Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0B05412g8.773ON45143623350.0
YMR238W (DFG5)8.773ON45843618270.0
NCAS0C008108.773ON45143618170.0
Suva_13.4228.773ON45843417980.0
Skud_13.4078.773ON45843517840.0
NDAI0K008408.773ON45943717690.0
Kpol_1030.208.773ON45143617470.0
Smik_13.4468.773ON45843517470.0
CAGL0M05049g8.773ON45343417350.0
KLTH0E04048g8.773ON45443917320.0
Kwal_55.202668.773ON45743917300.0
TDEL0B033608.773ON43643517020.0
TBLA0B033208.773ON45043417000.0
KLLA0F24926g8.773ON45143616950.0
KAFR0B034908.773ON45143816780.0
KNAG0J007008.773ON46342716460.0
TPHA0J016008.773ON46144616300.0
AFR530W8.773ON45943615960.0
Ecym_14748.773ON45443315860.0
ZYRO0F12210g8.773ON45343815590.0
ACL200WsingletonON46343414430.0
ACL201WsingletonON44843414280.0
NCAS0A08740singletonON43439913840.0
TBLA0C03850singletonON56741013550.0
NCAS0A08730singletonON63137613530.0
ACL202WsingletonON45040913051e-178
KLLA0E07723g2.570ON45043412801e-174
KLTH0D08008g2.570ON44843512771e-174
NDAI0C006802.570ON45243412741e-173
SAKL0D13574g2.570ON45143412601e-171
Kwal_26.82252.570ON44943412491e-169
KAFR0I017402.570ON44843612411e-168
KAFR0A021702.570ON44943512341e-167
NDAI0B015102.570ON44743612341e-167
YKL046C (DCW1)2.570ON44943612321e-167
Suva_11.1802.570ON45043612251e-166
Smik_11.2022.570ON44943612211e-165
NCAS0A127502.570ON44743512201e-165
TPHA0I024702.570ON45243312201e-165
NCAS0H029002.570ON45343612121e-164
Skud_11.1832.570ON44943512101e-163
TBLA0H02590singletonON45043711801e-159
TBLA0H02580singletonON44943511651e-157
Kpol_1056.42.570ON45041311631e-156
CAGL0L01727g2.570ON44643611461e-154
ABR060W2.570ON45143711401e-153
Ecym_45772.570ON45043611351e-152
KNAG0A071802.570ON46339311341e-152
TDEL0B065802.570ON44743611281e-151
TBLA0H026002.570ON44943611131e-149
ZYRO0E06380g2.570ON45343610851e-145
Smik_9.1607.198ON131861696.8
KLLA0C09262g7.275ON55835697.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0B05412g
         (451 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0B05412g Chr2 (466158..467513) [1356 bp, 451 aa] {ON} highly...   904   0.0  
YMR238W Chr13 (746353..747729) [1377 bp, 458 aa] {ON}  DFG5Putat...   708   0.0  
NCAS0C00810 Chr3 complement(144534..145889) [1356 bp, 451 aa] {O...   704   0.0  
Suva_13.422 Chr13 (727776..729152) [1377 bp, 458 aa] {ON} YMR238...   697   0.0  
Skud_13.407 Chr13 (720539..721915) [1377 bp, 458 aa] {ON} YMR238...   691   0.0  
NDAI0K00840 Chr11 complement(190148..191527) [1380 bp, 459 aa] {...   686   0.0  
Kpol_1030.20 s1030 complement(37060..38049,38052..38417) [1356 b...   677   0.0  
Smik_13.446 Chr13 (730295..731671) [1377 bp, 458 aa] {ON} YMR238...   677   0.0  
CAGL0M05049g Chr13 (547489..548850) [1362 bp, 453 aa] {ON} simil...   672   0.0  
KLTH0E04048g Chr5 complement(369100..370464) [1365 bp, 454 aa] {...   671   0.0  
Kwal_55.20266 s55 complement(327537..328910) [1374 bp, 457 aa] {...   671   0.0  
TDEL0B03360 Chr2 complement(601081..602391) [1311 bp, 436 aa] {O...   660   0.0  
TBLA0B03320 Chr2 complement(774913..776265) [1353 bp, 450 aa] {O...   659   0.0  
KLLA0F24926g Chr6 complement(2321928..2323283) [1356 bp, 451 aa]...   657   0.0  
KAFR0B03490 Chr2 (723671..725026) [1356 bp, 451 aa] {ON} Anc_8.7...   650   0.0  
KNAG0J00700 Chr10 complement(121298..122689) [1392 bp, 463 aa] {...   638   0.0  
TPHA0J01600 Chr10 complement(371534..372919) [1386 bp, 461 aa] {...   632   0.0  
AFR530W Chr6 (1388049..1389428) [1380 bp, 459 aa] {ON} Syntenic ...   619   0.0  
Ecym_1474 Chr1 (976393..977757) [1365 bp, 454 aa] {ON} similar t...   615   0.0  
ZYRO0F12210g Chr6 (992529..993890) [1362 bp, 453 aa] {ON} simila...   605   0.0  
ACL200W Chr3 (12145..13536) [1392 bp, 463 aa] {ON} Non-syntenic ...   560   0.0  
ACL201W Chr3 (10277..11623) [1347 bp, 448 aa] {ON} Non-syntenic ...   554   0.0  
NCAS0A08740 Chr1 (1727048..1728352) [1305 bp, 434 aa] {ON}            537   0.0  
TBLA0C03850 Chr3 (921692..923395) [1704 bp, 567 aa] {ON}              526   0.0  
NCAS0A08730 Chr1 (1724401..1726296) [1896 bp, 631 aa] {ON}            525   0.0  
ACL202W Chr3 (8390..9742) [1353 bp, 450 aa] {ON} Non-syntenic ho...   507   e-178
KLLA0E07723g Chr5 complement(691980..693332) [1353 bp, 450 aa] {...   497   e-174
KLTH0D08008g Chr4 (680735..682081) [1347 bp, 448 aa] {ON} highly...   496   e-174
NDAI0C00680 Chr3 complement(132980..134338) [1359 bp, 452 aa] {O...   495   e-173
SAKL0D13574g Chr4 (1125011..1126366) [1356 bp, 451 aa] {ON} high...   489   e-171
Kwal_26.8225 s26 (696173..697522) [1350 bp, 449 aa] {ON} YKL046C...   485   e-169
KAFR0I01740 Chr9 complement(352631..353977) [1347 bp, 448 aa] {O...   482   e-168
KAFR0A02170 Chr1 (454336..455685) [1350 bp, 449 aa] {ON} Anc_2.5...   479   e-167
NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {O...   479   e-167
YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON} ...   479   e-167
Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {...   476   e-166
Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {...   474   e-165
NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON} Anc_2...   474   e-165
TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.5...   474   e-165
NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570    471   e-164
Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {...   470   e-163
TBLA0H02590 Chr8 complement(612543..613895) [1353 bp, 450 aa] {O...   459   e-159
TBLA0H02580 Chr8 complement(610287..611636) [1350 bp, 449 aa] {O...   453   e-157
Kpol_1056.4 s1056 complement(6537..7889) [1353 bp, 450 aa] {ON} ...   452   e-156
CAGL0L01727g Chr12 complement(184249..185589) [1341 bp, 446 aa] ...   446   e-154
ABR060W Chr2 (504045..505400) [1356 bp, 451 aa] {ON} Syntenic ho...   443   e-153
Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {O...   441   e-152
KNAG0A07180 Chr1 (1127961..1129352) [1392 bp, 463 aa] {ON}            441   e-152
TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON} Anc_2...   439   e-151
TBLA0H02600 Chr8 complement(614887..616236) [1350 bp, 449 aa] {O...   433   e-149
ZYRO0E06380g Chr5 (484736..486097) [1362 bp, 453 aa] {ON} simila...   422   e-145
Smik_9.160 Chr9 complement(270288..274244) [3957 bp, 1318 aa] {O...    31   6.8  
KLLA0C09262g Chr3 (805512..807188) [1677 bp, 558 aa] {ON} highly...    31   7.2  

>SAKL0B05412g Chr2 (466158..467513) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 451

 Score =  904 bits (2335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/436 (100%), Positives = 436/436 (100%)

Query: 16  VHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDN 75
           VHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDN
Sbjct: 16  VHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDN 75

Query: 76  IYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPT 135
           IYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPT
Sbjct: 76  IYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPT 135

Query: 136 KEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARL 195
           KEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARL
Sbjct: 136 KEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARL 195

Query: 196 GRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVL 255
           GRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVL
Sbjct: 196 GRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVL 255

Query: 256 GGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFS 315
           GGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFS
Sbjct: 256 GGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFS 315

Query: 316 RMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQM 375
           RMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQM
Sbjct: 316 RMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQM 375

Query: 376 SALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIIT 435
           SALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIIT
Sbjct: 376 SALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIIT 435

Query: 436 AIVLGVMIGGSVWMVF 451
           AIVLGVMIGGSVWMVF
Sbjct: 436 AIVLGVMIGGSVWMVF 451

>YMR238W Chr13 (746353..747729) [1377 bp, 458 aa] {ON}  DFG5Putative
           mannosidase, essential glycosylphosphatidylinositol
           (GPI)-anchored membrane protein required for cell wall
           biogenesis in bud formation, involved in filamentous
           growth, homologous to Dcw1p
          Length = 458

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/436 (75%), Positives = 382/436 (87%), Gaps = 1/436 (0%)

Query: 16  VHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDN 75
            HA+DLDT+SK SIC AT+LIQ GMLDYYEGT+YGGTVGMFQ PYYWW AGEAFGGML+N
Sbjct: 24  THAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMLEN 83

Query: 76  IYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPT 135
            +LC+N+TY++L+YDA++AQTG NYDYIP+NQ+MVEGNDDQG+WGIT+MGAVERNFT+P 
Sbjct: 84  WFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWGITVMGAVERNFTDP- 142

Query: 136 KEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARL 195
            +G PGWLAMVQAVFNTMY+RWDS+HCGGGLRWQIFTWNSGYNYKNT++N CLFQIAARL
Sbjct: 143 GDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARL 202

Query: 196 GRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVL 255
           GRYTGN TYLEVA +V+DWL DVG+VVL D ANVFDGA I+ NC+ I KIEWTYNHG+VL
Sbjct: 203 GRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVL 262

Query: 256 GGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFS 315
           GG AYMYNATNG+  W+T LT++L+GA  +FF +SIMYE ACQ  GTCN DQR+FKSIFS
Sbjct: 263 GGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDYGTCNTDQRTFKSIFS 322

Query: 316 RMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQM 375
           RMLGLTSV+APFTRDTID LIK SAE AA+SC GGTDGHTCGL+W    +DGYYGLGEQM
Sbjct: 323 RMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNWQKQTNDGYYGLGEQM 382

Query: 376 SALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIIT 435
           SALE++QNLLI D P P+  DNGG+S GD NAG+NSS+ NVL+NNL+I   DR GAAIIT
Sbjct: 383 SALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNNLNIKKGDRAGAAIIT 442

Query: 436 AIVLGVMIGGSVWMVF 451
           A++L V+ GG+VWM+F
Sbjct: 443 AVILSVLTGGAVWMLF 458

>NCAS0C00810 Chr3 complement(144534..145889) [1356 bp, 451 aa] {ON}
           Anc_8.773
          Length = 451

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/436 (74%), Positives = 373/436 (85%)

Query: 16  VHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDN 75
           V +IDLD +SKDSIC AT+LIQKGMLDYYEG +YGG VGMFQPPYYWW  G AFGGML+N
Sbjct: 16  VQSIDLDVTSKDSICAATALIQKGMLDYYEGERYGGAVGMFQPPYYWWNGGVAFGGMLEN 75

Query: 76  IYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPT 135
           +YLC+N T++ L+ DA++AQTG+NYDYIP+NQSMVEGNDDQGVWG+TIM AVERNFT P 
Sbjct: 76  MYLCENNTFESLLMDALVAQTGDNYDYIPSNQSMVEGNDDQGVWGLTIMDAVERNFTAPN 135

Query: 136 KEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARL 195
           K GVPGWLAM QAVFNTMYARWD  HCGGGLRWQIFTWNSGYNYKNTIAN CLFQ+AARL
Sbjct: 136 KSGVPGWLAMAQAVFNTMYARWDPDHCGGGLRWQIFTWNSGYNYKNTIANACLFQMAARL 195

Query: 196 GRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVL 255
           GRYTGN TYL+VA KV+DW+ D+ ++VL DKANVFDGA+I+ NC+ I  +EWTYNHGVVL
Sbjct: 196 GRYTGNQTYLDVAEKVFDWMVDINYIVLNDKANVFDGADIDENCTDITTLEWTYNHGVVL 255

