R+    +S  +G   +  ++CPH  C  +F  + +L+RH   H P + + C Y SP   
Sbjct: 26  VRKRSKTVSMVVGEDGQYRYKCPHPTCDKSFSRQEHLSRHKLNHWPKEIFKCHYVSPLSG 85

Query: 271 CHTTGEFSRKDTFKTHLK 288
                 F R+D    H K
Sbjct: 86  QPCGKTFVRRDLLNRHEK 103

>KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 28/60 (46%), Gaps = 7/60 (11%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIH 291
           F+CP C   F    +  RH++ H   K Y C +  PDC       FSR D  K H K IH
Sbjct: 17  FKCPLCQRGFHRLEHKKRHVRTHTGEKPYKCSF--PDCP----KSFSRTDELKRHSK-IH 69

>KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {ON}
           some similarities with uniprot|Q03125 Saccharomyces
           cerevisiae YDR043C NRG1 Transcriptional repressor that
           recruits the Cyc8p-Tup1p complex to promoters mediates
           glucose repression and negatively regulates a variety of
           processes including filamentous growth and alkaline pH
           response
          Length = 265

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 10/64 (15%)

Query: 229 REIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT----FK 284
           R  + C  C   F   G+L RH + H   K++ CP+  P C       FSR D     +K
Sbjct: 199 RRRYVCKTCVKGFTTSGHLARHNRIHTGEKNHVCPH--PGCG----QRFSRHDNCVQHYK 252

Query: 285 THLK 288
           THL+
Sbjct: 253 THLR 256

>ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa]
           {ON} weakly similar to uniprot|P38082 Saccharomyces
           cerevisiae YBR066C
          Length = 189

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 43/99 (43%), Gaps = 23/99 (23%)

Query: 194 VGTSSTSYKVHKKKHMTRSIRQELIALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKK 253
           +GTS  ++++ K+++   S   E            R +  C  C   F   G+L RH + 
Sbjct: 85  LGTSPVTHRIRKRRNTNSSNNSE-----------RRHV--CRICYKGFTTSGHLARHNRI 131

Query: 254 HLPNKDYHCPYWSPDCKCHTTGEFSRKDT----FKTHLK 288
           H   K++ CPY   D K      FSR D     ++ H+K
Sbjct: 132 HTGEKNHECPYEGCDQK------FSRHDNCIQHYRAHVK 164

>KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543
           YPR186C
          Length = 416

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 36/79 (45%), Gaps = 8/79 (10%)

Query: 220 LSPELGAVHREI--FQCPHCPSNFKVKGYLTRHLKKHLPNKD--YHCPYWSPDCKCHTTG 275
           L+     +H  I  F+C  C  +F  K +L RHL  HL +KD  +HC Y    C   TT 
Sbjct: 81  LTEHQQTIHHGIKSFKCNECTKSFARKTHLERHLISHLNDKDKPFHCKY----CNKGTTT 136

Query: 276 EFSRKDTFKTHLKSIHFVY 294
               K    TH KS H  Y
Sbjct: 137 RQQLKRHEITHTKSFHCPY 155

>Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON}
           (58087..59160) [1074 nt, 358 aa]
          Length = 357

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 48/118 (40%), Gaps = 17/118 (14%)

Query: 182 IPTSLSETPCRTVG--TSSTSYKVHKKKHMTRS-IRQELIALSP----ELGAVHREIFQC 234
           IP+S +     T G    S      KK+H  +  I  E I  S     +   V R  + C
Sbjct: 244 IPSSFTSMETSTEGQLVDSNEASARKKRHYNKKRIVPEGIESSRTHILKADIVKRRKYIC 303

Query: 235 PHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT----FKTHLK 288
             C       G+L RH + H   K++ CPY      C+    FSR D     ++THLK
Sbjct: 304 RVCSKGLTTSGHLARHYRIHTGEKNHFCPYEG----CNQ--RFSRHDNCIQHYRTHLK 355

>SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some
           similarities with uniprot|Q12132 Saccharomyces
           cerevisiae YPL230W USV1 Up in StarVation
          Length = 322

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 43/94 (45%), Gaps = 20/94 (21%)

Query: 205 KKKHMTRSIRQELIALSPELGAVHREIFQCP---HCPSNFKVKGYLTRHLKKHLPNKDYH 261
           +++H T S++QE+          H  +F+C     C   F    +L RH++KH   K + 
Sbjct: 4   RRRH-TLSVKQEV--------KPHGRVFRCTGYGDCHMTFTRAEHLARHIRKHTGEKPFQ 54

Query: 262 CPYWSPDCKCHTTGEFSRKDTFKTHLKSIHFVYP 295
           C        CH    FSR D  K H +S+H + P
Sbjct: 55  CDI------CHRF--FSRVDNLKQHKESVHSIIP 80

>Suva_16.349 Chr16 complement(610937..612562) [1626 bp, 541 aa] {ON}
           YPR022C (REAL)
          Length = 541

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 26/59 (44%), Gaps = 2/59 (3%)

Query: 232 FQCPH--CPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLK 288
           F+CPH  C   F  + +L+RH   H P + Y C +  P         F RKD    H K
Sbjct: 32  FRCPHPECNKTFSRQEHLSRHKLNHWPKEIYVCSFVLPTTNAPCNKTFVRKDLLIRHEK 90

>KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598
           YMR037C
          Length = 620

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 9/81 (11%)

Query: 210 TRSIRQELIALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKK-HLPNKDYHCPYWSPD 268
           T S+ Q+ + L+  L ++  + F+C  C   FK   +L RH++  H  ++ + C      
Sbjct: 541 TPSMSQDSLNLAATLVSLEDKPFKCGQCVKAFKRSEHLKRHVRSVHSNDRPFACTL---- 596

Query: 269 CKCHTTGEFSRKDTFKTHLKS 289
           C+     +FSR D    HLK+
Sbjct: 597 CE----KKFSRSDNLSQHLKT 613

>Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {ON}
           YMR037C (REAL)
          Length = 704

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 44/97 (45%), Gaps = 11/97 (11%)

Query: 194 VGTSSTSYKVHKKKHMTRSIRQELIALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKK 253
           +G S      +++K MT S R  ++  S     +  + F C  CP +FK   +L RH++ 
Sbjct: 611 IGVSKEKRPSYRRKSMTPSRRSSVVMES--TNDLEEKPFHCHICPKSFKRSEHLKRHVRS 668

Query: 254 HLPNKDYHCPYWSPDCKCHT-TGEFSRKDTFKTHLKS 289
              N+    P+      CH    +FSR D    H+K+
Sbjct: 669 VHSNE---RPFA-----CHICDKKFSRSDNLSQHIKT 697

>NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256
          Length = 394

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 32/73 (43%), Gaps = 11/73 (15%)

Query: 222 PELGAVHREIFQCP---HCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFS 278
           P+   + ++ F C     C   F    +LTRH++KH   K YHC   S +        FS
Sbjct: 9   PQPKRIQKKKFCCTGYGECSMAFTRAEHLTRHIRKHTGEKPYHCGICSKN--------FS 60

Query: 279 RKDTFKTHLKSIH 291
           R D  K H   +H
Sbjct: 61  RIDNLKQHEDCVH 73

>Kwal_14.1457 s14 complement(331338..332885) [1548 bp, 515 aa] {ON}
           YGR044C (RME1) - zinc finger protein; negative regulator
           of meiosis; directly repressed by a1-a2 regulator
           [contig 242] FULL
          Length = 515

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 212 SIRQELIALSPELGAVHREI----FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPY 264
           S+ Q+LI   P + A+ R +    ++C HCP  F       +H+ +    +DY CP+
Sbjct: 345 SVYQQLIDDKPLMEALSRRVKRGYYRCAHCPKMFSSILEYAKHIDEFQIQRDYKCPF 401

>KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 506

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 8/69 (11%)

Query: 223 ELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT 282
           + G+    +++C  C  +FK K +  RHL  H   K Y+CP+    C+        R+D 
Sbjct: 379 DTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW----CQS----RHKRRDN 430

Query: 283 FKTHLKSIH 291
              H+K+ H
Sbjct: 431 LFQHMKTKH 439

>KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {ON}
           Anc_8.144 YER130C
          Length = 453

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 9/59 (15%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKK-HLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS 289
           F C +C   FK + +L RH++  H+  K +HC      C  H    FSR D    H+K+
Sbjct: 398 FSCEYCDRRFKRQEHLKRHIRSLHICEKPFHCHI----CDKH----FSRSDNLNQHIKT 448

>Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar to
           Ashbya gossypii AFL136W
          Length = 460

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 8/67 (11%)

Query: 237 CPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIHFVYPV 296
           C  +F    +L RH++KH   K + C        C+    FSR D  K H +S+H++  +
Sbjct: 28  CDMSFTRAEHLARHIRKHTGEKPFQCEV------CNRF--FSRIDNLKQHRESVHWIPTI 79

Query: 297 GVVKSQR 303
              +S+R
Sbjct: 80  STTRSKR 86

>TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.598
           YMR037C
          Length = 365

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 10/72 (13%)

Query: 219 ALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKK-HLPNKDYHCPYWSPDCKCHTTGEF 277
           ++SP++    +  F+C  C   FK   +L RH++  H   + YHC +    C+      F
Sbjct: 296 SISPQIIYSDKP-FKCNKCEKKFKRSEHLKRHIRSVHSTERPYHCQF----CE----KNF 346

Query: 278 SRKDTFKTHLKS 289
           SR D    HLK+
Sbjct: 347 SRSDNLSQHLKT 358

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 38/89 (42%), Gaps = 12/89 (13%)

Query: 225 GAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFK 284
           G + +  + C  C   FK    L+ H+  H  NK + CP+   +C    T  F+ K    
Sbjct: 298 GNIEKIKYHCSICGKKFKRPSSLSTHMNIHTGNKPFTCPFT--NC----TKSFNAKSNML 351

Query: 285 TH------LKSIHFVYPVGVVKSQRSYSK 307
            H      L S +++ P G + S +  +K
Sbjct: 352 RHYKLHFKLSSGNYILPNGKITSTKPTTK 380

>Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070W
           (REAL)
          Length = 419

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 33/73 (45%), Gaps = 8/73 (10%)

Query: 222 PELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKD 281
           P   +  + I QC  C  +FK K +L RHL  H   + + CP+      C +  +  RKD
Sbjct: 317 PAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW------CLSRQK--RKD 368

Query: 282 TFKTHLKSIHFVY 294
               H+K  H  Y
Sbjct: 369 NLLQHMKLKHTNY 381

>SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 388

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 8/59 (13%)

Query: 233 QCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIH 291
           QC  C  +FK K +L RHL  H   K ++CP+    C+        RKD    H+K  H
Sbjct: 259 QCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW----CQ----SRHKRKDNLLQHMKLKH 309

>Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W
           (MOT3) - 2 Cys2-His2 zinc fingers at c-terminus,
           glutamine and asparagine rich [contig 55] FULL
          Length = 507

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 8/68 (11%)

Query: 224 LGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTF 283
           +G V    ++C  C  +FK + +  RHL  H   K Y CP+    C+        R+D  
Sbjct: 381 MGLVPPVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW----CQS----RHKRRDNL 432

Query: 284 KTHLKSIH 291
             H+K+ H
Sbjct: 433 FQHMKTKH 440

>TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {ON}
           Anc_3.281 YBR066C
          Length = 350

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 30/64 (46%), Gaps = 10/64 (15%)

Query: 229 REIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT----FK 284
           R   QC  C   F   G+LTRH K H   K++ CP+    C       FSR D     ++
Sbjct: 265 RRKHQCKICMKKFTTAGHLTRHHKIHTGEKNHKCPHR--GCNL----WFSRNDNSLQHYQ 318

Query: 285 THLK 288
           THLK
Sbjct: 319 THLK 322

>TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {ON}
           Anc_8.234 YER169W
          Length = 912

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 57/127 (44%), Gaps = 12/127 (9%)

Query: 195 GTSSTSYKVHKKKHMTRSIRQELIALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKK- 253
           GT+S S ++ KKK+   SI Q        + + + +++ C  C   F    +LTRH K  
Sbjct: 741 GTASYSNEM-KKKNTAGSIPQNKFGSDEIVISENGKVYICQDCKRQFSSGHHLTRHKKSV 799

Query: 254 HLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHL-KSIHFVYPVGV-VKSQRSYSKGRCA 311
           H   K + CP      KC     F R+D    HL K I      GV V++    SK +  
Sbjct: 800 HSGEKPHSCP------KCGK--RFKRRDHVLQHLNKKIPCTQDGGVNVENPNKPSKPKST 851

Query: 312 ACFQEFE 318
           A  ++FE
Sbjct: 852 AVKEQFE 858

>Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {ON}
           YPR186C (REAL)
          Length = 432

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 226 AVHREI--FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPY 264
           +VH+ +  FQC  CP +F  K +L RHL  H   K + C Y
Sbjct: 75  SVHQGLRAFQCDKCPKSFVKKSHLERHLYSHSDTKPFQCSY 115

>Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa]
           {ON} complement(101434..102513) [1080 nt, 360 aa]
          Length = 359

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 51/110 (46%), Gaps = 19/110 (17%)

Query: 189 TPCRTVGTSSTSYKVHKKKHMTRSIRQELIAL--------SPELGAVHREIFQCPHCPSN 240
           +P +TV +     ++H + +   ++ + +  L        SP L  +  ++F C HC   
Sbjct: 254 SPPQTVLSDDDQMEIHDELNKITTMPKRIGTLPKTRGRKPSPILDPL--KLFACEHCDRR 311

Query: 241 FKVKGYLTRHLKK-HLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS 289
           FK + +L RH++  H+  K + C      C+     +FSR D    H+K+
Sbjct: 312 FKRQEHLKRHVRSLHMGEKPFSCHI----CE----KKFSRSDNLNQHIKT 353

>SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 767

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 14/58 (24%), Positives = 28/58 (48%), Gaps = 8/58 (13%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS 289
           F+CPHC   F  +  L +H++ H   + + C Y         T +F+   + + H+++
Sbjct: 658 FKCPHCTKKFSTEDILQQHIRTHSGERPFKCTY--------CTKQFATSSSLRIHIRT 707

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 8/53 (15%)

Query: 237 CPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS 289
           C  +F  +  L RHLK H   K + CP        H T +FS +D  + H+++
Sbjct: 635 CSKSFTQRQKLLRHLKVHSGYKPFKCP--------HCTKKFSTEDILQQHIRT 679

>Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {ON}
           YPR186C (REAL)
          Length = 407

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 226 AVHREI--FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPY 264
           +VH+ +  FQC  CP +F  K +L RHL  H   K + C Y
Sbjct: 72  SVHQGLRPFQCDKCPKSFVKKSHLERHLYSHSDTKPFQCSY 112

>Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W
           (REAL)
          Length = 398

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 12/81 (14%)

Query: 215 QELIALSPELG-AVHREIFQCPH---CPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCK 270
           + + A +P+   +  R+ F+C     C  +F    +L RH++KH   K + CP       
Sbjct: 23  KSVAASAPKRSKSARRKTFKCTGYDGCAMSFTRAEHLARHIRKHTGEKPFQCP------A 76

Query: 271 CHTTGEFSRKDTFKTHLKSIH 291
           C     FSR D  K H +S+H
Sbjct: 77  C--LKFFSRVDNLKQHRESVH 95

>TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.281
           YBR066C
          Length = 314

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 37/86 (43%), Gaps = 11/86 (12%)

Query: 208 HMTRSIRQELIALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSP 267
           H   SI  + + L P      ++ + C  C       G+L RH + H   K+Y C +   
Sbjct: 233 HTFSSIDDDELKLDPSQYDPKKK-YICKVCSKGLTTSGHLARHYRIHTGEKNYSCLHEGC 291

Query: 268 DCKCHTTGEFSRKDT----FKTHLKS 289
           D K      FSR D     +KTHLK+
Sbjct: 292 DQK------FSRHDNCKQHYKTHLKN 311

>Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON}
           YPL230W (REAL)
          Length = 386

 Score = 33.9 bits (76), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 11/69 (15%)

Query: 226 AVHREIFQCPH---CPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT 282
           +  R+ F+C     C  +F    +L RH++KH   K + CP             FSR D 
Sbjct: 35  SARRKSFKCTGYDGCAMSFTRAEHLARHIRKHTGEKPFQCPAC--------LKFFSRVDN 86

Query: 283 FKTHLKSIH 291
            K H +S+H
Sbjct: 87  LKQHRESVH 95

>NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {ON}
           Anc_3.281
          Length = 293

 Score = 33.9 bits (76), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 10/64 (15%)

Query: 229 REIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT----FK 284
           R  + C  C   F   G+L RH + H   K +HC Y  P C      +FSR D     ++
Sbjct: 225 RRKYICKVCSKGFTTSGHLARHNRIHTGEKKHHCSY--PGCYL----KFSRHDNCVQHYR 278

Query: 285 THLK 288
           TH K
Sbjct: 279 THFK 282

>NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518
          Length = 401

 Score = 33.9 bits (76), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 6/58 (10%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS 289
           F+C  C   F    +  RH++ H   K +HC +  P C       FSR D  K HL++
Sbjct: 18  FRCETCARGFHRLEHKKRHMRTHTGEKPHHCAF--PGCG----KGFSRSDELKRHLRT 69

>KLLA0E13487g Chr5 complement(1190615..1191307) [693 bp, 230 aa]
           {ON} some similarities with uniprot|Q12139 Saccharomyces
           cerevisiae YPR022C Hypothetical ORF
          Length = 230

 Score = 33.5 bits (75), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 24/59 (40%), Gaps = 2/59 (3%)

Query: 232 FQCPH--CPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLK 288
           + CPH  C   F    +L RH   H P + + C Y  PD        F RKD    H +
Sbjct: 18  YVCPHPDCEKTFSRYEHLQRHKLNHWPKQIFRCEYVYPDDGIVCNRTFVRKDLLVRHQR 76

>SAKL0H24464g Chr8 complement(2118553..2121405) [2853 bp, 950 aa]
           {ON} similar to gnl|GLV|KLLA0E13497g Kluyveromyces
           lactis KLLA0E13497g and weakly similar to YPR022C
           uniprot|Q12139 Saccharomyces cerevisiae YPR022C
           Hypothetical ORF
          Length = 950

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 2/59 (3%)

Query: 232 FQCPH--CPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLK 288
           + CPH  C  +F  + +L+RH   H P + + C Y  P+        F R+D    H K
Sbjct: 16  YVCPHPNCSKSFTRQEHLSRHKLNHWPKEIFRCHYVYPEDGVACNRTFVRRDLLVRHEK 74

>SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 499

 Score = 33.9 bits (76), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 9/59 (15%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKK-HLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS 289
           F+C  C   F+   +L RH++  H   + +HC Y    C      +FSR D    HLK+
Sbjct: 442 FKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSY----CD----KKFSRSDNLSQHLKT 492

>YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putative
           transcription factor containing a C2H2 zinc finger;
           mutation affects transcriptional regulation of genes
           involved in growth on non-fermentable carbon sources,
           response to salt stress and cell wall biosynthesis
          Length = 391

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 11/69 (15%)

Query: 226 AVHREIFQCPH---CPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT 282
           +  R+ F+C     C  +F    +L RH++KH   K + CP       C     FSR D 
Sbjct: 35  SARRKTFKCTGYDGCTMSFTRAEHLARHIRKHTGEKPFQCP------AC--LKFFSRVDN 86

Query: 283 FKTHLKSIH 291
            K H +S+H
Sbjct: 87  LKQHRESVH 95

>NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {ON}
           
          Length = 263

 Score = 33.5 bits (75), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 10/59 (16%)

Query: 234 CPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT----FKTHLK 288
           C  C   F   G+L+RH + H   K++ CPY   + K      FSR D     ++THLK
Sbjct: 208 CKTCSMGFTTSGHLSRHNRIHTGEKNHSCPYKGCNQK------FSRHDNCLQHYRTHLK 260

>NCAS0A02160 Chr1 complement(406753..407991) [1239 bp, 412 aa] {ON}
           Anc_4.189
          Length = 412

 Score = 33.5 bits (75), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 3/76 (3%)

Query: 233 QCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIHF 292
           +C HCP  F+       HL ++   +++ CP+ +  C  H  G F R+   + H  + H 
Sbjct: 271 RCAHCPRRFRTLYEYAAHLDEYSIVREFKCPFKT--CPWHILG-FPRRSDLRRHCANQHK 327

Query: 293 VYPVGVVKSQRSYSKG 308
               G +K++ +   G
Sbjct: 328 ENLTGQLKNKLNLKDG 343

>NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3.281
          Length = 330

 Score = 33.1 bits (74), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 10/65 (15%)

Query: 228 HREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT----F 283
           HR  + C  C   F   G+L RH + H   K + C +         T +FSR D     +
Sbjct: 266 HRRKYLCKVCSKGFTTSGHLARHNRIHTGEKSHACHFAG------CTQKFSRHDNCLQHY 319

Query: 284 KTHLK 288
           +TH K
Sbjct: 320 RTHFK 324

>KAFR0F03940 Chr6 complement(769153..770511) [1359 bp, 452 aa] {ON}
           Anc_4.189 YGR044C
          Length = 452

 Score = 33.1 bits (74), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 39/92 (42%), Gaps = 6/92 (6%)

Query: 177 EDRKLIPTSLSETPCRTVGTSSTSYKVHKKKHMTRSIRQELIALSPELGAV----HREIF 232
           E R+L    +SE     +  +          HMT  + ++L +  P L A+     R  +
Sbjct: 246 EIRRLNSKKISEVSTNKIAKNKLITPPTTPSHMT--LVEQLKSDKPLLQAISNTHKRGSY 303

Query: 233 QCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPY 264
           +C HCP  F        HL K+   +++ CP+
Sbjct: 304 RCAHCPIMFSTVFEYASHLDKYEIRREFKCPF 335

>KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 474

 Score = 33.1 bits (74), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 13/71 (18%)

Query: 221 SPELGAVHREIFQCPHCPSNFKVKGYLTRHLKK-HLPNKDYHCPYWSPDCKCHTTG-EFS 278
           SP L A   + F C +C   FK + +L RH++  H+  K Y          CH  G +FS
Sbjct: 409 SPILDA--SKPFGCEYCDRRFKRQEHLKRHIRSLHICEKPY---------GCHLCGKKFS 457

Query: 279 RKDTFKTHLKS 289
           R D    HLK+
Sbjct: 458 RSDNLSQHLKT 468

>KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON}
           Anc_2.533 YMR070W
          Length = 352

 Score = 33.1 bits (74), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 8/69 (11%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIH 291
           + CP CP +F+   +L RH   H  +  + C  W   CK     E  R+D    H+K  H
Sbjct: 250 YPCPQCPKSFQRSAWLKRHSITHTNSHPFKC-VW---CK----SEHKRRDNMFKHMKLKH 301

Query: 292 FVYPVGVVK 300
               + V++
Sbjct: 302 MNLLMKVIR 310

>TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 33.1 bits (74), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 40/101 (39%), Gaps = 10/101 (9%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLK--- 288
           F+CP C   F    +  RH++ H   K + CP       C+ +  FSR D  K H+K   
Sbjct: 16  FKCPMCHRGFYRAEHKKRHIRTHTGEKPHLCPILG----CNKS--FSRTDELKRHMKVHP 69

Query: 289 -SIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHI 328
            S H ++         S S     +  Q    + +  N H+
Sbjct: 70  ASTHNLHSTSTTSLNISNSTMSMTSLLQSNSVSNLPSNIHV 110

>KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa]
           {ON} Anc_2.533 YMR070W
          Length = 554

 Score = 33.1 bits (74), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 8/64 (12%)

Query: 231 IFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSI 290
           I +C  C  +FK + +L RHL  H   + Y CP+      C +     RKD    H+K  
Sbjct: 435 IHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPW------CLS--RHKRKDNLLQHMKLK 486

Query: 291 HFVY 294
           H  Y
Sbjct: 487 HSNY 490

>Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {ON}
           YMR037C (REAL)
          Length = 703

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 11/87 (12%)

Query: 204 HKKKHMTRSIRQELIALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCP 263
           +++K MT S R  ++  S +   +  + F C  CP +FK   +L RH++    N+    P
Sbjct: 620 YRRKSMTPSRRSSVVMESTK--ELEEKPFHCHICPKSFKRSEHLKRHVRSVHSNER---P 674

Query: 264 YWSPDCKCHT-TGEFSRKDTFKTHLKS 289
           +      CH    +FSR D    H+K+
Sbjct: 675 FA-----CHICEKKFSRSDNLSQHIKT 696

>TDEL0C01110 Chr3 complement(188642..190381) [1740 bp, 579 aa] {ON}
           Anc_8.82 YPL007C
          Length = 579

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 14/24 (58%)

Query: 252 KKHLPNKDYHCPYWSPDCKCHTTG 275
           +KHL  + YHC  WSPD  C   G
Sbjct: 125 EKHLEQRSYHCMEWSPDGSCLAIG 148

>KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.533
           YMR070W
          Length = 490

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 28/66 (42%), Gaps = 8/66 (12%)

Query: 231 IFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSI 290
           I  C  C  +F+ K +L RHL  H   + + CP+    C         RKD    H+K  
Sbjct: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPW----C----LSRHKRKDNLLQHMKLK 403

Query: 291 HFVYPV 296
           H  Y V
Sbjct: 404 HSNYLV 409

>KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 33/79 (41%), Gaps = 7/79 (8%)

Query: 220 LSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSR 279
           L P    ++R+ + C  C   FK    L+ H   H   K +HCP      KC  T  F+ 
Sbjct: 221 LLPGKDGLYRKKYCCNVCGKRFKRPSSLSTHTNIHTGKKPFHCPL----AKC--TKTFNA 274

Query: 280 KDTFKTHLKSIHFVYPVGV 298
           +     H K+ HF    GV
Sbjct: 275 RSNMLRHYKA-HFKLASGV 292

>TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144
           YER130C
          Length = 687

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 9/61 (14%)

Query: 230 EIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCK-CHTTGEFSRKDTFKTHLK 288
           +IF CP+C   FK + +L RH      N+  H      DC  C+   +FSR D    H+K
Sbjct: 632 KIFICPYCNRRFKRQEHLKRH------NRSLHMGEKPFDCHICN--KKFSRSDNLAQHIK 683

Query: 289 S 289
           +
Sbjct: 684 T 684

>KLTH0G17336g Chr7 (1500141..1501598) [1458 bp, 485 aa] {ON} some
           similarities with uniprot|P32338 Saccharomyces
           cerevisiae YGR044C RME1 mediates cell type control of
           sporulation negatively regulates IME1 and sporulation
           zinc finger protein negative regulator of meiosis
           directly repressed by a1-a2 regulator
          Length = 485

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 212 SIRQELIALSPELGA----VHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPY 264
           S+ Q+LI  +P + A    V R  ++C HCP  F       +H+ +    +DY CP+
Sbjct: 315 SVYQQLIDDNPLMEALSKRVKRGYYRCAHCPKMFSNVLEYAKHIDEFEIQRDYKCPF 371

>KLLA0A02629g Chr1 complement(233822..235501) [1680 bp, 559 aa] {ON}
           some similarities with uniprot|P32338 Saccharomyces
           cerevisiae YGR044C RME1 mediates cell type control of
           sporulation negatively regulates IME1 and sporulation
           zinc finger protein negative regulator of meiosis
           directly repressed by a1-a2 regulator
          Length = 559

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 32/69 (46%), Gaps = 6/69 (8%)

Query: 211 RSIRQELIALSPELGAV----HREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWS 266
           +S+ Q+++   P + A+     R  ++C HCP  F       +H+ ++   + Y CP+  
Sbjct: 388 KSVLQQILDDKPLMEAISKKQKRGAYKCAHCPEMFNTIFEFAKHIDEYQVERKYKCPF-- 445

Query: 267 PDCKCHTTG 275
           P C     G
Sbjct: 446 PLCPWKILG 454

>CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakly
           similar to uniprot|P54785 Saccharomyces cerevisiae
           YMR070w MOT3
          Length = 647

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 8/60 (13%)

Query: 233 QCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIHF 292
           +C  CP  FK K +L RHL  H   + + CP+      C++     R+D    H+K  H 
Sbjct: 535 RCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPW------CNS--RHKRRDNLLQHMKLKHV 586

>YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc finger
           transcriptional repressor; cooperates with Mig1p in
           glucose-induced repression of many genes including SUC2
           (invertase); binds to Mig1p-binding sites in SUC2
           promoter; under low glucose conditions Mig2p relocalizes
           to mitochondrion, where it regulates morphology,
           interacts with Ups1p and antagonizes mitochondrial
           fission factor, Dnm1p, indicative of a role in promoting
           mitochondrial fusion or regulating morphology
          Length = 382

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 6/58 (10%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS 289
           F+C  C   F    +  RHL+ H   K +HC +  P C       FSR D  K H+++
Sbjct: 17  FRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAF--PGCG----KSFSRSDELKRHMRT 68

>YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON}
           MSN2Transcriptional activator related to Msn4p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 704

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 11/87 (12%)

Query: 204 HKKKHMTRSIRQELIALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCP 263
           +++K MT S R  ++  S +   +  + F C  CP +FK   +L RH++    N+    P
Sbjct: 621 YRRKSMTPSRRSSVVIESTK--ELEEKPFHCHICPKSFKRSEHLKRHVRSVHSNE---RP 675

Query: 264 YWSPDCKCHT-TGEFSRKDTFKTHLKS 289
           +      CH    +FSR D    H+K+
Sbjct: 676 FA-----CHICDKKFSRSDNLSQHIKT 697

>KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]
           {ON} some similarities with uniprot|Q03125 Saccharomyces
           cerevisiae YDR043C NRG1 Transcriptional repressor that
           recruits the Cyc8p-Tup1p complex to promoters
          Length = 357

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 7/70 (10%)