Query: 256 GGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFS 315
           GG AYMYNATNGS  W+TR+ ++L GA E+FF +++M E ACQ   TCNNDQR FKSIFS
Sbjct: 256 GGCAYMYNATNGSSTWETRVNKILAGAQEYFFQDNVMLESACQSYNTCNNDQRCFKSIFS 315

Query: 316 RMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQM 375
           RMLG TSVLAPFT +TIDPLIKASAE AA SCTGG DGHTCGLDWT G +DGYYGLGEQM
Sbjct: 316 RMLGFTSVLAPFTAETIDPLIKASAEAAATSCTGGKDGHTCGLDWTKGSNDGYYGLGEQM 375

Query: 376 SALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIIT 435
           +ALEIM NLLI D P P TA+ GG+S GD +AGLNS++ NVLEN L IT  DR GAAI+T
Sbjct: 376 NALEIMSNLLIHDRPAPLTANTGGTSEGDASAGLNSTTTNVLENKLKITQGDRAGAAIVT 435

Query: 436 AIVLGVMIGGSVWMVF 451
           A++LG+ +GG+VWM+F
Sbjct: 436 AVILGIFVGGAVWMLF 451

>Suva_13.422 Chr13 (727776..729152) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/434 (75%), Positives = 376/434 (86%), Gaps = 1/434 (0%)

Query: 18  AIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNIY 77
           A+DLDT+S  SIC AT+LIQ GMLDYYEGT+YGGTVGMFQ PYYWW AGEAFGGM++N Y
Sbjct: 26  AMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQSPYYWWHAGEAFGGMVENWY 85

Query: 78  LCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTKE 137
           LC N+TY+ L+YDA++AQTG +YDYIPANQ+MVEGNDDQG+WGIT+MGAVERNFTNP   
Sbjct: 86  LCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTNP-DN 144

Query: 138 GVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLGR 197
           G PGWLAMVQAVFNTMY+RWDS++CGGGLRWQIFTWNSGYNYKNTI+N CLFQIAARLGR
Sbjct: 145 GAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGR 204

Query: 198 YTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVLGG 257
           YTGN TYL+VA +V+DWL DVG+VVL D ANV+DGA I+ NC+ I KIEWTYNHG+VLGG
Sbjct: 205 YTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTNCTDITKIEWTYNHGIVLGG 264

Query: 258 AAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFSRM 317
            AYMYNATNG+  W+T L QVL+GA  +FF + IMYE ACQ  GTCN DQR+FKSIFSRM
Sbjct: 265 MAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQDYGTCNTDQRTFKSIFSRM 324

Query: 318 LGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMSA 377
           LGLTSV+APFT DTID LIK SAE AA+SC GGTDGHTCGLDW    +DGYYGLGEQMSA
Sbjct: 325 LGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGLDWEKETNDGYYGLGEQMSA 384

Query: 378 LEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIITAI 437
           LE++QNLLI D P P+  DNGG+S GD NAG+NSS+ +VL+NNL+IT  DR GAAIITA+
Sbjct: 385 LEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQNNLNITKGDRAGAAIITAV 444

Query: 438 VLGVMIGGSVWMVF 451
           +L V+IGG+VWM+F
Sbjct: 445 ILSVLIGGAVWMLF 458

>Skud_13.407 Chr13 (720539..721915) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/435 (75%), Positives = 380/435 (87%), Gaps = 1/435 (0%)

Query: 17  HAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNI 76
           HA+DLDT+SK SIC AT+LIQ GMLDYY+GT+YGG VGMFQ PYYWW AGEAFGGML+N 
Sbjct: 25  HAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQSPYYWWHAGEAFGGMLENW 84

Query: 77  YLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTK 136
           +LC+NETY++L+YDA++AQTG NYDYIPANQ+MVEGNDDQG+WGIT+MGAVERNFT+P  
Sbjct: 85  FLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDP-D 143

Query: 137 EGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLG 196
           EG PGWLAMVQAVFNTMY+RWDS+HCGGGLRWQIFTWNSGYNYKNT++N CLFQIAARLG
Sbjct: 144 EGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTVSNACLFQIAARLG 203

Query: 197 RYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVLG 256
           RYTGN TYL+VA +V+DWL DVG+VVL D ANVFDGA I+ NC+ I KIEWTYNHG+VLG
Sbjct: 204 RYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVLG 263

Query: 257 GAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFSR 316
           G AYMYNATNG+  W+TRLTQ+L+GA  +FF ++IMYE ACQ   TCN DQR+FKSIFSR
Sbjct: 264 GLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQDYSTCNTDQRTFKSIFSR 323

Query: 317 MLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMS 376
           MLGLTSV+APFT DTID LIK SAE AA+SC GGTDGHTCGLDW    HDGYYGLGEQMS
Sbjct: 324 MLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGLDWGKQTHDGYYGLGEQMS 383

Query: 377 ALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIITA 436
           ALE++QNLLI D P P+   NGG+S GD NAG+NSS+ NVL+NNL+IT   R GAAIITA
Sbjct: 384 ALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNITKGGRAGAAIITA 443

Query: 437 IVLGVMIGGSVWMVF 451
           I+L V+IGG+VWM+F
Sbjct: 444 IILSVLIGGAVWMLF 458

>NDAI0K00840 Chr11 complement(190148..191527) [1380 bp, 459 aa] {ON}
           Anc_8.773
          Length = 459

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/437 (74%), Positives = 375/437 (85%), Gaps = 2/437 (0%)

Query: 16  VHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDN 75
             AIDLD +SK+SIC ATSLIQ GM+DYY GT+YGGTVGMFQPPYYWW+AGEAFGGM++N
Sbjct: 24  TQAIDLDITSKESICDATSLIQGGMMDYYWGTQYGGTVGMFQPPYYWWEAGEAFGGMIEN 83

Query: 76  IYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPT 135
            YLC N+TY+D++  A++AQTG NYDYIPANQSMVEGNDDQGVWG+T+MGA ERNFT+P 
Sbjct: 84  WYLCQNDTYEDMLKSALLAQTGSNYDYIPANQSMVEGNDDQGVWGLTLMGAAERNFTDP- 142

Query: 136 KEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARL 195
            +G PGWLAM QAVFNTM ARWDS HCGGGLRWQIFTWNSGYNYKNTI+N CLFQ+AARL
Sbjct: 143 DDGTPGWLAMTQAVFNTMNARWDSAHCGGGLRWQIFTWNSGYNYKNTISNACLFQLAARL 202

Query: 196 GRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVL 255
           GRYTGN TYLEVA KV+ WL DVG+V+L D ANVFDGA I++NC+ + +IEWTYNHGVVL
Sbjct: 203 GRYTGNTTYLEVAEKVFTWLVDVGYVLLDDTANVFDGAEIDSNCTDMTQIEWTYNHGVVL 262

Query: 256 GGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFN-NSIMYERACQGSGTCNNDQRSFKSIF 314
           GGAAYMYNATNGS  W++R+T++L GA  +FF+ N IM+E ACQ   TCNNDQRSFKSIF
Sbjct: 263 GGAAYMYNATNGSSDWESRVTKLLKGATTYFFDSNGIMFENACQEYNTCNNDQRSFKSIF 322

Query: 315 SRMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQ 374
           SRMLGLTSVLAPFT DT+DPLIK SA  AA+SCTGGTDGHTCGL+W  G HDGYYGLGEQ
Sbjct: 323 SRMLGLTSVLAPFTSDTVDPLIKTSAAAAAKSCTGGTDGHTCGLNWAKGSHDGYYGLGEQ 382

Query: 375 MSALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAII 434
           M ALE+MQNLLI D P P T + GGSS GD  AGLNS++ NVLEN ++IT+ DR GAAI+
Sbjct: 383 MCALEVMQNLLIHDRPAPLTGNTGGSSKGDALAGLNSTTTNVLENKMTITNGDRAGAAIV 442

Query: 435 TAIVLGVMIGGSVWMVF 451
           TAI+LGV+ GG+VWM F
Sbjct: 443 TAIILGVLTGGAVWMFF 459

>Kpol_1030.20 s1030 complement(37060..38049,38052..38417) [1356 bp,
           451 aa] {ON} complement(37060..38049,38052..38417) [1356
           nt, 452 aa]
          Length = 451

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/436 (73%), Positives = 375/436 (86%), Gaps = 2/436 (0%)

Query: 16  VHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDN 75
           V AIDLD +SKDSIC ATSLIQ GMLDYYEGT+YGGTVGMFQPPYYWW+AGEAFGGM++N
Sbjct: 18  VTAIDLDVNSKDSICAATSLIQGGMLDYYEGTRYGGTVGMFQPPYYWWEAGEAFGGMIEN 77

Query: 76  IYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPT 135
            +LC N+TY D+IYDA++AQTG NYDY+PANQ+ VE    + V+G T+M A ERNFT P+
Sbjct: 78  WFLCQNDTYHDIIYDALLAQTGSNYDYVPANQTFVEVMMIK-VFGGTVMDAAERNFTAPS 136

Query: 136 KEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARL 195
            +G P WLAM QAVFNTMYARWDS +CGGGLRWQI+TWNSGYNYKNT++N CLFQIAARL
Sbjct: 137 -DGKPDWLAMAQAVFNTMYARWDSANCGGGLRWQIYTWNSGYNYKNTVSNACLFQIAARL 195

Query: 196 GRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVL 255
           GRYTGNDTYLEVA KV+DWL DV FVVL D+ANVFDGANI +NCS++VK+EW+YNHG+VL
Sbjct: 196 GRYTGNDTYLEVAEKVFDWLVDVNFVVLNDEANVFDGANITSNCSAVVKLEWSYNHGIVL 255

Query: 256 GGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFS 315
           GG AYMYNATNG+  W++ LT+VL+GA   FF N+IMYE+ACQ   TCN DQRSFKSIFS
Sbjct: 256 GGLAYMYNATNGTSKWESGLTKVLNGAKSIFFKNNIMYEQACQDHNTCNTDQRSFKSIFS 315

Query: 316 RMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQM 375
           RMLGLTSVLAP+T DTI PLI+ASAEGAA+SC GGTDGHTCGL+W LG +DG YGLGEQM
Sbjct: 316 RMLGLTSVLAPYTSDTITPLIQASAEGAAKSCDGGTDGHTCGLNWNLGTNDGKYGLGEQM 375

Query: 376 SALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIIT 435
            ALEIM NLLI + P P+T  NGG+SVGDP+AGLN++S +VL NNL I  KDR GAAI+T
Sbjct: 376 CALEIMSNLLILNRPAPYTMHNGGTSVGDPSAGLNATSTSVLSNNLDIKQKDRAGAAIVT 435

Query: 436 AIVLGVMIGGSVWMVF 451
           A++L V++GGSVWM+F
Sbjct: 436 AVILFVLLGGSVWMLF 451

>Smik_13.446 Chr13 (730295..731671) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/435 (74%), Positives = 380/435 (87%), Gaps = 1/435 (0%)

Query: 17  HAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNI 76
           HA++LD++SK SIC AT+LIQ GMLDYYEGT+YGG VGMFQ PYYWW AGEAFGGML+N 
Sbjct: 25  HAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWHAGEAFGGMLENW 84

Query: 77  YLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTK 136
           +LC+N+TY++L+YDA++AQTG NYDYIPANQ+MVEGNDDQG+WGIT+MGAVERNFT+P+ 
Sbjct: 85  FLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDPS- 143

Query: 137 EGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLG 196
           +G PGWLAMVQAVFNTMY+RWDS+HCGGGLRWQIFTWNSGYNYKNTI+N CLFQIAARLG
Sbjct: 144 DGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLG 203

Query: 197 RYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVLG 256
           RYTGN TYL+VA +V+DWL DVG+VVL D ANVFDGA I+ NC+ I KIEWTYNHG+VLG
Sbjct: 204 RYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVLG 263

Query: 257 GAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFSR 316
           G AYMYNATNG+  W+T LT++L+GA  +FF +SIMYE ACQ   TCN DQR+FKSIFSR
Sbjct: 264 GLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYSTCNTDQRTFKSIFSR 323

Query: 317 MLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMS 376
           MLGLTSV+AP+T DTID LIK SAE AA+SC GG DGHTCGL+W    +DGYYGLGEQM+
Sbjct: 324 MLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQTNDGYYGLGEQMN 383

Query: 377 ALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIITA 436
           ALE++QNLLI D P P+   NGG+S GD NAG+NSS+ NVL+NNL+I + DR GAAIITA
Sbjct: 384 ALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNIKNGDRAGAAIITA 443

Query: 437 IVLGVMIGGSVWMVF 451
           I+L V+IGG+VWM+F
Sbjct: 444 IILSVLIGGAVWMLF 458

>CAGL0M05049g Chr13 (547489..548850) [1362 bp, 453 aa] {ON} similar
           to uniprot|P36091 Saccharomyces cerevisiae YKL046c or
           uniprot|Q05031 Saccharomyces cerevisiae YMR238w DFG5
          Length = 453