Query: 223 ELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT 282
           +L    R  + C  C   F   G+L RH + H   K + C +  P C       FSR D 
Sbjct: 275 DLPLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQF--PGCN----QRFSRHDN 328

Query: 283 FKTHLKSIHF 292
           +  H ++ HF
Sbjct: 329 YIQHYRT-HF 337

>SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {ON}
           similar to uniprot|Q750L1 Ashbya gossypii AGR031W
           AGR031Wp and some similarites with YDR043C
           uniprot|Q03125 Saccharomyces cerevisiae YDR043C NRG1
           Transcriptional repressor that recruits the Cyc8p-Tup1p
           complex to promoters mediates glucose repression and
           negatively regulates a variety of processes including
           filamentous growth and alkaline pH response
          Length = 157

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 10/65 (15%)

Query: 229 REIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT----FK 284
           R  + C  C   F   G+L RH + H   K++ CP+            FSR D     ++
Sbjct: 97  RRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEG------CGQRFSRHDNCVQHYR 150

Query: 285 THLKS 289
           THLK+
Sbjct: 151 THLKT 155

>Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W
           (REAL)
          Length = 383

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 6/58 (10%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS 289
           F+C  C   F    +  RHL+ H   K +HC +  P C       FSR D  K H+++
Sbjct: 17  FRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAF--PGCG----KSFSRSDELKRHMRT 68

>TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 33/79 (41%), Gaps = 13/79 (16%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIH 291
           F C  C   F+   +  RH++ H   K +HC +    C      +FSR D  K HLK   
Sbjct: 13  FICDICSKGFRRLEHKKRHIRTHTGEKPHHCTFKG--C----VKKFSRSDELKRHLK--- 63

Query: 292 FVYPVGVVKSQRSYSKGRC 310
               + V K +   SK R 
Sbjct: 64  ----IHVNKKKNRASKNRI 78

>Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W
           (REAL)
          Length = 392

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 11/69 (15%)

Query: 226 AVHREIFQCPH---CPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT 282
           +  R+ F+C     C  +F    +L RH++KH   K + CP       C     FSR D 
Sbjct: 38  SARRKTFKCTGYDGCAMSFTRAEHLARHIRKHTGEKPFQCP------AC--LKFFSRVDN 89

Query: 283 FKTHLKSIH 291
            K H +S+H
Sbjct: 90  LKQHRESVH 98

>Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)
          Length = 382

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 6/58 (10%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS 289
           F+C  C   F    +  RHL+ H   K +HC +  P C       FSR D  K H+++
Sbjct: 17  FRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAF--PGCG----KSFSRSDELKRHMRT 68

>Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)
          Length = 400

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 6/58 (10%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS 289
           F+C  C   F    +  RHL+ H   K +HC +  P C       FSR D  K H+++
Sbjct: 17  FRCDTCNRGFHRLEHKKRHLRTHTGEKPHHCGF--PGCG----KSFSRSDELKRHMRT 68

>Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON}
           YER028C (REAL)
          Length = 394

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 6/61 (9%)

Query: 229 REIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLK 288
           R  F+C  C   F    +  RH++ H   K Y C   S +C    T  FSR D  K H +
Sbjct: 14  RRPFRCEICSRGFHRLEHKKRHVRTHTGEKPYKC--SSKNC----TKSFSRSDELKRHFR 67

Query: 289 S 289
           +
Sbjct: 68  T 68

>KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {ON}
           some similarities with uniprot|P27705 Saccharomyces
           cerevisiae YGL035C
          Length = 460

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 31/71 (43%), Gaps = 7/71 (9%)

Query: 221 SPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRK 280
           SP  G      + CP C   F    + TRH++ H   K + C +  P C    T +FSR 
Sbjct: 15  SPNSGPDSPRPYICPICSRAFHRLEHQTRHIRTHTGEKPHACDF--PGC----TKKFSRS 68

Query: 281 DTFKTHLKSIH 291
           D    H K IH
Sbjct: 69  DELTRH-KRIH 78

>Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {ON}
           YKL062W (MSN4) - zinc finger protein [contig 59] FULL
          Length = 698

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 9/59 (15%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKK-HLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS 289
           F+C  C   F+   +L RH++  H   + +HC Y    C      +FSR D    HLK+
Sbjct: 641 FKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSY----CD----KKFSRSDNLSQHLKT 691

>KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 677

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 9/59 (15%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKK-HLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS 289
           F+C  C   F+   +L RH++  H   + +HC Y    C      +FSR D    HLK+
Sbjct: 620 FKCQECTKAFRRSEHLKRHIRSVHSTERPFHCSY----CD----KKFSRSDNLSQHLKT 670

>NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281
          Length = 266

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 10/64 (15%)

Query: 229 REIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT----FK 284
           R    C  C + F   G+L+RH + H   K++ CP+   + K      FSR D     ++
Sbjct: 207 RRKHVCKICSTGFTTSGHLSRHNRIHTGEKNHSCPFEGCNQK------FSRHDNCLQHYR 260

Query: 285 THLK 288
           THLK
Sbjct: 261 THLK 264

>NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256
          Length = 274

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 32/83 (38%), Gaps = 20/83 (24%)

Query: 239 SNFKVKGY------------LTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTH 286
           +NFK  GY            L RH++KH   K + C              FSR D  K H
Sbjct: 17  NNFKCTGYGDCHMAFTRAEHLARHIRKHTGEKPFQCDVC--------LKRFSRVDNLKQH 68

Query: 287 LKSIHFVYPVGVVKSQRSYSKGR 309
            +S+H        K+    +KGR
Sbjct: 69  RESVHATVVNAASKNVPLVAKGR 91

>NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {ON}
           Anc_8.144
          Length = 547

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 50/114 (43%), Gaps = 13/114 (11%)

Query: 177 EDRKLIPTSLSETPCRTVGTSSTSYKVHKKKHMTRSIRQELIALSPELGAVHREIFQCPH 236
           E+ K+   S S +      ++S+++ + KK       R    +L P+      + F C +
Sbjct: 444 ENMKIRKDSTSSSHLHNESSTSSTHVIRKKLGNMPKTRGRKPSLLPDAT----KQFACDY 499

Query: 237 CPSNFKVKGYLTRHLKK-HLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS 289
           C   FK + +L RH++  H+  K Y C        C+    FSR D    H+K+
Sbjct: 500 CERRFKRQEHLKRHVRSLHIGEKPYACHI------CN--KNFSRSDNLTQHIKT 545

>KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weakly
           similar to uniprot|P33748 Saccharomyces cerevisiae
           YMR037C MSN2 Transcriptional activator related to Msn4p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 694

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 9/59 (15%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKK-HLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS 289
           F+C  C   F+   +L RH++  H   + +HC +      C    +FSR D    HLK+
Sbjct: 621 FKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQF------CDK--KFSRSDNLSQHLKT 671

>KAFR0D03890 Chr4 complement(752859..759476) [6618 bp, 2205 aa] {ON}
            Anc_1.94 YNL262W
          Length = 2205

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 230  EIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKC 271
            +IF CPHCP  F  K  L  HL K + ++     Y++ D KC
Sbjct: 2108 KIFSCPHCPKAFN-KLILQEHLIKKIVSQ--FEAYYTQDLKC 2146

>TBLA0D02300 Chr4 (581398..584553) [3156 bp, 1051 aa] {ON} Anc_8.130
           YPR022C
          Length = 1051

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 2/35 (5%)

Query: 232 FQCPH--CPSNFKVKGYLTRHLKKHLPNKDYHCPY 264
           F CPH  C  +F  + +L+RH   H P K Y C Y
Sbjct: 10  FACPHPDCNKSFSRQEHLSRHKLNHWPKKIYKCTY 44

>Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {ON}
           YDR043C (NRG1) - transcriptional repressor which can
           bind to UAS-1 in the STA1 promoter and which can
           interact with Ssn6p [contig 33] FULL
          Length = 264

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 10/64 (15%)

Query: 229 REIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT----FK 284
           R  + C  C   F   G+L RH + H   K++ CP+            FSR D     +K
Sbjct: 198 RRRYVCKICVKGFTTSGHLARHNRIHTGEKNHVCPHEG------CGQRFSRHDNCVQHYK 251

Query: 285 THLK 288
           THL+
Sbjct: 252 THLR 255

>AGL246W Chr7 (240857..241540) [684 bp, 227 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR253C (MET32) and
           YPL038W (MET31)
          Length = 227

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 10/60 (16%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGE-FSRKDTFKTHLKSI 290
           F C  C   F+  G L RH K HLP          P+  C   G+ F+RKD  K H  ++
Sbjct: 147 FHCTKCELVFRRSGDLRRHEKVHLP--------ILPNI-CSLCGKGFARKDALKRHFGTL 197

>KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}
           Anc_3.298
          Length = 394

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 56/127 (44%), Gaps = 15/127 (11%)

Query: 183 PTSLSETPCRTVGTSSTSYKVHKKKHMTRSIRQELIALSPELGAVHREIFQCPHCPSNFK 242
           P+ +S  P +   T+ST      +++  +SI+   + +SP    V    + C  C   FK
Sbjct: 240 PSEVSSLPTKGRYTAST------QQNEKKSIQD--LEISPSTDKVK---YCCKVCSKRFK 288

Query: 243 VKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLK--SIHFVYPVGVVK 300
               L+ H+  H   K Y CP+   +C+     + +    +K H K  S  +V P G + 
Sbjct: 289 RPSSLSTHMNIHTGYKPYQCPFS--NCQKSFNAKSNMLRHYKLHFKLSSGVYVLPSGEIT 346

Query: 301 SQRSYSK 307
            Q+  SK
Sbjct: 347 LQKPTSK 353

>TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1375

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 49/102 (48%), Gaps = 16/102 (15%)

Query: 193 TVGTSSTSY--KVHKK-KHMTRSIRQELIALSPELGAVHREIFQCPHCPSNFKVKGYLTR 249
           T+G+ S +   KV+KK K +  ++R  L   +P  G V   +F C  C   F  + +LTR
Sbjct: 7   TIGSFSNNMNSKVNKKHKDLPDNLR--LNGKTPS-GKV--RLFVCSICTRAFARQEHLTR 61