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/434 (73%), Positives = 366/434 (84%), Gaps = 2/434 (0%)

Query: 18  AIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNIY 77
           AI+L   +KDSIC AT+LIQ GMLDYYEGT+YGGTVGMFQPPYYWWQAG AFGGML+N +
Sbjct: 22  AINLQ-DNKDSICAATALIQGGMLDYYEGTRYGGTVGMFQPPYYWWQAGVAFGGMLENWF 80

Query: 78  LCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTKE 137
           LC N+TYKDL+ +A++AQTG NYDYIPANQ+ VEGNDDQGVWG+TI+ AVERNF+ P  +
Sbjct: 81  LCQNDTYKDLLMNALVAQTGPNYDYIPANQTTVEGNDDQGVWGLTILDAVERNFSAPI-D 139

Query: 138 GVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLGR 197
           G PGWLAM Q +FNTMYARWD Q C GGLRWQIFTWNSGYNYKNTI+N CLFQIAARLGR
Sbjct: 140 GKPGWLAMSQGIFNTMYARWDMQSCNGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGR 199

Query: 198 YTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVLGG 257
           YTGN TYL+VA +V+DWL  VG++VL +K NV+DGA +E+NC+ I  IEWTYNHGVVLGG
Sbjct: 200 YTGNTTYLDVAERVFDWLVGVGYIVLSEKGNVYDGAKVEDNCTDITAIEWTYNHGVVLGG 259

Query: 258 AAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFSRM 317
            AYMYNATNGS +WQ+RLT VL GA  +FF + IMYE ACQ   TCNNDQR FKSIFSRM
Sbjct: 260 LAYMYNATNGSSVWQSRLTSVLGGATAYFFQDDIMYESACQPYKTCNNDQRCFKSIFSRM 319

Query: 318 LGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMSA 377
           LG TSVLAPFT DTIDPL+KASA  AA SC GGTDGHTCGLDW L  +DGYYGLGEQMSA
Sbjct: 320 LGFTSVLAPFTSDTIDPLLKASAMAAAGSCDGGTDGHTCGLDWQLKTNDGYYGLGEQMSA 379

Query: 378 LEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIITAI 437
           LE++Q LLI + P P+ ADNGG+SVGD  AGLNS++ NVL+NNL IT  DR GAAI+T I
Sbjct: 380 LEVIQQLLIHERPAPYRADNGGTSVGDAAAGLNSTTTNVLKNNLKITGGDRAGAAIVTTI 439

Query: 438 VLGVMIGGSVWMVF 451
           VLG++IGG+ WM+F
Sbjct: 440 VLGIIIGGAAWMMF 453

>KLTH0E04048g Chr5 complement(369100..370464) [1365 bp, 454 aa] {ON}
           similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 454

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/439 (69%), Positives = 372/439 (84%), Gaps = 3/439 (0%)

Query: 16  VHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDN 75
           +  IDLDTS   SIC ATSLIQ G++DYY GT+ GGTVGMFQ PYYWW+AGE FGGML+N
Sbjct: 16  ILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLEN 75

Query: 76  IYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPT 135
            +LC N+TY D+IYDAMI Q G +YD++P+NQSMVEGNDDQGVWG+T+M A ERNFTNPT
Sbjct: 76  WFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPT 135

Query: 136 KEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARL 195
           ++GVPGWLAM Q VFNTM+ RWDS+HCGGG+RWQIFTWNSGYNYKNT++N C+FQ+AARL
Sbjct: 136 EDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARL 195

Query: 196 GRYTGNDTYLEVASKVWDWLEDVGFVVLQD--KANVFDGANIENNCSSIVKIEWTYNHGV 253
           GRYTGNDTYL  A  VWDWL DVGFVVL +   ANV+DGANI++NC+ IVK EW+YN G+
Sbjct: 196 GRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWSYNQGI 255

Query: 254 VLGGAAYMYNAT-NGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKS 312
           VLGGAAYMYNAT N + +W++RL Q++ G+ EFFF + +MYE  CQ S TCN DQRSFKS
Sbjct: 256 VLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQRSFKS 315

Query: 313 IFSRMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLG 372
           IFSRML LT  LAP+T +TIDPL++ASAEGAA+SCTGGTDGHTCGL+W LG+HDGYYGLG
Sbjct: 316 IFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLG 375

Query: 373 EQMSALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAA 432
           EQ  ALE +Q+L+    P P+T+DNGGSSVGD  A LNS+S NVL++++ ITHKD+VGA+
Sbjct: 376 EQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDKVGAS 435

Query: 433 IITAIVLGVMIGGSVWMVF 451
           IITA++L V++GGS+WM+F
Sbjct: 436 IITAVILAVLVGGSIWMIF 454

>Kwal_55.20266 s55 complement(327537..328910) [1374 bp, 457 aa] {ON}
           YMR238W (DFG5) - involved in pseudohyphal growth [contig
           152] FULL
          Length = 457

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/439 (70%), Positives = 371/439 (84%), Gaps = 3/439 (0%)

Query: 16  VHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDN 75
           V AIDLDTSSKDSIC ATSLIQKG++DYYEG ++GGTVGMFQ PYYWW+AGE FGGM++N
Sbjct: 19  VSAIDLDTSSKDSICDATSLIQKGVMDYYEGNRFGGTVGMFQQPYYWWEAGEVFGGMMEN 78

Query: 76  IYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPT 135
            +LC N+TY+  +YDAMIAQ G +YD++P+NQSMVEGNDDQGVWG+T+M AVERNFTNPT
Sbjct: 79  WFLCQNDTYEKTLYDAMIAQAGPDYDFMPSNQSMVEGNDDQGVWGLTLMSAVERNFTNPT 138

Query: 136 KEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARL 195
           ++GVPGWLAMVQ VFNTM++RWDS HCGGGLRWQIFTWNSGYNYKNT++N CLFQ+AARL
Sbjct: 139 EKGVPGWLAMVQGVFNTMWSRWDSDHCGGGLRWQIFTWNSGYNYKNTVSNACLFQLAARL 198

Query: 196 GRYTGNDTYLEVASKVWDWLEDVGFVVLQDK--ANVFDGANIENNCSSIVKIEWTYNHGV 253
           GRYTGN+TYL  A  VW+WL D+GFV   +   ANV+DGA I+ NC+ IV+IEW+YN G+
Sbjct: 199 GRYTGNETYLTKAETVWNWLVDIGFVRFNESGNANVYDGATIDKNCTDIVEIEWSYNQGI 258

Query: 254 VLGGAAYMYNAT-NGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKS 312
           VLGGAAYMYNAT NG+  W++RL Q++ G+ + FF N IMYE  CQ SG CN DQRSFKS
Sbjct: 259 VLGGAAYMYNATHNGTSDWESRLNQIVGGSTDIFFRNKIMYEATCQDSGKCNQDQRSFKS 318

Query: 313 IFSRMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLG 372
           IFSRML LT  LAP+T D IDPL+KASAEGAA+SCTGGTDGHTCGL+W  G HDG+YGLG
Sbjct: 319 IFSRMLSLTRTLAPYTADKIDPLMKASAEGAAKSCTGGTDGHTCGLNWEKGEHDGWYGLG 378

Query: 373 EQMSALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAA 432
           EQ  ALE +Q+ L    P P+TADNGG+SVGD  AGLN +S NVL ++L+IT KD+VGA+
Sbjct: 379 EQACALEGIQSQLYSMRPAPYTADNGGTSVGDTEAGLNKTSTNVLHSDLNITQKDKVGAS 438

Query: 433 IITAIVLGVMIGGSVWMVF 451
           IITA++L V++GGS+WM+F
Sbjct: 439 IITAVLLAVLVGGSIWMIF 457

>TDEL0B03360 Chr2 complement(601081..602391) [1311 bp, 436 aa] {ON}
           Anc_8.773 YMR238W
          Length = 436

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/435 (73%), Positives = 367/435 (84%), Gaps = 3/435 (0%)

Query: 19  IDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNIYL 78
           +DLD SSKDSICYAT+LIQKGMLDYYEGT+ GGTVGMFQ PYYWWQAGEAFGGM+DN Y 
Sbjct: 3   LDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWYF 62

Query: 79  CDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTKEG 138
           C+N T++ LIYD M+AQTG +YDY+P NQ+MVEGNDDQGVWG+T+MGAVERNFTNPT  G
Sbjct: 63  CENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTN-G 121

Query: 139 VPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLGRY 198
            PGWLAM QA+FN + +RWD+ +CGGGLRWQIFTWN GYNYKNTI+N CLFQIAARLGRY
Sbjct: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181

Query: 199 TGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVLGGA 258
           TGNDTYLEVA  V+DWL DVG+VVL+D  NVFDGA I+NNC+SI K+EW+YNHGVVLGG 
Sbjct: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241

Query: 259 AYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSG--TCNNDQRSFKSIFSR 316
           A+MYNATNGS  W+TR+TQ+L GA  +FF +SIMYE  CQG G  TCN+DQRSFK+IFSR
Sbjct: 242 AFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSR 301

Query: 317 MLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMS 376
           MLGLTSVL P T+  +D L+K SA  AA SC+GGTDGHTCGL+W    +DGYYGLGEQMS
Sbjct: 302 MLGLTSVLVPSTQSKVDDLLKQSALAAAASCSGGTDGHTCGLNWNKQANDGYYGLGEQMS 361

Query: 377 ALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIITA 436
           ALE+MQ LLI     PFT   GGSS GD NAGLN+SSANVL+N L I  KDR GAAIITA
Sbjct: 362 ALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITA 421

Query: 437 IVLGVMIGGSVWMVF 451
           ++L V++GGS+WM+F
Sbjct: 422 VILMVLVGGSIWMLF 436

>TBLA0B03320 Chr2 complement(774913..776265) [1353 bp, 450 aa] {ON}
           Anc_8.773 YMR238W
          Length = 450

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/434 (71%), Positives = 371/434 (85%), Gaps = 2/434 (0%)

Query: 18  AIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNIY 77
           A+DLDTSSK+SIC ATSLI KGMLDYY GT+YGGTVGMFQPPYYWW+AGEAFGGML+N Y
Sbjct: 19  AMDLDTSSKESICGATSLIIKGMLDYYWGTQYGGTVGMFQPPYYWWEAGEAFGGMLENWY 78

Query: 78  LCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTKE 137
           LC N+TY DL++DA+ AQTG +YDYIP NQ+MVEGNDDQ +WG+T+M AVERNFTNPT E
Sbjct: 79  LCQNDTYADLLFDALTAQTGPDYDYIPQNQTMVEGNDDQCIWGLTVMDAVERNFTNPT-E 137

Query: 138 GVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLGR 197
           G PGWLAM QAVFNTM++RWD+  CGGGLRWQIFTWNSGY+YKNTI+N CLFQ+AARLGR
Sbjct: 138 G-PGWLAMGQAVFNTMWSRWDAADCGGGLRWQIFTWNSGYDYKNTISNACLFQMAARLGR 196

Query: 198 YTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVLGG 257
           YTGN+TYL+VA+ V+DWL  VG+V + + A V+DGA+I  NC+ I K +W+YN+G +LGG
Sbjct: 197 YTGNNTYLDVANDVFDWLTGVGYVNMDNAAEVYDGADISENCTDITKYQWSYNNGCMLGG 256

Query: 258 AAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFSRM 317
           AAYMYNATNGS IW+TR+TQ+L+GA  +FF + IMYE ACQ + TCNNDQRSFKS+FSRM
Sbjct: 257 AAYMYNATNGSSIWETRVTQLLNGAKAYFFQDDIMYESACQTAKTCNNDQRSFKSLFSRM 316

Query: 318 LGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMSA 377
           LG TSVL P TRD IDPLI ASA+GAAR+C GGTDGHTCGL+W    HDGYYGLGEQMSA
Sbjct: 317 LGFTSVLVPSTRDIIDPLILASAQGAARTCNGGTDGHTCGLNWQASTHDGYYGLGEQMSA 376

Query: 378 LEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIITAI 437
           LE++QNLLI D P P+T+ +GGSS GD NAGLN +S NVL N+L I   D+VGAAI+TA 
Sbjct: 377 LEVIQNLLIHDRPAPYTSIDGGSSEGDANAGLNKTSKNVLSNDLDIKTGDKVGAAILTAG 436

Query: 438 VLGVMIGGSVWMVF 451
           VL +++GG++WM+F
Sbjct: 437 VLAILVGGAIWMLF 450

>KLLA0F24926g Chr6 complement(2321928..2323283) [1356 bp, 451 aa]
           {ON} similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 451

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/436 (70%), Positives = 360/436 (82%)

Query: 16  VHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDN 75
           V AIDLDTSSK SIC AT+LIQ+G+ DYYEG  YGGTVGMF  PYYWW+AG  FGGM++N
Sbjct: 16  VLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEAGLVFGGMIEN 75

Query: 76  IYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPT 135
            YLC N +Y+D++YDA++AQTG +YDY+P+NQ+MVEGNDDQGVW +T+M AVERNFTNP 
Sbjct: 76  WYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMTAVERNFTNPK 135

Query: 136 KEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARL 195
           ++G PGWLAMVQAVFN MY+RWDS HC GGLRWQIFTWNSGYNYKNTI+NGCLFQ+AARL
Sbjct: 136 EDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISNGCLFQLAARL 195

Query: 196 GRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVL 255
           GRYTGN TYLEVA KV+DWL D+ FVV++++ANVFDGA I++NC+SIVK EW+YNHGVVL
Sbjct: 196 GRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSIVKYEWSYNHGVVL 255

Query: 256 GGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFS 315
           GG AYMYNATNGSD+WQTR  Q+L GA  FFF + IMYE  CQ S  CN DQR FK+IFS
Sbjct: 256 GGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNKCNTDQRVFKAIFS 315

Query: 316 RMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQM 375
           RMLG TSVLAPFT DTI PLI  SA  AA+SC+GGTDGHTCGL+W  G  DG YGLGEQ 
Sbjct: 316 RMLGYTSVLAPFTTDTITPLIDTSAAAAAKSCSGGTDGHTCGLNWFTGDWDGQYGLGEQA 375

Query: 376 SALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIIT 435
            ALEI+  LL+ D+P P T   GGSS GD +AGLN S+ NVL+ N++IT  D+ GA IIT
Sbjct: 376 CALEIINQLLVHDLPAPLTESTGGSSSGDASAGLNVSTTNVLQKNINITAGDKAGAGIIT 435

Query: 436 AIVLGVMIGGSVWMVF 451
            IVLGV++ G+VWMV 
Sbjct: 436 TIVLGVLVLGTVWMVL 451

>KAFR0B03490 Chr2 (723671..725026) [1356 bp, 451 aa] {ON} Anc_8.773
           YMR238W
          Length = 451

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/438 (70%), Positives = 369/438 (84%), Gaps = 4/438 (0%)

Query: 17  HAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNI 76
            AIDLDTSSK SIC AT+LIQ GMLDYYEG +YGGTVGMFQ PYYWW+AGEAFGGML+N 
Sbjct: 15  KAIDLDTSSKTSICDATALIQDGMLDYYEGIRYGGTVGMFQSPYYWWEAGEAFGGMLENW 74

Query: 77  YLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTK 136
           +LC+N+T+K++IYDA++AQTG +YD++P NQ+MVEGNDDQ VWG+TIM AVERNFT+PT 
Sbjct: 75  FLCENDTFKEIIYDAILAQTGSDYDFMPENQTMVEGNDDQCVWGLTIMDAVERNFTDPT- 133

Query: 137 EGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLG 196
           +G PGWL M QA+FN M++RWDS +CGGGLRWQIFTWNSGY+YK+TI+N CLFQ+A+RLG
Sbjct: 134 DGSPGWLYMTQAIFNEMWSRWDSANCGGGLRWQIFTWNSGYDYKSTISNVCLFQLASRLG 193

Query: 197 RYTGNDTYLEVASKVWDWLEDVGFV-VLQDKANVFDGANIENNCSSIVKIEWTYNHGVVL 255
           RYTGNDTYL+VA  V+DWL DVGF+ V    A V+DGA+I  NC+ I  I+W+YNHG++L
Sbjct: 194 RYTGNDTYLDVAESVYDWLVDVGFINVANGTAYVYDGADISENCTDITTIDWSYNHGILL 253

Query: 256 GGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFS 315
           GGAAY YNATNGS +W++R+T +++GA   FF++ IMYE ACQ   TCNNDQRSFKSIFS
Sbjct: 254 GGAAYAYNATNGSSVWESRVTDIVEGAKSIFFSDGIMYESACQDYDTCNNDQRSFKSIFS 313

Query: 316 RMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQM 375
           RMLG TSVLAPFT  TIDPLIK+SA   A SC GGTDGHTCGL+W     DG YGLGEQM
Sbjct: 314 RMLGFTSVLAPFTASTIDPLIKSSAAACALSCDGGTDGHTCGLNWQDKTCDGNYGLGEQM 373

Query: 376 SALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLN--SSSANVLENNLSITHKDRVGAAI 433
           SALE++QNLLI D P P+TA  GGSSVGD +AGLN  +SSA+VLENNL+IT KDR GAAI
Sbjct: 374 SALEVIQNLLIHDRPAPYTASTGGSSVGDASAGLNTTTSSADVLENNLTITSKDRAGAAI 433

Query: 434 ITAIVLGVMIGGSVWMVF 451
           ITA++LG M GG++WM+F
Sbjct: 434 ITAVILGCMAGGAIWMLF 451

>KNAG0J00700 Chr10 complement(121298..122689) [1392 bp, 463 aa] {ON}
           Anc_8.773 YMR238W
          Length = 463

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/427 (69%), Positives = 357/427 (83%)

Query: 25  SKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNIYLCDNETY 84
           S D +C AT+L+  G+LDYY GT+YGGTVGMFQPPYYWW AGEAFGGM++N +LC N TY
Sbjct: 37  SLDPVCSATALVTDGLLDYYSGTRYGGTVGMFQPPYYWWHAGEAFGGMIENWFLCQNSTY 96

Query: 85  KDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTKEGVPGWLA 144
           + L+ DA IAQTG NYDYIP NQ+MVEGNDDQG+WG+TIM AVERNFT PTK+GVPGWLA
Sbjct: 97  ETLLMDAFIAQTGNNYDYIPENQTMVEGNDDQGIWGLTIMDAVERNFTKPTKDGVPGWLA 156

Query: 145 MVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLGRYTGNDTY 204
           M QAVFNTM+ARWD+QHCGGGLRWQIFTWNSGYNYKNTI+N CLF +AARLGRYTGN TY
Sbjct: 157 MSQAVFNTMWARWDTQHCGGGLRWQIFTWNSGYNYKNTISNACLFNLAARLGRYTGNSTY 216

Query: 205 LEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVLGGAAYMYNA 264
           L+VA +V+DW+  VG+VVL D ANVFDGANIE+NC++I   EW+YNHGVVLGG A+MYNA
Sbjct: 217 LDVADQVFDWMVSVGYVVLGDTANVFDGANIEDNCTTITTFEWSYNHGVVLGGTAFMYNA 276

Query: 265 TNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFSRMLGLTSVL 324
           TNGS +W+ R+ ++L GA  +FF +SIM+E ACQ +G CNNDQR+FK+IFSRML  T+VL
Sbjct: 277 TNGSSVWEDRVNRILKGATTYFFRDSIMFESACQDTGKCNNDQRTFKAIFSRMLSFTAVL 336

Query: 325 APFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMSALEIMQNL 384
            P T  TIDPL+++SA+ AA+SC+GGTDGHTCGL+W     DG YGLGEQMSALE+M  L
Sbjct: 337 VPSTASTIDPLMQSSAQAAAQSCSGGTDGHTCGLNWQHSGWDGMYGLGEQMSALEVMNYL 396

Query: 385 LIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIITAIVLGVMIG 444
           L+ D P P+TA  GGSSVGD +AGLNS++ NV  N+L+I  KD+ GAAI+T ++LG + G
Sbjct: 397 LVHDRPAPYTAAAGGSSVGDASAGLNSTATNVFANSLNIRGKDKAGAAIVTTVILGTLAG 456

Query: 445 GSVWMVF 451
           GS+WM+F
Sbjct: 457 GSIWMLF 463

>TPHA0J01600 Chr10 complement(371534..372919) [1386 bp, 461 aa] {ON}
           Anc_8.773 YMR238W
          Length = 461

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/446 (67%), Positives = 362/446 (81%), Gaps = 14/446 (3%)

Query: 18  AIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNIY 77
           AI LD  SKDS+C AT+LIQKGMLDYY+GT+YGGTVGMFQPPYYWW+AGEAFGGML+N Y
Sbjct: 18  AITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEAGEAFGGMLENWY 77

Query: 78  LCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTKE 137
           LC N+T++ LI DA+I Q G NYDYIP+NQ++VEGNDDQGVWG+T++GAVERN   P ++
Sbjct: 78  LCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLGAVERNL--PDRD 135

Query: 138 GVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLGR 197
           GVPGWLA+ QAVFNTMYARWD+ +CGGGLRWQI+TWNSGYNYKNTI+N CLFQIAARLGR
Sbjct: 136 GVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISNACLFQIAARLGR 195

Query: 198 YTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVLGG 257
           YTGN+TYLEVA KV+DW+ DV ++VL+D ANV+DGA    NCS IV+ EW+YNHGVVLGG
Sbjct: 196 YTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQYEWSYNHGVVLGG 255

Query: 258 AAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFSRM 317
            AYMYNATNG+  W+T LTQVL GA  +FF N+IMYE ACQ + TCN DQRSFKSIFSRM
Sbjct: 256 LAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCNTDQRSFKSIFSRM 315

Query: 318 LGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMSA 377
           LG T VLAP+T  T+D LI+ SA+ AA SC GGTDG TCGL W    +DGYYGLGEQMSA
Sbjct: 316 LGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTNDGYYGLGEQMSA 375

Query: 378 LEIMQNLLI------------DDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITH 425
           LEI+  LL+                 P+T+ +GG+S GD +AGLN++S NVL+NNL I  
Sbjct: 376 LEIINQLLVSSSGAAAEAASSGSASSPYTSSSGGNSTGDASAGLNTTSTNVLQNNLDIES 435

Query: 426 KDRVGAAIITAIVLGVMIGGSVWMVF 451
           KD+ GAA+ TA++L V++GGSVWM+F
Sbjct: 436 KDKAGAAVATAVILAVLVGGSVWMLF 461

>AFR530W Chr6 (1388049..1389428) [1380 bp, 459 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5)
          Length = 459

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/436 (66%), Positives = 354/436 (81%), Gaps = 1/436 (0%)

Query: 17  HAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNI 76
            A+DLD SS++ +C+ T+ IQKG++DYY G+KYGG VGMFQPPYYWW+AGE FGGML+N 
Sbjct: 24  RALDLDLSSREDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWWEAGEVFGGMLENW 83

Query: 77  YLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTK 136
           YLCDN+ Y+ ++ ++MIAQTG+ +DYIPANQS  EGNDDQGVW + IMGAVERNF +P K
Sbjct: 84  YLCDNQEYESVLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFIMGAVERNFKDPEK 143

Query: 137 EGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLG 196
           EG+PGWL MVQ VFN M ARWD+++CGGGLRWQIF WN+GY YKNTIANGCLFQ+AARLG
Sbjct: 144 EGMPGWLTMVQTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTIANGCLFQLAARLG 203

Query: 197 RYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVLG 256
           RYTGN TYL+VASKV+ WL DV ++VL+DKA VFDGA+I  NCS I  IEW+YNHG++L 
Sbjct: 204 RYTGNQTYLDVASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIKGIEWSYNHGIILA 263

Query: 257 GAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFSR 316
           GAAYMYNAT GS  W++ +T++L GA +F+F + IMYERACQ   TC+NDQRSFKSIFSR
Sbjct: 264 GAAYMYNATGGSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTCDNDQRSFKSIFSR 323

Query: 317 MLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMS 376
           ML +TSV+APFTR TID LI ASA  A++SC  GT G+TCGL+W  G +DG YGLGEQ S
Sbjct: 324 MLAITSVVAPFTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKGTYDGVYGLGEQAS 383

Query: 377 ALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLN-SSSANVLENNLSITHKDRVGAAIIT 435
           ALEI+QN+LI     P TAD GG S G+P+AGL+  S   +L    +IT KDRVGA++IT
Sbjct: 384 ALEIIQNVLIHTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHNITGKDRVGASLIT 443

Query: 436 AIVLGVMIGGSVWMVF 451
           AI LG+M+G ++WM+F
Sbjct: 444 AISLGLMLGCALWMIF 459

>Ecym_1474 Chr1 (976393..977757) [1365 bp, 454 aa] {ON} similar to
           Ashbya gossypii AFR530W
          Length = 454

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/433 (68%), Positives = 347/433 (80%)

Query: 19  IDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNIYL 78
           + LD  SKDSIC AT  IQ+G++DYY G+  GG VGMF  PYYWW+AG  F GML+N YL
Sbjct: 22  LQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPYYWWEAGLVFAGMLENWYL 81