Query: 250 HLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIH 291
           H + H   K Y C      C+     +FSR+D    H + IH
Sbjct: 62  HERSHTKEKPYCCGL----CQ----RKFSRRDLLLRHAQKIH 95

>NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {ON}
           Anc_2.533
          Length = 541

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 8/65 (12%)

Query: 227 VHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTH 286
           +  + ++C  C   FK + +L RHL  H   + Y CP+    C         R+D    H
Sbjct: 395 IESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPW----C----LSRHKRRDNLLQH 446

Query: 287 LKSIH 291
           +K  H
Sbjct: 447 MKLKH 451

>Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON}
           (79397..80281) [885 nt, 295 aa]
          Length = 294

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 10/69 (14%)

Query: 237 CPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEF-SRKDTFKTHLKSIHFVYP 295
           C   F     L RH +KH   K +         +CH   +F SR D  K H++S+H ++P
Sbjct: 33  CSMEFTRSENLVRHRRKHTGEKPF---------QCHVCLKFFSRIDNLKQHIESVHGIHP 83

Query: 296 VGVVKSQRS 304
             V +++ S
Sbjct: 84  AIVKRTKIS 92

>Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {ON}
           complement(39687..41171) [1485 nt, 495 aa]
          Length = 494

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 17/87 (19%)

Query: 207 KHMTRSIRQELIALSPELGAVHREI---FQCPHCPSNFKVKGYLTRHLKK-HLPNKDYHC 262
           K++T S R   I+++      + EI   F+C  C   F+   +L RH++  H   + + C
Sbjct: 414 KNLTASKRNSSISINS-----NDEIEKPFKCGDCTKQFRRSEHLKRHIRSVHSKERPFPC 468

Query: 263 PYWSPDCKCHTTGEFSRKDTFKTHLKS 289
            Y      C    +FSR D    HLK+
Sbjct: 469 KY------CD--KKFSRSDNLSQHLKT 487

>CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa]
           {ON} weakly similar to uniprot|Q03125 Saccharomyces
           cerevisiae YDR043c NRG1
          Length = 463

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 28/66 (42%), Gaps = 10/66 (15%)

Query: 229 REIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT----FK 284
           R  + C  C   F   G+L RH + H   K + CPY            F+R D     +K
Sbjct: 399 RRKYLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEG------CGQRFNRHDNCLQHYK 452

Query: 285 THLKSI 290
           THLK +
Sbjct: 453 THLKRL 458

>Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {ON}
           complement(96025..97794) [1770 nt, 590 aa]
          Length = 589

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 8/58 (13%)

Query: 234 CPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIH 291
           C  C   FK K +L RHL  H   +++ CP+    C      +  RKD    H+K  H
Sbjct: 479 CHICGKQFKRKSWLQRHLLSHSSERNFDCPW----C----LSKHKRKDNLLQHMKLKH 528

>Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {ON}
           similar to Ashbya gossypii AEL278W
          Length = 431

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 34/86 (39%), Gaps = 9/86 (10%)

Query: 220 LSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHL-PN--KDYHCPYWSPDCKCHTTGE 276
           L   + +VH +   C HC   F+    L  H+ KH  PN    Y C +  P C    T  
Sbjct: 152 LRSHVLSVHEKTLTCGHCSKTFQRPYRLKNHISKHHNPNCETKYQCNF--PLC----TKA 205

Query: 277 FSRKDTFKTHLKSIHFVYPVGVVKSQ 302
           F    T + H+K  H   P  +   Q
Sbjct: 206 FKTWSTLQQHIKDDHPKLPCAICGKQ 231

>KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {ON}
           similar to uniprot|P39933 Saccharomyces cerevisiae
           YPR186C PZF1 Transcription factor IIIA (TFIIIA) with
           putative Zn-fingers
          Length = 472

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 33/82 (40%), Gaps = 9/82 (10%)

Query: 220 LSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKD---YHCPYWSPDCKCHTTGE 276
           L   + +VH +   CPHC   F+    L  H+ KH   +    Y C + S       T  
Sbjct: 208 LRSHILSVHEKKLTCPHCNKTFQRPYRLKNHIDKHHNPESTGMYQCDFLS------CTDV 261

Query: 277 FSRKDTFKTHLKSIHFVYPVGV 298
           FS   + + H+K  H   P  +
Sbjct: 262 FSTWSSLQQHIKQCHPKLPCPI 283

>CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} similar
           to uniprot|P46974 Saccharomyces cerevisiae YJR127c ZMS1
           or uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1020

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 28/64 (43%), Gaps = 10/64 (15%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDC-KCHTTGEFSRKDTFKTHLKSI 290
           F CP C   F  + +L RH   H   K + C      C KC     F+RKD    HL+ +
Sbjct: 27  FLCPICSRGFVRQEHLKRHQNSHTHEKPFLCLI----CGKC-----FARKDLVLRHLQKL 77

Query: 291 HFVY 294
           H  Y
Sbjct: 78  HRDY 81

>ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER130C
          Length = 520

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 11/70 (15%)

Query: 221 SPELGAVHREIFQCPHCPSNFKVKGYLTRHLKK-HLPNKDYHCPYWSPDCKCHTTGEFSR 279
           SP L A   + F C +C   FK + +L RH++  H+  K Y C             +FSR
Sbjct: 451 SPALDAT--KPFGCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICG--------KKFSR 500

Query: 280 KDTFKTHLKS 289
            D    H+K+
Sbjct: 501 SDNLNQHIKT 510

>Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}
           similar to Ashbya gossypii AEL174W
          Length = 663

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/58 (20%), Positives = 27/58 (46%), Gaps = 8/58 (13%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS 289
           F+CPHC   F  +  L++H++ H   + + C +            F+   + + H+++
Sbjct: 546 FKCPHCSKTFSTEDILSQHIRTHSGERPFKCQFCDK--------RFTTSSSLRIHIRT 595

>NDAI0E03120 Chr5 (662597..663316) [720 bp, 239 aa] {ON} Anc_8.486
           YDR253C
          Length = 239

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 29/73 (39%), Gaps = 10/73 (13%)

Query: 219 ALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGE-F 277
           A SP   A H   + C  C   F     L RH K HL           P+  C   G+ F
Sbjct: 145 ATSPTAAANHNRRYPCSKCELEFLRTSDLRRHEKAHL--------LVLPNI-CSQCGKGF 195

Query: 278 SRKDTFKTHLKSI 290
           +RKD  K H  ++
Sbjct: 196 ARKDALKRHFNTM 208

>Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON}
           complement(48007..48672) [666 nt, 222 aa]
          Length = 221

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 33/75 (44%), Gaps = 7/75 (9%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIH 291
           + C  C   F    +  RHLK H   K Y C Y   +C    + +FSR D    H K +H
Sbjct: 19  YLCEVCNRGFYRLEHKKRHLKIHTGEKPYKCLYL--NC----SKKFSRSDELNRHSK-VH 71

Query: 292 FVYPVGVVKSQRSYS 306
                G +K ++S S
Sbjct: 72  HSRANGSIKRKKSIS 86

>ZYRO0B01892g Chr2 complement(151888..152991) [1104 bp, 367 aa] {ON}
           conserved hypothetical protein
          Length = 367

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 36/85 (42%), Gaps = 1/85 (1%)

Query: 259 DYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFE 318
           DYH P ++          F R D  K  ++     Y V +  + R  S G    C + F 
Sbjct: 41  DYHAPDYTSPWAGANWCSFVR-DGDKLQIQRDKLTYDVLLQLADREQSCGVKKYCLKTFM 99

Query: 319 SNVVWLNEHIETGICRGLFEVKNEE 343
           S    +  +I+ G  +GL E+ NEE
Sbjct: 100 SRNSAVPWYIKDGFVKGLKELSNEE 124

>ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL062W
           (MSN4) and YMR037C (MSN2)
          Length = 571

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 9/59 (15%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKK-HLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS 289
           F+C  C   F+   +L RH++  H  ++ + C Y      C    +FSR D    HLK+
Sbjct: 504 FKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTY------CDK--KFSRSDNLSQHLKT 554

>NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {ON}
           Anc_8.425
          Length = 1152

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 27/61 (44%), Gaps = 8/61 (13%)

Query: 231 IFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSI 290
           +F C  C   F  + +L RH + H   K Y C      C    T +F+R+D    H + +
Sbjct: 77  LFVCDVCSRAFARQEHLDRHARSHTNEKPYQCGI----C----TKKFTRRDLLLRHAQKV 128

Query: 291 H 291
           H
Sbjct: 129 H 129

>CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some
           similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c
          Length = 317

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 15/73 (20%)

Query: 219 ALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKK-HLPNKDYHCPYWSPDCKCHT-TGE 276
           +L P+L       F C  C   FK + +L RH++  H+  K Y         +CH    +
Sbjct: 255 SLVPDLSKQ----FGCEFCDRRFKRQEHLKRHIRSLHMGEKPY---------ECHICNKK 301

Query: 277 FSRKDTFKTHLKS 289
           FSR D    H+K+
Sbjct: 302 FSRSDNLNQHIKT 314

>Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON}
           complement(124703..125578) [876 nt, 292 aa]
          Length = 291

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 2/25 (8%)

Query: 232 FQCP--HCPSNFKVKGYLTRHLKKH 254
           F+CP  +CP +F VK  + RHLK H
Sbjct: 177 FKCPWENCPKSFNVKSNMLRHLKSH 201

>Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130C -
           Hypothetical ORF [contig 211] FULL
          Length = 403

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 13/71 (18%)

Query: 221 SPELGAVHREIFQCPHCPSNFKVKGYLTRHLKK-HLPNKDYHCPYWSPDCKCHTTG-EFS 278
           SP L A  +  F C  C   FK + +L RH++  H+  K +          CH  G +FS
Sbjct: 337 SPILDASKQ--FACDFCDRRFKRQEHLKRHVRSLHMGEKPFD---------CHICGKKFS 385

Query: 279 RKDTFKTHLKS 289
           R D    H+K+
Sbjct: 386 RSDNLNQHIKT 396

>Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON}
           similar to Ashbya gossypii ADL050W
          Length = 179