Query: 79  CDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTKEG 138
           CDN  Y   +Y++MIAQTG NYDYIP+NQSM EGNDDQG+WG+ IMGAVERNF +     
Sbjct: 82  CDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWGLFIMGAVERNFPDAQMGN 141

Query: 139 VPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLGRY 198
           VPGWL M QAVFNTMYARWDSQHCGGGLRWQIFTWN GY+YKNTIANGCLFQ+AARLGRY
Sbjct: 142 VPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYKNTIANGCLFQLAARLGRY 201

Query: 199 TGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVLGGA 258
           TGN TYL++A++ + WL DV FVVL+D+ANVFDGA+I +NC  I  IEWTYNHGV+LGG 
Sbjct: 202 TGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQDIKGIEWTYNHGVILGGC 261

Query: 259 AYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFSRML 318
           AYMYNATNG  +W+TRL Q+L GA  FFF N+IMYERACQ +  CNNDQRSFKSIFSRML
Sbjct: 262 AYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDNKICNNDQRSFKSIFSRML 321

Query: 319 GLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMSAL 378
            +TSVLAPFTR+TIDPL++ASA  AA SC+GG DG TCGLDWT G  DGYYGLGEQ SAL
Sbjct: 322 AVTSVLAPFTRETIDPLLEASAAAAAASCSGGKDGETCGLDWTTGSWDGYYGLGEQASAL 381

Query: 379 EIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIITAIV 438
           E++QNLLI     P T + GG+S GDP AGL +   NVL + L+I  KDR+ AA+ITA+ 
Sbjct: 382 EVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSRLNIGSKDRIKAALITAVC 441

Query: 439 LGVMIGGSVWMVF 451
           LG+++G ++WMV 
Sbjct: 442 LGLLVGTALWMVI 454

>ZYRO0F12210g Chr6 (992529..993890) [1362 bp, 453 aa] {ON} similar
           to uniprot|Q05031 Saccharomyces cerevisiae YMR238W DFG5
           Mannosidase essential glycosylphosphatidylinositol
           (GPI)-anchored membrane protein required for cell wall
           biogenesis involved in filamentous growth homologous to
           Dcw1p
          Length = 453

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/438 (65%), Positives = 351/438 (80%), Gaps = 3/438 (0%)

Query: 16  VHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDN 75
           + A+DL    KDS+C AT+LIQ+GMLDYY G KYGG +GMFQPPYYWWQAGEAFGGM+DN
Sbjct: 17  IWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQAGEAFGGMIDN 76

Query: 76  IYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPT 135
            + C N T+++LI +AM+ Q G +YDY+P NQ+MVEGNDDQGVWG+T+M AVERNFT+P 
Sbjct: 77  WHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVMEAVERNFTDP- 135

Query: 136 KEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARL 195
            +G PGWLAM QAVFN +  RWD + C GG+RWQIFTWNSGYNYKNTI+NGC FQ+AARL
Sbjct: 136 GDGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNGCYFQLAARL 195

Query: 196 GRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVL 255
           GRYT N TYLEVA KV+DWL DVGFVVL+DK NVFDGA  ++NC+ + ++EWTYNHG++L
Sbjct: 196 GRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQVTELEWTYNHGIIL 255

Query: 256 GGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQ--GSGTCNNDQRSFKSI 313
           GG+AYMYNATNGS  W+ R+ Q+L+GA ++FF +++MYE  CQ   S  CNNDQRSFKSI
Sbjct: 256 GGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDSSNCNNDQRSFKSI 315

Query: 314 FSRMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGE 373
           FSRMLGLTSVL P   D +D L+ ASAEGAA+SC+GG DGHTCGL+W  G  D  YGLGE
Sbjct: 316 FSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKGSWDNQYGLGE 375

Query: 374 QMSALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAI 433
           QMSALE++QN LI +   P+    GGSS GD  AGLN+++ NVL+  L I  KDR GAAI
Sbjct: 376 QMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQKKLKIQSKDRAGAAI 435

Query: 434 ITAIVLGVMIGGSVWMVF 451
           IT +VL V++GGSVWM+F
Sbjct: 436 ITGVVLMVVVGGSVWMLF 453

>ACL200W Chr3 (12145..13536) [1392 bp, 463 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 463

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/434 (61%), Positives = 327/434 (75%), Gaps = 2/434 (0%)

Query: 17  HAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNI 76
           +A+D+D +S +SIC AT LIQ G+LDYYEG + GG VG FQ PYYWW AGEAFGGM++N 
Sbjct: 29  NALDVDFNSSESICDATKLIQVGILDYYEGLRPGGRVGFFQKPYYWWMAGEAFGGMVENW 88

Query: 77  YLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTK 136
           YLC+N  Y+DL+ DAM++Q GEN DY+P++Q M+EGNDDQG+WG+ +MGA ERNF +   
Sbjct: 89  YLCNNTEYQDLLTDAMVSQIGENKDYVPSHQKMIEGNDDQGIWGLLVMGAAERNFPDAPP 148

Query: 137 EGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLG 196
           E  PGWLA+ QAVFNTM+ARWD ++CGGGLRWQIF WN+GY+YKNTI+N CLFQIAARL 
Sbjct: 149 ERAPGWLALAQAVFNTMWARWDPENCGGGLRWQIFPWNNGYDYKNTISNACLFQIAARLA 208

Query: 197 RYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVLG 256
           R+TGN TY +VA  V+DWL D   V L++ A V DGA+I   C    K+EWTYNHGVVL 
Sbjct: 209 RFTGNSTYQDVAETVFDWLVDSKLVQLENDAKVLDGAHISERCEDHSKLEWTYNHGVVLA 268

Query: 257 GAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFSR 316
           G AYMYN TNGS +W  RL +VL+G++  FF N I+YERACQ    CN+DQRSF+SIFSR
Sbjct: 269 GCAYMYNITNGSAVWGDRLNKVLNGSL-LFFPNGILYERACQDVQKCNDDQRSFRSIFSR 327

Query: 317 MLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMS 376
           ML LTSVLAP T+  I+P I+ SAE AA+SC+GG DGHTCG+ W     DG YGLGEQ+S
Sbjct: 328 MLALTSVLAPHTKARIEPNIRKSAEAAAKSCSGGRDGHTCGMVWRNYTWDGKYGLGEQLS 387

Query: 377 ALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLE-NNLSITHKDRVGAAIIT 435
           ALEI+QN LI   P P TA+ G  S GDP+AGL  +S N++  +   I  KDRVGA  +T
Sbjct: 388 ALEIIQNTLIHTKPPPTTANEGAKSKGDPSAGLYDNSPNIITLSTRQIGLKDRVGAGFMT 447

Query: 436 AIVLGVMIGGSVWM 449
            ++L   I GS+WM
Sbjct: 448 VVLLIPFITGSIWM 461

>ACL201W Chr3 (10277..11623) [1347 bp, 448 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 448

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/434 (61%), Positives = 320/434 (73%), Gaps = 2/434 (0%)

Query: 17  HAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNI 76
           +A+D+D +S +SIC AT LIQ G+LDYYEG K GG  G    PYYWW AGEAFGGM++N 
Sbjct: 14  NALDVDFNSSESICDATKLIQVGILDYYEGAKPGGRAGFLVKPYYWWMAGEAFGGMVENW 73

Query: 77  YLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTK 136
           YLC+N  Y+DL+ DAM++Q GEN DY+P++Q MVEGNDDQG+WG+ +MGA ERNF +   
Sbjct: 74  YLCNNTEYQDLLTDAMVSQIGENKDYMPSHQKMVEGNDDQGIWGLLVMGAAERNFPDAPP 133

Query: 137 EGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLG 196
           E  PGWLA+ QAVFNTM+ARWD ++CGGGLRWQIF WN GY+YKNTI+N CLFQIAARL 
Sbjct: 134 ERAPGWLALAQAVFNTMWARWDPENCGGGLRWQIFPWNGGYDYKNTISNACLFQIAARLA 193

Query: 197 RYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVLG 256
           R+TGN TY +VA  V+DWL DV  V L++ A V DGA+I   C    ++EWTYNHGVVLG
Sbjct: 194 RFTGNSTYQDVAETVFDWLVDVKLVELENDARVLDGAHISERCEDHSQLEWTYNHGVVLG 253

Query: 257 GAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFSR 316
           G AYMYN TNGS +W  RL +VL+G++  FF N I+YERACQ    CN+DQRSF+SIFSR
Sbjct: 254 GCAYMYNITNGSAVWGDRLNKVLNGSL-LFFENGILYERACQDVNKCNDDQRSFRSIFSR 312

Query: 317 MLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMS 376
           ML LTSVLAP T+  I+P I+ SAE AA+SC+GG DGHTCG+ W     DG YGLGEQ+S
Sbjct: 313 MLALTSVLAPHTKARIEPNIRKSAEAAAKSCSGGRDGHTCGMVWRNYTWDGKYGLGEQLS 372

Query: 377 ALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLE-NNLSITHKDRVGAAIIT 435
           ALEI+QN LI   P P TA+ G  S GDP AGL  SS N +      I  KDRVGA   T
Sbjct: 373 ALEIIQNTLIHTKPPPTTANEGAKSQGDPGAGLQLSSPNSITLPTRQIRLKDRVGAGFAT 432

Query: 436 AIVLGVMIGGSVWM 449
            + L   I GS+WM
Sbjct: 433 VVFLLPFITGSIWM 446

>NCAS0A08740 Chr1 (1727048..1728352) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/399 (63%), Positives = 308/399 (77%), Gaps = 9/399 (2%)

Query: 18  AIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNIY 77
           +I L+ +S  SIC ATS+I KG+LDYYEGT++ GTVGMFQ PYYWW+AG AFGGML+N Y
Sbjct: 26  SIKLNVTSNTSICDATSIITKGILDYYEGTRFNGTVGMFQQPYYWWKAGSAFGGMLENWY 85

Query: 78  LCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTKE 137
           LC N+T++ L+ DAM+ Q G++YDY+P NQ+MVE NDDQGVWG+TIMGAVERNFT+P  +
Sbjct: 86  LCQNDTFESLLTDAMLHQAGKDYDYLPENQTMVEANDDQGVWGLTIMGAVERNFTDPQGK 145

Query: 138 GVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLGR 197
            VPGWLAM Q++FN MY+RWD+  CGGGLRWQI+ WN GYNYKNTI+  CLFQ+AARLGR
Sbjct: 146 DVPGWLAMAQSIFNQMYSRWDTGSCGGGLRWQIYDWNKGYNYKNTISTACLFQMAARLGR 205

Query: 198 YTGNDTYLEVASKVWDWLEDVGFVVLQDKA-NVFDGANIENNCSSIVKIEWTYNHGVVLG 256
           YTGN TYL+VA K + W+ D+G++ L   +  VFDGA+IE+NCS I K+EW+YNHG+VLG
Sbjct: 206 YTGNSTYLKVADKTFQWMVDIGYIQLNTSSGRVFDGAHIESNCSDITKLEWSYNHGIVLG 265

Query: 257 GAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGT--CNNDQRSFKSIF 314
           G AYMYNAT   + W     ++L+GA  +FF N  M E ACQ      CNNDQR+FKSIF
Sbjct: 266 GCAYMYNATKSPE-WGMNTIKILNGATTYFFQNKTMLETACQRPDRVFCNNDQRTFKSIF 324

Query: 315 SRMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQ 374
           SRMLGLTSV+APFT + IDPLI  SAE AA SCTGG D  TCGL+W  G +DGYYGLGEQ
Sbjct: 325 SRMLGLTSVMAPFTSERIDPLIVQSAEAAALSCTGGFDNETCGLNWLEGKNDGYYGLGEQ 384

Query: 375 MSALEIMQNLLIDDIPGPFTADN-----GGSSVGDPNAG 408
           +SALE++QNLLI   P P+ A       GG S GDP AG
Sbjct: 385 LSALEVIQNLLIHKRPPPYMAKTDKNKVGGVSKGDPAAG 423

>TBLA0C03850 Chr3 (921692..923395) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  526 bits (1355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/410 (61%), Positives = 311/410 (75%), Gaps = 12/410 (2%)

Query: 19  IDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNIYL 78
           I++DT SK+SIC ATSLIQ G+LDYYEG +YGGTVG+FQPPYYWWQ+GEAFG +L+N YL
Sbjct: 17  IEIDTHSKESICNATSLIQDGLLDYYEGNRYGGTVGIFQPPYYWWQSGEAFGSLLNNWYL 76

Query: 79  CDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTKEG 138
           C N+TY+ LIYDA++AQ G NYD++P NQ+MVEGNDDQGV+ +TI+ A+ERNFT P K G
Sbjct: 77  CQNDTYEKLIYDAILAQAGPNYDFVPKNQTMVEGNDDQGVFDMTILDAMERNFTAPPK-G 135