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 25/58 (43%), Gaps = 7/58 (12%)

Query: 234 CPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIH 291
           CP C   F  K  L  HL  H   + Y C Y  PDCK      F+ K     HLK IH
Sbjct: 111 CPVCLKEFTRKTSLNTHLLIHADIRPYRCKY--PDCK----KTFNVKSNLNRHLK-IH 161

>KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.256
           YPL230W
          Length = 413

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 11/66 (16%)

Query: 229 REIFQCP---HCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKT 285
           +++F+C     C   F    +L RH++KH   K + C Y    C  H    FSR D  K 
Sbjct: 40  KKMFKCQGFEDCHMAFTRAEHLARHIRKHTGEKPFQC-YI---CLKH----FSRVDNLKQ 91

Query: 286 HLKSIH 291
           H +S+H
Sbjct: 92  HRESVH 97

>AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR043C (NRG1) and
           YBR066C (NRG2)
          Length = 140

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 10/59 (16%)

Query: 234 CPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT----FKTHLK 288
           C  C   F   G+L RH + H   K++ C +  P C       FSR D     ++THLK
Sbjct: 82  CQTCGKGFTTSGHLARHNRIHTGEKNHACHF--PGC----GQRFSRHDNCLQHYRTHLK 134

>AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML081W and
           YJR127C (ZMS1)
          Length = 1191

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 8/60 (13%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIH 291
           F CP C   F  + +L RH + H   K + C +     +C     F+R+D    H + +H
Sbjct: 80  FLCPVCTRGFARQEHLKRHQRSHTNEKPFLCAFCG---RC-----FARRDLVLRHQQKLH 131

>TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {ON}
           Anc_2.162 YOR113W
          Length = 823

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 39/92 (42%), Gaps = 15/92 (16%)

Query: 181 LIPTSLSETPCRTVGTSSTSYKVHKKKHMTRSIRQELIA----------LSPELGAVHRE 230
           L PTS   +P +++   +T+        +T  +   L++          LSP      ++
Sbjct: 461 LSPTSQENSPRQSIKQETTAANT-----ITSPMGSPLLSTSPQTPVNNDLSPTRSRTKKK 515

Query: 231 IFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHC 262
             QCP+C   F    +L  H++ H+  K Y C
Sbjct: 516 THQCPYCHRFFSQSTHLEVHIRSHIGYKPYQC 547

>CAGL0K04257g Chr11 complement(392116..393759) [1644 bp, 547 aa]
           {ON} some similarities with uniprot|P32338 Saccharomyces
           cerevisiae YGR044c
          Length = 547

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 37/91 (40%), Gaps = 8/91 (8%)

Query: 229 REIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLK 288
           R +++C HCPS F        HL ++   + + CP+   +C     G   R+   + H  
Sbjct: 403 RGLYRCAHCPSTFNNIFEYASHLDEYEVERKHKCPF--KNCAWRILG-LPRRSDLRRHCA 459

Query: 289 SIHFVYPVGVVK-----SQRSYSKGRCAACF 314
             H     G +K     ++ +Y   RC   F
Sbjct: 460 IQHKYELYGQLKKDLNLTEDAYPVLRCPVMF 490

>KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.80
           YGL035C
          Length = 459

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 26/58 (44%), Gaps = 7/58 (12%)

Query: 234 CPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIH 291
           CP C   F    + TRH++ H   K + C +  P C    T  FSR D    H K IH
Sbjct: 45  CPVCGRAFHRLEHQTRHMRTHTGEKPHACDF--PGC----TKRFSRSDELTRH-KRIH 95

>NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {ON}
           Anc_3.518
          Length = 524

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 6/58 (10%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS 289
           F+C  C   F    +  RH++ H   K +HC +  P C       FSR D  K HL++
Sbjct: 18  FKCDVCSRGFHRLEHKKRHMRTHTGEKPHHCNF--PGCG----KSFSRSDELKRHLRT 69

>YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON}
           PZF1Transcription factor IIIA (TFIIIA); essential DNA
           binding protein required for transcription of 5S rRNA by
           RNA polymerase III; not involved in transcription of
           other RNAP III genes; nine conserved zinc fingers; may
           also bind 5S rRNA
          Length = 429

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 2/41 (4%)

Query: 226 AVHREI--FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPY 264
           +VH+ +  FQC  C  +F  K +L RHL  H   K + C Y
Sbjct: 72  SVHQGLRAFQCDKCAKSFVKKSHLERHLYTHSDTKPFQCSY 112

>SAKL0G16434g Chr7 (1423039..1423932) [894 bp, 297 aa] {ON} some
           similarities with uniprot|P32338 Saccharomyces
           cerevisiae YGR044C RME1 mediates cell type control of
           sporulation negatively regulates IME1 and sporulation
           zinc finger protein negative regulator of meiosis
           directly repressed by a1-a2 regulator
          Length = 297

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 42/93 (45%), Gaps = 8/93 (8%)

Query: 204 HKKKHMTRSIRQEL--IALSPELGAVHREIFQCP---HCPSNFKVKGYLTRHLKKHLPNK 258
           H  K +T  +R+++    L   L A  + +++C    HC   F   G L  HL++H   +
Sbjct: 162 HNTKPLTTLLREKVNKTHLQGLLSAKKKGLYKCGSAVHCSKTFASFGELLNHLEQHQIER 221

Query: 259 DYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIH 291
            + CP  S  C     G FS     K H ++IH
Sbjct: 222 KFKCPDHS--CPWGIVG-FSSHAQMKRHYRTIH 251

>SAKL0H11440g Chr8 (982180..982797) [618 bp, 205 aa] {ON} similar to
           uniprot|Q12041 Saccharomyces cerevisiae YDR253C MET32
           Zinc-finger DNA-binding protein, involved in regulating
           expression of the methionine biosynthetic genes
          Length = 205

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 37/88 (42%), Gaps = 10/88 (11%)

Query: 204 HKKKHMTRSIRQELIALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCP 263
            KK+H + S   E  ++         + +QC  C   F+    L RH + HLP       
Sbjct: 97  RKKRHKSTSSSTEADSVEDVQQLNEDKKYQCDKCELVFRRSSDLRRHERAHLP------- 149

Query: 264 YWSPDCKCHTTGE-FSRKDTFKTHLKSI 290
              P+  C   G+ F+RKD  K H  ++
Sbjct: 150 -ILPNI-CSLCGKGFARKDALKRHYDTL 175

>NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON}
           Anc_8.425
          Length = 1350

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 27/61 (44%), Gaps = 8/61 (13%)

Query: 231 IFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSI 290
           +F C  C   F  + +L RH + H   K Y+C   S         +F+R+D    H + +
Sbjct: 115 LFVCEICTRAFARQEHLVRHERSHTKEKPYNCGICS--------KKFTRRDLLIRHAQKV 166

Query: 291 H 291
           H
Sbjct: 167 H 167

>SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1238

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 8/60 (13%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIH 291
           F CP C   F  + +L RH + H   K + C +     +C     F+R+D    H + +H
Sbjct: 73  FLCPICTRGFARQEHLKRHQRSHTNEKPFLCAFCG---RC-----FARRDLVLRHQQKLH 124

>Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {ON}
           YMR037C (REAL)
          Length = 709

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 44/97 (45%), Gaps = 11/97 (11%)

Query: 194 VGTSSTSYKVHKKKHMTRSIRQELIALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKK 253
           VG +      +++K MT S R  ++  S +   +  + F C  C  +FK   +L RH++ 
Sbjct: 616 VGVTKERRPSYRRKSMTPSRRSSVVMESAK--ELEEKPFHCHICSKSFKRSEHLKRHVRS 673

Query: 254 HLPNKDYHCPYWSPDCKCHT-TGEFSRKDTFKTHLKS 289
              N+    P+      CH    +FSR D    H+K+
Sbjct: 674 VHSNER---PFA-----CHICDKKFSRSDNLSQHIKT 702

>KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.144
           YER130C
          Length = 225

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 9/59 (15%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKK-HLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS 289
           F C +C   F+ + ++ RH++  H+  K Y C   S          FSR D  K H K+
Sbjct: 171 FACQYCHRRFRRQEHMKRHIRSLHIAEKPYSCQICS--------KAFSRNDNLKQHRKT 221

>KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some
           similarities with uniprot|Q12132 Saccharomyces
           cerevisiae YPL230W USV1 Up in StarVation
          Length = 331

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 34/78 (43%), Gaps = 13/78 (16%)

Query: 237 CPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGE-FSRKDTFKTHLKSIHFVYP 295
           C   F  + +L RH++KH   + +         +CH     FSR D  K H++S+H    
Sbjct: 28  CRMEFTRQEHLARHIRKHTGEQPF---------QCHLCLRFFSRLDNLKQHVESVHS--- 75

Query: 296 VGVVKSQRSYSKGRCAAC 313
           V +  SQ   SK     C
Sbjct: 76  VSMATSQLKNSKSTAPCC 93

>ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} similar
           to uniprot|P07248 Saccharomyces cerevisiae YDR216W ADR1
           Positive transcriptional regulator controls the
           expression of ADH2 peroxisomal protein genes and genes
           required for ethanol glycerol and fatty acid utilization
          Length = 1346

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 8/61 (13%)

Query: 231 IFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSI 290
           +F C  C   F  + +LTRH + H   K Y C        C+   +FSR+D    H   I
Sbjct: 85  LFVCQVCTRAFARQEHLTRHERSHTKEKPYCCGI------CNR--KFSRRDLLLRHAHKI 136

Query: 291 H 291
           H
Sbjct: 137 H 137

>Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii ACR264W
          Length = 775

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 34/97 (35%), Gaps = 26/97 (26%)

Query: 191 CRTVGTSSTSYKVHKKKHMTRSIRQELIALSPELGAVHREIFQCPHCPSNFKVKGYLTRH 250
           C    T ST  +VH + H         I   P         FQC +C   F   G L  H
Sbjct: 496 CHKCFTQSTHLEVHVRSH---------IGYKP---------FQCEYCGKRFTQGGNLRTH 537

Query: 251 LKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHL 287
           ++ H   + Y C       KC     FSRK     H+
Sbjct: 538 VRLHTGERPYEC------DKCGK--RFSRKGNLAAHM 566

>KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 682

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 25/57 (43%), Gaps = 8/57 (14%)

Query: 233 QCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS 289
           +CPHC   F  +  L +H++ H   K Y C         H    F+   + + H+++
Sbjct: 578 KCPHCAKTFSTQDILQQHIRTHSGEKPYKC--------VHCGKGFATSSSLRIHIRT 626

>ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 557

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 13/71 (18%)

Query: 221 SPELGAVHREIFQCPHCPSNFKVKGYLTRHLKK-HLPNKDYHCPYWSPDCKCHTTG-EFS 278
           SP L A     F C +C   FK + +L RH++  H+  K +          CH  G +FS
Sbjct: 494 SPILDATKH--FGCEYCDRRFKRQEHLKRHVRSLHMCEKPF---------GCHICGKKFS 542

Query: 279 RKDTFKTHLKS 289
           R D    H+K+
Sbjct: 543 RSDNLNQHIKT 553

>Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON}
           complement(28325..32557) [4233 nt, 1411 aa]
          Length = 1410

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 8/61 (13%)

Query: 231 IFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSI 290
           +F C  C   F  + +LTRH + H   K Y C      C+     +FSR+D    H   I
Sbjct: 117 LFVCSICTRAFARQEHLTRHERSHTKEKPYCCGI----CQ----RKFSRRDLLLRHAHKI 168

Query: 291 H 291
           H
Sbjct: 169 H 169

>KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 30/71 (42%), Gaps = 7/71 (9%)

Query: 228 HREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHL 287
           ++  F+C  C   F+    L  H   H   K Y CPY +    CH +  F+ K     H 
Sbjct: 204 NKRKFKCCVCGKGFRRPSSLATHSNIHTGFKPYVCPYEN----CHKS--FNAKSNMFRHY 257

Query: 288 KSIHFVYPVGV 298
           K +HF  P G 
Sbjct: 258 K-LHFKLPSGA 267

>Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii ABR089C
          Length = 767

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 15/76 (19%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKK-HLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS- 289
           F+C  C   F+   +L RH++  H  ++ + C Y    C      +FSR D    HLK+ 
Sbjct: 698 FKCQECTKAFRRSEHLKRHIRSVHSTDRPFPCTY----CD----KKFSRSDNLSQHLKTH 749

Query: 290 -----IHFVYPVGVVK 300
                I  V P+  +K
Sbjct: 750 RKHGDIKDVLPMPTMK 765

>KNAG0F03980 Chr6 complement(754914..756041) [1128 bp, 375 aa] {ON}
           Anc_7.543 YPR186C
          Length = 375

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%)

Query: 220 LSPELGAVHREI--FQCPHCPSNFKVKGYLTRHLKKHLPN--KDYHC 262
           L+     VH+ I  FQCP C   F  + +L RHL  H  +  K +HC
Sbjct: 56  LTEHQQTVHQGIKRFQCPQCERQFARQAHLDRHLLSHAADAQKPHHC 102

>ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR113W (AZF1)
          Length = 769

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 34/97 (35%), Gaps = 26/97 (26%)

Query: 191 CRTVGTSSTSYKVHKKKHMTRSIRQELIALSPELGAVHREIFQCPHCPSNFKVKGYLTRH 250
           C    T ST  +VH + H         I   P         FQC +C   F   G L  H
Sbjct: 492 CHKCFTQSTHLEVHVRSH---------IGYKP---------FQCEYCGKRFTQGGNLRTH 533

Query: 251 LKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHL 287
           ++ H   + Y C       KC     FSRK     H+
Sbjct: 534 VRLHTGERPYEC------DKCGK--RFSRKGNLAAHM 562

>Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON}
           (235260..238010) [2751 nt, 917 aa]
          Length = 916

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 10/60 (16%)

Query: 234 CPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDC-KCHTTGEFSRKDTFKTHLKSIHF 292
           CP C   F  + +L RH + H   K + C +    C +C     F+R+D    H   +HF
Sbjct: 43  CPTCSRGFVRREHLKRHQRAHTKEKPFVCVF----CGRC-----FARRDLIIRHQNKLHF 93

>KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON}
           Anc_8.425 YDR216W
          Length = 627

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 26/64 (40%), Gaps = 8/64 (12%)

Query: 228 HREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHL 287
           ++  F C  C   F  + +L RHL+ H   K + C     D        F+R+D    H 
Sbjct: 45  NKRTFLCFVCQKAFARQEHLDRHLRSHTNEKPFKCAVCDKD--------FTRRDLLIRHS 96

Query: 288 KSIH 291
             +H
Sbjct: 97  NKLH 100

>SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P27705 Saccharomyces
           cerevisiae YGL035C MIG1 Transcription factor involved in
           glucose repression; C2H2 zinc finger protein similar to
           mammalian Egr and Wilms tumor proteins
          Length = 548

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 29/71 (40%), Gaps = 7/71 (9%)

Query: 221 SPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRK 280
           SP  G      + CP C   F    + TRH++ H   K + C +  P C       FSR 
Sbjct: 23  SPNSGPDSPRPYVCPICSRAFHRLEHQTRHIRTHTGEKPHACEF--PGCGK----RFSRS 76

Query: 281 DTFKTHLKSIH 291
           D    H + IH
Sbjct: 77  DELTRHTR-IH 86

>Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa]
           {ON} YPR186C (PZF1) - Transcription factor IIIA (TFIIIA)
           with putative Zn-fingers [contig 8] FULL
          Length = 429

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 2/41 (4%)

Query: 226 AVHREI--FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPY 264
            VH+ I  FQC  C   F  K +L RH+  H  +K + C Y
Sbjct: 73  VVHQGIKPFQCTVCARQFSRKTHLERHMFSHSEDKPFKCSY 113

>TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1207

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 26/61 (42%), Gaps = 8/61 (13%)

Query: 231 IFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSI 290
           +F C  C   F  + +LTRH + H   K Y C        C+    FSR+D    H   +
Sbjct: 58  LFVCQICTRAFARQEHLTRHERSHTKEKPYSCGI------CNRN--FSRRDLLLRHAHKV 109

Query: 291 H 291
           H
Sbjct: 110 H 110

>Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar to
           Ashbya gossypii AGR031W
          Length = 257

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 10/64 (15%)

Query: 229 REIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT----FK 284
           R   +C  C   F   G+L RH + H   K++ C +  P C       FSR D     ++
Sbjct: 190 RRKHRCQTCDKGFTTSGHLARHNRIHTGEKNHRCHF--PGCG----QRFSRHDNCLQHYR 243

Query: 285 THLK 288
           THLK
Sbjct: 244 THLK 247

>Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {ON}
           YPR186C (REAL)
          Length = 427

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 220 LSPELGAVHREI--FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPY 264
           L+     VH+ +  F+C +C  +F  K +L RHL  H   K + C Y
Sbjct: 66  LTEHQSTVHQGLRAFRCDNCAKSFVKKSHLERHLFSHSDTKPFQCSY 112

>Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii ACL057W
          Length = 573

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 32/70 (45%), Gaps = 11/70 (15%)

Query: 221 SPELGAVHREIFQCPHCPSNFKVKGYLTRHLKK-HLPNKDYHCPYWSPDCKCHTTGEFSR 279
           SP L A   + F C  C   FK + +L RH++  H+  K Y C      C      +FSR
Sbjct: 505 SPALDAT--KPFGCEFCERRFKRQEHLKRHVRSLHMGEKPYGCDI----CG----KKFSR 554

Query: 280 KDTFKTHLKS 289
            D    H+K+
Sbjct: 555 SDNLNQHIKT 564

>Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa]
           {ON} YJR127C (REAL)
          Length = 1270

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 33/83 (39%), Gaps = 9/83 (10%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIH 291
           F CP C   F  + +L RH   H   K Y C +     +C     F+R+D    H + +H
Sbjct: 36  FLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCG---RC-----FARRDLVLRHQQKLH 87

Query: 292 FVYPVGVVKSQRSYSKGRCAACF 314
               VG   +Q        +A F
Sbjct: 88  AAL-VGTGDTQHMAPSPSPSASF 109

>TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 31/83 (37%)

Query: 225 GAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFK 284
           G + +  + C  C   FK    L  H+  H   K Y CP+ S     +      R     
Sbjct: 263 GCIDKIKYDCNICGKKFKRPSSLNTHMNIHTGQKPYRCPHISCSKAFNAKSNMLRHYKLH 322

Query: 285 THLKSIHFVYPVGVVKSQRSYSK 307
             L +  ++ P G + + +  +K
Sbjct: 323 FKLNTGQYILPNGEISATKPTTK 345

>Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON}
           YGR067C (REAL)
          Length = 810

 Score = 30.8 bits (68), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 35/87 (40%), Gaps = 19/87 (21%)

Query: 226 AVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKT 285
           A+ R+ + C  C   F    +  RH + H   K + C      CK      F R+D  + 
Sbjct: 2   AIGRKKYICSFCLKPFSRSEHKIRHERSHAGVKPFQCQI----CK----HSFVRRDLLQR 53

Query: 286 HLKSIHFVYPVGVVKSQRSYSKGRCAA 312
           H++++H           RS+    CA+
Sbjct: 54  HIRTVH-----------RSFLLSSCAS 69

>CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa]
           {ON} weakly similar to uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 541

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 9/59 (15%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKK-HLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS 289
           FQC  C   F+   +L RH++  H   + + C +    C+     +FSR D    HLK+
Sbjct: 484 FQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMF----CE----KKFSRSDNLSQHLKT 534

>TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.533
           YMR070W
          Length = 417

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 8/62 (12%)

Query: 230 EIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS 289
           + ++C  C   FK   +L RH   H   K++ C + S        G++ RKD    H++ 
Sbjct: 322 KFYECKVCHKTFKRNSWLKRHFFSHSKLKNFSCNWCS--------GKYKRKDNLVQHIRK 373

Query: 290 IH 291
            H
Sbjct: 374 KH 375

>Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON}
           complement(4290..6233) [1944 nt, 648 aa]
          Length = 647