Query: 139 VPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLGRY 198
            P WL M Q VFN+MY RWD+  C GG+RWQI++WN+GY+YKN ++ G LF IAARL RY
Sbjct: 136 SPSWLDMNQRVFNSMYDRWDTTSCNGGIRWQIYSWNNGYDYKNAVSTGSLFHIAARLARY 195

Query: 199 TGNDTYLEVASKVWDWLEDVGFVVLQDK-ANVFDGANIENNCSSIVKIEWTYNHGVVLGG 257
           TGN +Y +VA  ++DWL  V +V+  DK   V DGA+IE NC+ I +IEWTYN G+++ G
Sbjct: 196 TGNASYFQVADTIFDWLTSVNYVMFDDKYGYVMDGASIEQNCTDITRIEWTYNFGIIMDG 255

Query: 258 AAYMYNATNGSDIWQTRLTQVLDGAVEFFFN-NSIMYERACQGSGTCNNDQRSFKSIFSR 316
            AY+YNATNGS  W+   T++L GA + FF+ N IMYE ACQ +  CNNDQRSFK++ +R
Sbjct: 256 CAYLYNATNGSAKWEQCTTKLLAGAKDDFFDKNDIMYEAACQTNNKCNNDQRSFKALLAR 315

Query: 317 MLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMS 376
            LG TSVLAP+T  TI P+I ASA GAA+SC GG DGHTCGL W  G +DGYYG+GEQMS
Sbjct: 316 FLGTTSVLAPYTESTIKPMINASAIGAAKSCNGGYDGHTCGLSWQKGTNDGYYGMGEQMS 375

Query: 377 ALEIMQNLLIDDIPGPFTADNGG---SSVGD------PNAGLNSSSANVL 417
           ALEI+QNLLI+D P P  A NGG    +V D      P  GLN +S   L
Sbjct: 376 ALEIIQNLLINDYPPPLVAPNGGCFNETVNDTQTRLRPPRGLNVTSRTTL 425

>NCAS0A08730 Chr1 (1724401..1726296) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 230/376 (61%), Positives = 302/376 (80%), Gaps = 3/376 (0%)

Query: 18  AIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNIY 77
           ++ LD +S  SIC ATSL+QKG+LDYYEGT YGGTVGMFQ PYYWW +G AFG M++N Y
Sbjct: 28  SLTLDQTSSKSICDATSLLQKGILDYYEGTTYGGTVGMFQAPYYWWHSGCAFGSMIENWY 87

Query: 78  LCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTKE 137
           LC ++TY+ LI DA++AQ G+NYD++P NQ+MVEGNDDQGVWG+ +M A ER F  P  +
Sbjct: 88  LCQDDTYESLITDAILAQAGDNYDFVPQNQTMVEGNDDQGVWGLALMDAAEREF--PQVK 145

Query: 138 GVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLGR 197
           G P WL M + +F +M+ARWD+ +CGGGLRWQI++WN+GY+YKNT++  CLFQ+AARLGR
Sbjct: 146 GQPSWLTMAENIFESMFARWDNANCGGGLRWQIYSWNNGYDYKNTVSTTCLFQLAARLGR 205

Query: 198 YTGNDTYLEVASKVWDWLEDVGFVVLQDK-ANVFDGANIENNCSSIVKIEWTYNHGVVLG 256
           YTGN+TY++ A++ +DWL+ VGFV+ ++    VFDGA+I  NC++I K EW+YNHG+VLG
Sbjct: 206 YTGNETYVKAANQAFDWLQGVGFVMFKNNDGYVFDGADISTNCTNIKKYEWSYNHGIVLG 265

Query: 257 GAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFSR 316
           GAAYMYN T+GS  W+TR +Q+L+ A  +FF N IM+E  CQ S  CNNDQRSF+SIF+R
Sbjct: 266 GAAYMYNLTDGSSTWETRTSQLLNLASSYFFQNGIMFEAECQTSNICNNDQRSFRSIFAR 325

Query: 317 MLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMS 376
           MLG TS++APFT +TIDPL+K +++ AA +C+GG DGHTCGL+W   + DG YGLGE+MS
Sbjct: 326 MLGKTSIMAPFTAETIDPLLKTTSKAAANACSGGKDGHTCGLNWLNSNFDGNYGLGEEMS 385

Query: 377 ALEIMQNLLIDDIPGP 392
           A+E++QNLLI   P P
Sbjct: 386 AMEVIQNLLIHQRPAP 401

>ACL202W Chr3 (8390..9742) [1353 bp, 450 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 450

 Score =  507 bits (1305), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 246/409 (60%), Positives = 296/409 (72%), Gaps = 6/409 (1%)

Query: 17  HAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNI 76
           +A+D++ +S  SIC AT LIQ+G+LDYYEG + GG VG FQ PYYWW AG+ FGGM++N 
Sbjct: 13  NALDVNFNSSASICNATKLIQQGILDYYEGLRPGGRVGFFQEPYYWWMAGDVFGGMVENW 72

Query: 77  YLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTK 136
           YLCDN  YKDL+ +AM++Q GEN DY+P +Q MVEGNDDQG+WG+ +M A ER+F +   
Sbjct: 73  YLCDNTEYKDLLTEAMVSQIGENKDYVPWHQRMVEGNDDQGIWGLLVMDAAERDFPDAPP 132

Query: 137 EGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLG 196
           +  PGWLA+ QAVFNTM+ARWD  +C GGL WQI+ WN GY+YKNTI+NG LFQIAARL 
Sbjct: 133 DQAPGWLALAQAVFNTMWARWDMDNCAGGLLWQIYPWNVGYDYKNTISNGYLFQIAARLA 192

Query: 197 RYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVLG 256
           R+TGN TY  VA  V+DWL D   V L + A V DGA++  NC+   + EWTYN+GVVLG
Sbjct: 193 RFTGNSTYGRVAETVFDWLVDSKLVQLDNVALVLDGAHVYTNCTDFTRYEWTYNYGVVLG 252

Query: 257 GAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFSR 316
           G AYMYN TNGS +W  RL +VL+GA+  FF N IMYER CQ    CNNDQR FKSIF+R
Sbjct: 253 GCAYMYNFTNGSPVWANRLNRVLNGAL-LFFENGIMYERTCQDVDRCNNDQRFFKSIFTR 311

Query: 317 MLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMS 376
           ML LTSVLAP T+  I+P I+ SAE AA+SC GG+DGHTCGL W     DG  GLGEQ+ 
Sbjct: 312 MLALTSVLAPHTKARIEPNIRKSAEAAAKSCNGGSDGHTCGLVWRNYTWDGKAGLGEQLC 371

Query: 377 ALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITH 425
           ALEI+QN LI     P TA  G  S GDP AGLNSS       +L I H
Sbjct: 372 ALEIIQNTLIHTKRPPLTAKQGAKSKGDPAAGLNSS-----RYDLPIVH 415

>KLLA0E07723g Chr5 complement(691980..693332) [1353 bp, 450 aa] {ON}
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 450

 Score =  497 bits (1280), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 238/434 (54%), Positives = 314/434 (72%), Gaps = 7/434 (1%)

Query: 19  IDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNIYL 78
           +DLD +  +S+  ATSL+  G++DYY G +YG T+GMF  P YWWQAG A+G +LD  + 
Sbjct: 21  LDLDVNDLNSLKNATSLVAYGLMDYYTGLQYGKTIGMFASPSYWWQAGGAWGSILDYWFY 80

Query: 79  CDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTKEG 138
            +N+TY D++  A++ QTG+N+DY+P NQ++ EGNDDQ  WG  +M A ERN+ NP  + 
Sbjct: 81  MENDTYNDILTQALLYQTGDNHDYMPLNQTVTEGNDDQAFWGFAVMAAAERNYPNPPDD- 139

Query: 139 VPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLGRY 198
            P WL + QAVFNTM +RWD   CGGGLRWQIFTWNSGY+YKN+++N  LF ++ARL RY
Sbjct: 140 EPQWLYLAQAVFNTMSSRWDMDSCGGGLRWQIFTWNSGYDYKNSVSNAALFHLSARLARY 199

Query: 199 TGNDTYLEVASKVWDWLEDVGFVVLQDKAN--VFDGANIENNCSSIVKIEWTYNHGVVLG 256
           TGN +Y E A K++DW++D+  +V ++     V+DGA+IE NC+  VK +WTYN G++L 
Sbjct: 200 TGNSSYTEWAEKIYDWMQDIQLLVDEEPTQYYVYDGASIEENCTDTVKYQWTYNQGLMLS 259

Query: 257 GAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFSR 316
           G+AY+YN T  S+ W  R    L+ +   FFNNSIMYE ACQGSG CNNDQRSFK+ FSR
Sbjct: 260 GSAYLYNFTE-SETWHERTKNFLNSS-GIFFNNSIMYEAACQGSGYCNNDQRSFKAYFSR 317

Query: 317 MLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMS 376
            LGLT+ L P TRDT+  L++ASA+GAA SC+GGTDGHTCGL+W  G  DG YGLGEQM+
Sbjct: 318 FLGLTAQLVPETRDTVLALLQASAQGAADSCSGGTDGHTCGLNWFYGGWDGKYGLGEQMA 377

Query: 377 ALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIITA 436
           ALE+MQNL   D P P+TAD+GG+S G+P AG   S  N+    L+I   D+ GA IITA
Sbjct: 378 ALEVMQNLRCLDRPAPYTADDGGTSAGNPAAGTEQSPTNLAP--LTIGKGDQAGAGIITA 435

Query: 437 IVLGVMIGGSVWMV 450
           ++   +IG  VW++
Sbjct: 436 VIGITIIGSVVWLI 449

>KLTH0D08008g Chr4 (680735..682081) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 448

 Score =  496 bits (1277), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 239/435 (54%), Positives = 314/435 (72%), Gaps = 5/435 (1%)

Query: 17  HAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNI 76
            A+D D  ++ SI  AT+L+  G+LDYY G +YG T+GMF  PYYWW+AG A+G +LD  
Sbjct: 19  QALDFDVDNEGSIKNATALVAGGLLDYYTGQQYGQTIGMFSNPYYWWEAGGAWGSILDFW 78

Query: 77  YLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTK 136
           +   N+TY  ++ +A++ Q GEN+DYIP NQS  EGNDDQ  WG+ +M A ERNFTNP  
Sbjct: 79  WYTQNDTYNAMLEEALLYQAGENHDYIPLNQSTTEGNDDQAFWGLVVMAAAERNFTNP-P 137

Query: 137 EGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLG 196
           E  P WL + QAVFNTM  RWD + CGGGLRWQIFTWNSGY+YKNT++NG LF +AARL 
Sbjct: 138 ETEPQWLYLAQAVFNTMALRWDDESCGGGLRWQIFTWNSGYDYKNTVSNGALFHLAARLA 197

Query: 197 RYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVLG 256
           RYTGN+TY++ A KV+DW++ +G +   D + V+DGA ++ NCS+I K+ WTYN G+++ 
Sbjct: 198 RYTGNNTYVDWAEKVFDWMKGIGLLTENDNSYVYDGAKVDGNCSTITKLIWTYNQGLLMS 257

Query: 257 GAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFSR 316
           G AY+YN T GS+ W TR  + L+ + + FFNNSI+YER CQ + TCN DQRSFK+ FSR
Sbjct: 258 GCAYLYNYT-GSETWHTRTFEFLNSS-DIFFNNSILYERTCQEANTCNTDQRSFKAYFSR 315

Query: 317 MLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMS 376
            LGLT+ L P  R+ I   I+ASA+GAA+SC+GGTDGHTCGL+W     DG +GLGEQM+
Sbjct: 316 FLGLTAQLVPAARNQIMDWIRASAKGAAQSCSGGTDGHTCGLNWFYDGWDGKWGLGEQMA 375

Query: 377 ALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIITA 436
           ALEIMQN+L  D P P+TA  GGSSVG+  AG  +S+ N+  + L IT   R  A IITA
Sbjct: 376 ALEIMQNVLCLDRPAPYTAATGGSSVGNGAAGTETSATNL--SPLDITTGSRAAAGIITA 433

Query: 437 IVLGVMIGGSVWMVF 451
           ++   ++  +VW+V 
Sbjct: 434 VIGLSIVACTVWLVL 448

>NDAI0C00680 Chr3 complement(132980..134338) [1359 bp, 452 aa] {ON}
           Anc_2.570
          Length = 452

 Score =  495 bits (1274), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 245/434 (56%), Positives = 302/434 (69%), Gaps = 5/434 (1%)

Query: 18  AIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNIY 77
           A+++D    DS+  ATSL+  G++DYY G +YG T+GMF  PYYWW+AG A+G MLD  Y
Sbjct: 24  ALEIDLDDIDSLRNATSLVAYGLMDYYTGNQYGKTIGMFSDPYYWWEAGGAWGSMLDYWY 83

Query: 78  LCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTKE 137
             DN+TY D I  A++ QTG+N DY+P NQS  EGNDDQ  WGI +M A ERNFTNP  E
Sbjct: 84  YMDNDTYNDEIMAALLHQTGDNNDYVPLNQSTTEGNDDQAFWGIAVMTAAERNFTNP-PE 142

Query: 138 GVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLGR 197
             P WL + QAVFNTM  RWD   CGGGLRWQIF WNSGY+YKNT++NG LF +AARL R
Sbjct: 143 DSPQWLYLAQAVFNTMALRWDGDTCGGGLRWQIFVWNSGYDYKNTVSNGALFHMAARLAR 202

Query: 198 YTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVLGG 257
           YTGN +Y++ A KV+DW+ +VG V       V+DG NI NNCS+I   +WTYNHG+V+ G
Sbjct: 203 YTGNQSYVDWAEKVYDWMYEVGLVSNGSSMFVYDGVNIANNCSTITPYQWTYNHGLVMAG 262

Query: 258 AAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFSRM 317
           AAY+YN T  +++W  R T++L  A   FFNNSIMYE ACQG  +CN DQRSFK+ FSR 
Sbjct: 263 AAYLYNFTE-NEVWHNR-TKMLVDASTVFFNNSIMYEAACQGPNSCNTDQRSFKAYFSRF 320

Query: 318 LGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMSA 377
           LG T+ L P TR  I PLI ASA  A +SC+GGTDGHTCGL+W +G  DG YGLGEQM A
Sbjct: 321 LGATAQLVPETRSKILPLINASAIAAGKSCSGGTDGHTCGLNWFIGDWDGMYGLGEQMCA 380

Query: 378 LEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIITAI 437
           LE+M N      P P+T+ NGGSSVGD  AG      N+    L IT   R GA IITA+
Sbjct: 381 LEVMVNTRCLHKPAPYTSTNGGSSVGDGAAGTEHHPTNLAP--LHITKGSRAGAGIITAV 438

Query: 438 VLGVMIGGSVWMVF 451
           +   ++  ++W+VF
Sbjct: 439 IGISILACALWLVF 452

>SAKL0D13574g Chr4 (1125011..1126366) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 451

 Score =  489 bits (1260), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 231/434 (53%), Positives = 310/434 (71%), Gaps = 4/434 (0%)

Query: 18  AIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNIY 77
           A+DLD    +S+  AT+L+  G++DYY G +YG T+GMF  PYYWW+AG A+G MLD  +
Sbjct: 22  AMDLDVDDLNSLKNATALVAYGLMDYYTGLQYGQTIGMFSNPYYWWEAGGAWGSMLDYWW 81

Query: 78  LCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTKE 137
             +N+TY D++  A++ QTG+++DY+P NQS  EGNDDQ  WG+ +M A ERNF+NP  +
Sbjct: 82  YMENDTYNDIVKQALLYQTGDDHDYVPLNQSTTEGNDDQAFWGLAVMAAAERNFSNPDPD 141

Query: 138 GVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLGR 197
             P WL + QAVFNTM  RWD+  CGGGLRWQIFTWNSGY+YKN+++NG LF IAARL R
Sbjct: 142 Q-PQWLYLAQAVFNTMALRWDADSCGGGLRWQIFTWNSGYDYKNSVSNGALFHIAARLAR 200

Query: 198 YTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVLGG 257
           YTGN +Y++ A KV+DW+ DVG +   D A V DG +I++NC+S+   +WTYNHG+++ G
Sbjct: 201 YTGNQSYVDWAEKVFDWMRDVGLITEGDWAFVHDGVSIDDNCTSVTPYQWTYNHGLIMAG 260

Query: 258 AAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFSRM 317
           +AY+YN T GS++W  R  + L  +  FF N SI++E ACQ S TCN DQRSFK+ FSR 
Sbjct: 261 SAYLYNFT-GSEVWHNRTKEFLHSSSVFFKNGSILWEAACQASNTCNTDQRSFKAYFSRF 319

Query: 318 LGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMSA 377
           LGLT+ L P +R  I   I++SA+GAA SC+GG DGHTCG++W  G  DG+YGLGEQM+A
Sbjct: 320 LGLTAQLVPESRSQIMEWIRSSAKGAAESCSGGRDGHTCGINWFNGSWDGFYGLGEQMAA 379

Query: 378 LEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIITAI 437
           LEI+QN+   D P P+T+  GGSS GD  AG  +   N+    L+IT   R GA IITA+
Sbjct: 380 LEIIQNVRCLDRPAPYTSTTGGSSQGDSAAGTETHPTNLTP--LTITAGSRAGAGIITAV 437

Query: 438 VLGVMIGGSVWMVF 451
           +   ++  +VW+V 
Sbjct: 438 IGISIVACAVWLVL 451

>Kwal_26.8225 s26 (696173..697522) [1350 bp, 449 aa] {ON} YKL046C -
           Hypothetical ORF [contig 58] FULL
          Length = 449

 Score =  485 bits (1249), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 235/434 (54%), Positives = 315/434 (72%), Gaps = 6/434 (1%)

Query: 19  IDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNIYL 78
           I LD ++ +SI  AT+L+  G+LDYY G +YG T+GMF  PYYWW+AG A+G +LD  + 
Sbjct: 21  IYLDVNNTESIKNATALVAGGLLDYYTGLQYGETIGMFSDPYYWWEAGGAWGSILDYWHY 80

Query: 79  CDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTKEG 138
             N+TY  ++  A++ Q+GEN+DYIP NQS  EGNDDQ  WG+ +M A ERNFTNP  + 
Sbjct: 81  TQNDTYNKILEQALLYQSGENHDYIPLNQSTTEGNDDQAFWGLVVMAAAERNFTNPPPDQ 140

Query: 139 VPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLGRY 198
            P WL + QAVFNTM  RWD   CGGGLRWQIFTWNSGY+YKNT++NG LF +AARL RY
Sbjct: 141 -PQWLYLAQAVFNTMALRWDEDTCGGGLRWQIFTWNSGYDYKNTVSNGALFHLAARLARY 199

Query: 199 TGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVLGGA 258
           TGNDTY+E A KV+DW++ +  +  +++  V+DGA +++NC+ I K+ WTYN G+++ G+
Sbjct: 200 TGNDTYVEWAEKVFDWMKGIKLLTEENENFVYDGAKVDDNCTVITKLIWTYNQGLLMSGS 259

Query: 259 AYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQG-SGTCNNDQRSFKSIFSRM 317
           AY+YN T G++ W TR  + L+ +   FFNNS++YERACQG + +CN DQRSFK+ FSR 
Sbjct: 260 AYLYNYT-GAEKWHTRTFEFLNSS-HIFFNNSVLYERACQGVTVSCNTDQRSFKAYFSRF 317

Query: 318 LGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMSA 377
           +GLT+ L P +R  I   I+ASA GAA+SC+GG DGHTCGL+W     DG +GLGEQMSA
Sbjct: 318 MGLTAQLVPESRSKIMAWIQASALGAAQSCSGGRDGHTCGLNWFYDGWDGKWGLGEQMSA 377

Query: 378 LEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIITAI 437
           LEIMQNLL  D P P+TA+ GGSSVG+  AG  +S+ N+  + L+IT   R  A IITA+
Sbjct: 378 LEIMQNLLCLDRPAPYTAETGGSSVGNGAAGTETSATNL--SPLAITAGSRAAAGIITAV 435

Query: 438 VLGVMIGGSVWMVF 451
           +   ++  ++W+V 
Sbjct: 436 IGLSIVACTIWLVL 449

>KAFR0I01740 Chr9 complement(352631..353977) [1347 bp, 448 aa] {ON}
           Anc_2.570 YKL046C
          Length = 448

 Score =  482 bits (1241), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 234/436 (53%), Positives = 310/436 (71%), Gaps = 5/436 (1%)

Query: 16  VHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDN 75
           V++++LD  S +S+  AT+L+  G++DYY G +YG TVGMF  PYYWW+AG A+G M+D 
Sbjct: 18  VYSLELDLDSFESLQNATALVAYGLMDYYTGNQYGKTVGMFSDPYYWWEAGGAWGSMIDF 77

Query: 76  IYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPT 135
            Y  DN TY D I  A++ QTG+++DYIP NQS  EGNDDQ  WGI +M A ERNFTNP 
Sbjct: 78  WYYMDNNTYNDDIMAALLHQTGDDWDYIPLNQSTTEGNDDQAFWGIAVMTAAERNFTNPP 137

Query: 136 KEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARL 195
            +  P WL + QAVFNTM  RWD   CGGGLRWQIFTWNSGY+YKNT++NG LF +AARL
Sbjct: 138 DDQ-PQWLYLAQAVFNTMALRWDDATCGGGLRWQIFTWNSGYDYKNTVSNGALFHLAARL 196

Query: 196 GRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVL 255
            RYTGN +Y++ A KV++W+ED   +    +  V+DGA++ +NC+++ K +WTYN G++L
Sbjct: 197 ARYTGNTSYVDWAEKVYNWMEDTYLISNGTQMFVYDGASVTDNCTTVTKYQWTYNQGLLL 256

Query: 256 GGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFS 315
            G+AY+YN T  S++W  R    L+ +V  FFNNSIMYE ACQG  TCN DQRSFK+ FS
Sbjct: 257 SGSAYLYNFTE-SELWHERTKGFLNASV-VFFNNSIMYEAACQGPQTCNTDQRSFKAYFS 314

Query: 316 RMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQM 375
           R LG T+ L P TRDT+   +  SA  AA SC+GGTDGHTCG++W  G  DGYYGLGEQM
Sbjct: 315 RFLGATAQLVPETRDTVMHWVNTSAVAAATSCSGGTDGHTCGINWFYGGWDGYYGLGEQM 374

Query: 376 SALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIIT 435
           SALEIM N      PGP+T++NGGSS+GD  AG  +++ N+  + L++T   +  A IIT
Sbjct: 375 SALEIMVNTRALHKPGPYTSENGGSSMGDGAAGTQATATNL--SPLNVTPGSKAAAGIIT 432

Query: 436 AIVLGVMIGGSVWMVF 451
           A++   +    +W+++
Sbjct: 433 AVIGISIFACVLWLIY 448

>KAFR0A02170 Chr1 (454336..455685) [1350 bp, 449 aa] {ON} Anc_2.570
           YKL046C
          Length = 449

 Score =  479 bits (1234), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 240/435 (55%), Positives = 307/435 (70%), Gaps = 5/435 (1%)

Query: 17  HAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNI 76
            +++LD     S+  AT+L+  G++DYYEGTKYGGTVGMF  PYYWW+AG AFG +LD  
Sbjct: 20  QSLELDLDDYQSLQNATALVAWGLMDYYEGTKYGGTVGMFSSPYYWWEAGGAFGTLLDFW 79

Query: 77  YLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTK 136
           Y  DN+TY D I  AM+ Q G ++DYIP NQS  EGNDDQ  WGI  M A ERNFTNP  
Sbjct: 80  YFMDNDTYNDEILAAMVYQAGNDWDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPAS 139

Query: 137 EGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLG 196
           +  P WL + QAVFNTM  RWD+  CGGGLRWQIFTWNSGY+YKN+++NG LF +AARL 
Sbjct: 140 D-EPQWLYLAQAVFNTMALRWDTDSCGGGLRWQIFTWNSGYDYKNSVSNGALFHLAARLA 198

Query: 197 RYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVLG 256
           RYTGND+Y++ A KV++W+ED GF+   +   V+DGA+ E+NCSS+ K +WTYN G++L 
Sbjct: 199 RYTGNDSYVDWAEKVYNWMEDTGFITTGNTLYVYDGASTEDNCSSVTKYQWTYNQGLILS 258

Query: 257 GAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFSR 316
           GAAY+YN +  S +W  R    L  +   F NNSIM E ACQ +GTC+ DQRSFK+ F+R
Sbjct: 259 GAAYLYNYSE-SSLWYNRTMTALSSS-GVFLNNSIMCEAACQPAGTCDTDQRSFKAYFAR 316

Query: 317 MLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMS 376
            LG+T+ L P TR  I   + ASA   A SC+GGTDGHTCGL+W LG  DGYYGLGEQMS
Sbjct: 317 FLGVTAQLVPSTRTQIMTWMNASAYAVAESCSGGTDGHTCGLNWFLGSWDGYYGLGEQMS 376

Query: 377 ALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIITA 436
           ALE++ N    D PGP+ + NGGSS GD  AG  +++ N+    L+IT   +  AAIITA
Sbjct: 377 ALEVLVNTRALDKPGPYNSTNGGSSQGDGAAGTETTATNLAP--LNITGGSKAAAAIITA 434