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 9/59 (15%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKK-HLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS 289
           F+C  C   F+   +L RH++  H   + + C Y    C+     +FSR D    HLK+
Sbjct: 590 FKCTDCEKAFRRSEHLKRHIRSVHSSERPFACNY----CE----KKFSRSDNLSQHLKT 640

>SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 261

 Score = 30.0 bits (66), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 15/33 (45%)

Query: 231 IFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCP 263
           I Q P C   F VK  L RH+K H      H P
Sbjct: 228 ICQLPGCAKRFNVKSNLLRHVKSHYGRGGAHGP 260

>KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {ON}
           Anc_1.326 YJL056C
          Length = 746

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 41/101 (40%), Gaps = 25/101 (24%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIH 291
           ++CP C   F     L +HL+ H   K YHC              F+   + K H+++  
Sbjct: 641 YKCPQCQKCFSSDETLKQHLRIHSGEKPYHCDI--------CGKRFAISSSLKIHVRTHT 692

Query: 292 FVYPVGVVKSQRSYSKGRCAACFQEF--ESNVVWLNEHIET 330
              P+            +CA C + F   SN   LN+H++T
Sbjct: 693 GEKPL------------QCAVCGKRFIESSN---LNKHMKT 718

>KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081W
          Length = 1332

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 8/60 (13%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIH 291
           F CP C   F  + +L RH + H   K + C +     +C     F+R+D    H + +H
Sbjct: 83  FLCPICTRGFARQEHLRRHERSHTNEKPFLCAFCG---RC-----FARRDLVLRHQQKLH 134

>KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.144
           YER130C
          Length = 402

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 35/82 (42%), Gaps = 11/82 (13%)

Query: 210 TRSIRQELIALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKK-HLPNKDYHCPYWSPD 268
           T  +  ++    P L   + + + C +C   FK + +L RH++  HL  K Y        
Sbjct: 327 TNGLAPKIRGRKPTLIPDNTKHYSCEYCERRFKRQEHLKRHIRSLHLGAKPY-------- 378

Query: 269 CKCHTTG-EFSRKDTFKTHLKS 289
             CH    +FSR D    H K+
Sbjct: 379 -TCHICARKFSRSDNLNQHTKT 399

>KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON}
           Anc_3.281 YBR066C
          Length = 224

 Score = 30.0 bits (66), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 25/59 (42%), Gaps = 10/59 (16%)

Query: 234 CPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT----FKTHLK 288
           C  C   F   G+L+RH K H   K Y CP+            FSR D      KTHL+
Sbjct: 160 CKVCTMAFTTSGHLSRHNKIHTGEKKYVCPFEG------CGQRFSRHDNCVQHHKTHLR 212

>KNAG0J02850 Chr10 complement(545071..546573) [1503 bp, 500 aa] {ON}
           Anc_4.21 YHL027W
          Length = 500

 Score = 30.4 bits (67), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 10/54 (18%)

Query: 202 KVHKKKHMTRSIRQELIALSPELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHL 255
           K  K+ H+T  +R   I L P         FQC +C   FK    L +HLK HL
Sbjct: 122 KTVKRDHITSHVRVH-IPLKP---------FQCSNCAKKFKRPQDLKKHLKTHL 165

>SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa]
           {ON} similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1129

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 25/61 (40%), Gaps = 8/61 (13%)

Query: 231 IFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSI 290
           +F C  C   F  + +LTRH + H   K Y C        C     FSR+D    H   +
Sbjct: 58  LFVCKICTRAFARQEHLTRHERSHTKEKPYFCGI------CDR--RFSRRDLLLRHAHKL 109

Query: 291 H 291
           H
Sbjct: 110 H 110

>CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa]
           {ON} similar to uniprot|P53035 Saccharomyces cerevisiae
           YGL209w MIG2 C2H2 zinc-finger protein
          Length = 396

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 6/55 (10%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTH 286
           F+C HC   F    +  RH++ H   K + C +  P C       FSR D  K H
Sbjct: 17  FKCEHCSRGFHRLEHKKRHMRTHTGEKPHGCSF--PGCG----KSFSRSDELKRH 65

>Smik_10.420 Chr10
           complement(647997..651776,651798..651836,651840..652019,
           652023..652070) [4047 bp, 1348 aa] {ON} YJR127C (REAL)
          Length = 1348

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 9/72 (12%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIH 291
           F CP C   F  + +L RH   H   K Y C +     +C     F+R+D    H + +H
Sbjct: 125 FLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCG---RC-----FARRDLVLRHQQKLH 176

Query: 292 FVYPVGVVKSQR 303
               VG   +Q+
Sbjct: 177 AAL-VGTGDTQQ 187

>TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {ON}
           Anc_2.598 YMR037C
          Length = 519

 Score = 30.4 bits (67), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 9/61 (14%)

Query: 230 EIFQCPHCPSNFKVKGYLTRHLKK-HLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLK 288
           + F+C +C   F+   +L RH++  H   + + C Y    C+     +FSR D    HLK
Sbjct: 460 KTFKCNNCEKAFRRSEHLKRHIRSVHSSERPFPCNY----CE----KKFSRSDNLSQHLK 511

Query: 289 S 289
           +
Sbjct: 512 T 512

>NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144
          Length = 436

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 9/69 (13%)

Query: 222 PELGAVHREIFQCPHCPSNFKVKGYLTRHLKK-HLPNKDYHCPYWSPDCKCHTTGEFSRK 280
           P L     + F C +C   FK + +L RH++  H+  K Y C      C+      FSR 
Sbjct: 374 PSLIPDASKQFGCEYCERRFKRQEHLKRHVRSLHIGVKPYTCHI----CQ----KNFSRS 425

Query: 281 DTFKTHLKS 289
           D    H+K+
Sbjct: 426 DNLSQHIKT 434

>NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {ON}
           Anc_8.326
          Length = 635

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 13/66 (19%)

Query: 213 IRQELIALSPELGAVHREI-------FQC--PHCPSNFKVKGYLTRHLKKHLPNKDYHCP 263
           I ++L  L P  G++ R +       F+C  P+C  +FK +     H++ HL ++ Y C 
Sbjct: 465 ITRKLTTLPP--GSIDRYVKELPDKTFECLYPNCGKHFKRRYNTRSHIQTHLEDRPYACD 522

Query: 264 YWSPDC 269
           +  P+C
Sbjct: 523 F--PNC 526

>SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 819

 Score = 30.4 bits (67), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 8/56 (14%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHL 287
           FQC +C   F   G L  H + H   K Y C       KC     FSRK     H+
Sbjct: 568 FQCEYCGKRFTQGGNLRTHTRLHTGEKPYSCE------KCGK--RFSRKGNLAAHM 615

>Skud_10.351 Chr10
           complement(617553..621332,621389..621469,621466..621510,
           621543..621620) [3984 bp, 1327 aa] {ON} YJR127C (REAL)
          Length = 1327

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 32/83 (38%), Gaps = 9/83 (10%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIH 291
           F CP C   F  + +L RH   H   K Y C +     +C     F+R+D    H + +H
Sbjct: 104 FLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCG---RC-----FARRDLVLRHQQKLH 155

Query: 292 FVYPVGVVKSQRSYSKGRCAACF 314
               VG   +Q         A F
Sbjct: 156 AAL-VGTGDAQHMTPSPNTNASF 177

>TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa]
           {ON} Anc_4.80 YGL035C
          Length = 390

 Score = 30.0 bits (66), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 7/58 (12%)

Query: 234 CPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIH 291
           CP C   F    + TRH++ H   K + C +  P C    T +FSR D    H K IH
Sbjct: 74  CPVCNRAFHRLEHQTRHIRTHTGEKPHSCDF--PGC----TKKFSRSDELTRH-KRIH 124

>NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa]
           {ON} Anc_3.518
          Length = 426

 Score = 30.0 bits (66), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 6/58 (10%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKS 289
           F+C  C   F    +  RH++ H   K + C +  P CK      FSR+D  K H+++
Sbjct: 21  FRCQFCSRGFHRLEHKKRHVRTHTGEKPHVCNF--PHCK----KGFSRRDELKRHIRT 72

>TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {ON}
           Anc_2.598 YMR037C
          Length = 746

 Score = 30.0 bits (66), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 10/69 (14%)

Query: 222 PELGAVHREIFQCPHCPSNFKVKGYLTRHLKK-HLPNKDYHCPYWSPDCKCHTTGEFSRK 280
           P + A+++  F+C  C  NF+   +L RH++  H   + + C      C      +FSR 
Sbjct: 680 PNVSAINKP-FKCDTCGKNFRRSEHLKRHIRSVHSMERPFSCDI----C----LKKFSRS 730

Query: 281 DTFKTHLKS 289
           D    HLK+
Sbjct: 731 DNLSQHLKT 739

>KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weakly
           similar to uniprot|P21192 Saccharomyces cerevisiae
           YLR131C ACE2 Transcription factor that activates
           expression of early G1-specific genes localizes to
           daughter cell nuclei after cytokinesis and delays G1
           progression in daughters localization is regulated by
           phosphorylation potential Cdc28p substrate
          Length = 746

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 4/42 (9%)

Query: 230 EIFQC--PHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDC 269
           + F+C  P C  NF+ +  +  H++ HL ++ Y C +  PDC
Sbjct: 581 KTFECLHPDCGKNFRRRYNIRSHIQTHLEDRPYICDF--PDC 620

>KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON}
           Anc_8.486 YDR253C
          Length = 185

 Score = 29.3 bits (64), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 24/59 (40%), Gaps = 8/59 (13%)

Query: 232 FQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSI 290
           ++C  C   F     L RH + HLP      P   P C       F+RKD  K H  ++
Sbjct: 101 YKCLKCDLKFSRSSDLRRHERAHLP----ILPNICPQC----GKGFARKDALKRHFDTL 151

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,282,083
Number of extensions: 1299572
Number of successful extensions: 3954
Number of sequences better than 10.0: 414
Number of HSP's gapped: 3887
Number of HSP's successfully gapped: 449
Length of query: 344
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 234
Effective length of database: 40,868,139
Effective search space: 9563144526
Effective search space used: 9563144526
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)