Query: 437 IVLGVMIGGSVWMVF 451
           ++   +I  ++W++F
Sbjct: 435 VIGISLIACTLWIIF 449

>NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score =  479 bits (1234), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 236/436 (54%), Positives = 302/436 (69%), Gaps = 5/436 (1%)

Query: 16  VHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDN 75
            +A+ LD ++  S+   T+L+  G++DYY G +YG TVGMF  PYYWW+AG A+G MLD 
Sbjct: 17  ANALSLDLNNYQSLENDTALVAYGLMDYYNGDQYGQTVGMFSNPYYWWEAGGAWGTMLDY 76

Query: 76  IYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPT 135
            +  +N+TY DLI  A++ QTGEN DYIP NQS  EGNDDQ  WGI  M A ERNFTNP 
Sbjct: 77  WFFMENDTYNDLIMSALLHQTGENNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNP- 135

Query: 136 KEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARL 195
            E  P WL + QAVFNTM  RWD+Q+CGGGLRWQIF WNSGY+YKN+++NG LF +AARL
Sbjct: 136 PESSPQWLYLAQAVFNTMALRWDAQNCGGGLRWQIFVWNSGYDYKNSVSNGALFHLAARL 195

Query: 196 GRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVL 255
            RYTGN +Y++ A K +DW+ DVG +    +  V+DG +IE NC++I   +W+YN G++L
Sbjct: 196 ARYTGNQSYVDWAEKTYDWMSDVGLISNGTQKYVYDGTSIETNCTTITSYQWSYNQGLML 255

Query: 256 GGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFS 315
            GAAY+YN T GS IW  R   +LD A   FFNNSIMYE ACQ +GTCNNDQRSFKS  +
Sbjct: 256 AGAAYLYNFT-GSTIWLNRTMDLLD-ATSVFFNNSIMYEVACQPTGTCNNDQRSFKSYLA 313

Query: 316 RMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQM 375
           R LGLT+ L   T+  I   +  SA   A SC+GGTDGHTCGL+W     DGYYGLGEQM
Sbjct: 314 RFLGLTAQLVTITQSRIMNWLNTSAIAVAHSCSGGTDGHTCGLNWFDNGWDGYYGLGEQM 373

Query: 376 SALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIIT 435
           SAL+++ N  + D P P+ + NGGSS+GD  AG  ++  N+    L IT   +VGAA IT
Sbjct: 374 SALDVLVNTRVLDRPAPYNSTNGGSSIGDGAAGTEATPTNLAP--LHITKGSKVGAAFIT 431

Query: 436 AIVLGVMIGGSVWMVF 451
           A +   ++  S+W++ 
Sbjct: 432 AAIGLSIVFTSIWIIL 447

>YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON}
           DCW1Putative mannosidase, GPI-anchored membrane protein
           required for cell wall biosynthesis in bud
           formation;homologous to Dfg5p
          Length = 449

 Score =  479 bits (1232), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 237/436 (54%), Positives = 305/436 (69%), Gaps = 5/436 (1%)

Query: 16  VHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDN 75
            +A++LD  + +S+  ATSLI  G++DYY G +YG TVGMF  PYYWW+AG A+G MLD 
Sbjct: 19  TNAVELDLDNYESLQNATSLIAYGLMDYYTGNQYGKTVGMFSDPYYWWEAGGAWGCMLDY 78

Query: 76  IYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPT 135
            +  DN+TY D I  AMI Q G++ DYIP NQS  EGNDDQ  WGI  M A ERNFTNP 
Sbjct: 79  WFFMDNDTYNDEIIAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNP- 137

Query: 136 KEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARL 195
            E  P WL + QAVFNTM  RWD+  CGGGLRWQIF WNSGY+YKNT++NG LF IAARL
Sbjct: 138 PENEPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAARL 197

Query: 196 GRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVL 255
            RYTGN TY++ A KV++W+  V  +       V+DG +I++NC+ +   +WTYN G++L
Sbjct: 198 ARYTGNQTYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIDDNCTKVTSYQWTYNQGLLL 257

Query: 256 GGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFS 315
            G+AY+YN T GSD+W TR  + L+ A + FF++ I+YE ACQG  +CN DQRSFK+ F+
Sbjct: 258 AGSAYLYNFT-GSDLWHTRTKEFLN-ASQVFFHDGIVYEAACQGPNSCNTDQRSFKAYFA 315

Query: 316 RMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQM 375
           R LG+T+ L P TR+ I   +  SA  AA+SC+GGTDGHTCGL+W  G  DG YGLGEQM
Sbjct: 316 RFLGVTAQLVPETRNQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDGMYGLGEQM 375

Query: 376 SALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIIT 435
           SALE+M N    D P P+TA+NGGSSVGD  AG  +   N+    L+IT   + GA IIT
Sbjct: 376 SALEVMVNTRALDKPAPYTAENGGSSVGDGAAGTQAQPTNLAP--LNITKGSKAGAGIIT 433

Query: 436 AIVLGVMIGGSVWMVF 451
           A++   ++  ++W+VF
Sbjct: 434 AVIGISIVACALWLVF 449

>Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {ON}
           YKL046C (REAL)
          Length = 450

 Score =  476 bits (1225), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 235/436 (53%), Positives = 305/436 (69%), Gaps = 5/436 (1%)

Query: 16  VHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDN 75
            +A++LD  +  S+  ATSLI  G++DYY G +YG TVGMF  PYYWW+AG A+G MLD 
Sbjct: 20  TNAVELDLDNYQSLQNATSLIAYGLMDYYTGDQYGKTVGMFSDPYYWWEAGGAWGCMLDY 79

Query: 76  IYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPT 135
            +  +N+TY D I  AMI Q G++ DYIP NQS  EGNDDQ  WGI  M A ERNFTNP 
Sbjct: 80  WFFMENDTYNDEITAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPP 139

Query: 136 KEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARL 195
            +  P WL + QAVFNTM  RWD+  CGGGLRWQIF WNSGY+YKNT++NG LF IAARL
Sbjct: 140 SD-EPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAARL 198

Query: 196 GRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVL 255
            RYTGN+TY++ A KV++W+  V  +       V+DG +I++NC+ +   +WTYN G++L
Sbjct: 199 ARYTGNETYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIDDNCTKVTSYQWTYNQGLLL 258

Query: 256 GGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFS 315
            G+AY+YN T GSD+W TR  + L+ A + FF++ I+YE ACQG  +CN DQRSFK+ F+
Sbjct: 259 AGSAYLYNFT-GSDLWHTRTKEFLN-ASQVFFHDGIVYEAACQGPNSCNTDQRSFKAYFA 316

Query: 316 RMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQM 375
           R LG+T+ L P TR  I   +  SA  AA+SC+GGTDGHTCGL+W  G  DG YGLGEQM
Sbjct: 317 RFLGVTAQLVPETRSQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDGMYGLGEQM 376

Query: 376 SALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIIT 435
           +ALE+M N    D P P+TADNGGSSVGD  AG  +   N+  + L+IT   + GA IIT
Sbjct: 377 AALEVMVNTRALDRPSPYTADNGGSSVGDGAAGTQAQPTNL--SPLNITKGSKAGAGIIT 434

Query: 436 AIVLGVMIGGSVWMVF 451
           A++   ++  ++W+VF
Sbjct: 435 AVIGISIVACALWLVF 450

>Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score =  474 bits (1221), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 233/436 (53%), Positives = 305/436 (69%), Gaps = 5/436 (1%)

Query: 16  VHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDN 75
            +A++LD  + +S+  ATSL+  G++DYY G +YG T+GMF  PYYWW+AG A+G MLD 
Sbjct: 19  TNAVELDLDNYESLQNATSLVAYGLMDYYTGNQYGKTIGMFSDPYYWWEAGGAWGCMLDY 78

Query: 76  IYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPT 135
            +  DN+TY D I  AMI Q G++ DYIP NQS  EGNDDQ  WGI  M A ERNFTNP 
Sbjct: 79  WFFMDNDTYNDEIIAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPP 138

Query: 136 KEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARL 195
           ++  P WL + QAVFNTM  RWD+  CGGGLRWQIF WNSGY+YKNT++NG LF IAARL
Sbjct: 139 EDD-PQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAARL 197

Query: 196 GRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVL 255
            RYTGN TY++ A KV++W+  V  +       V+DG +I++NC+ +   +WTYN G++L
Sbjct: 198 ARYTGNQTYVDWAEKVYEWMVGVDLISNGTYKYVYDGVSIDDNCTKVTSYQWTYNQGLLL 257

Query: 256 GGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFS 315
            G+AY+YN T GSD+W TR  + L+ A + FF++ I+YE ACQG  +CN DQRSFK+ F+
Sbjct: 258 AGSAYLYNFT-GSDLWHTRTKEFLN-ASQVFFHDGIVYEAACQGPNSCNTDQRSFKAYFA 315

Query: 316 RMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQM 375
           R LG+T+ L P TR  I   +  SA  AA+SC+GGTDGHTCGL+W  G  DG YGLGEQM
Sbjct: 316 RFLGVTAQLVPETRHQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDGMYGLGEQM 375

Query: 376 SALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIIT 435
           SALE++ N    D P P+TA+NGGSSVGD  AG  +   N+    L+IT   + GA IIT
Sbjct: 376 SALEVLVNTRALDRPAPYTAENGGSSVGDGAAGTQARPTNLAP--LNITKGSKAGAGIIT 433

Query: 436 AIVLGVMIGGSVWMVF 451
           A++   ++  ++W+VF
Sbjct: 434 AVIGISIVACALWLVF 449

>NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score =  474 bits (1220), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 234/435 (53%), Positives = 302/435 (69%), Gaps = 5/435 (1%)

Query: 16  VHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDN 75
           + A+DL+ +S  S+  ATSL+  G++DYY G +YG TVGMF  PYYWW+AG A+G MLD 
Sbjct: 17  IAAVDLNLNSLQSLQNATSLVAYGLMDYYTGDQYGQTVGMFSDPYYWWEAGGAWGTMLDY 76

Query: 76  IYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPT 135
            Y   N+TY D+I  A++ Q G + +YIP NQS  EGNDDQ  WGIT+M A ERNFTNP 
Sbjct: 77  WYFMQNDTYNDIITAALLHQVGTDNNYIPLNQSTTEGNDDQAFWGITVMTAAERNFTNP- 135

Query: 136 KEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARL 195
            E  P WL + QAVFNTM  RWD+  CGGGLRWQIF WNSGY+YKN+++NG LF +AARL
Sbjct: 136 PEDQPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNSVSNGALFHMAARL 195

Query: 196 GRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVL 255
            RYTGN +Y++ A +V+DW+ DVG +       V+DGA+  +NC+ +   +WTYN G++L
Sbjct: 196 ARYTGNQSYVDWAERVYDWMSDVGLISNGSYKFVYDGASTTDNCTVLTTYQWTYNQGLLL 255

Query: 256 GGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFS 315
            GAAY+YN T GSD W  R  Q+L+ A   FFNNSI+YE ACQ SGTCNNDQRSFK+ F 
Sbjct: 256 SGAAYLYNYT-GSDTWLLRTNQLLN-ASSVFFNNSILYEAACQKSGTCNNDQRSFKAYFL 313

Query: 316 RMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQM 375
           R LG T+ L   T+ TI   + ASA  AA+SC+GGTDGHTCGL+W  G  DG YGLGEQM
Sbjct: 314 RFLGQTAQLVSETQPTIMKWLNASAYAAAQSCSGGTDGHTCGLNWFSGGWDGMYGLGEQM 373

Query: 376 SALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIIT 435
           SALE + N  +  +PGP+ + +GGSS+G+  AG    + N+    L IT   +  AAIIT
Sbjct: 374 SALEALVNTRVLHLPGPYNSTDGGSSIGNSAAGTEQEATNLAP--LHITDGSKAAAAIIT 431

Query: 436 AIVLGVMIGGSVWMV 450
           ++V   ++   VW++
Sbjct: 432 SVVGISIVAAGVWLI 446

>TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.570
           YKL046C
          Length = 452

 Score =  474 bits (1220), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 234/433 (54%), Positives = 299/433 (69%), Gaps = 5/433 (1%)

Query: 18  AIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNIY 77
           A+ LD  + +S+  AT+L+  G++DYY G +YG T+GMF  PYYWW+AG A+G MLD  +
Sbjct: 24  AVYLDLDNYESLQNATALVAYGLMDYYTGLQYGKTIGMFSDPYYWWEAGGAWGCMLDYWF 83

Query: 78  LCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTKE 137
             +N+TY D+I  A++ Q G   DY+P NQS  EGNDDQ  WGI  M A ERNFTNP  E
Sbjct: 84  FMENDTYNDIIKQALLYQVGTANDYVPLNQSTTEGNDDQAFWGIAAMMAAERNFTNP-AE 142

Query: 138 GVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLGR 197
             P WL + QAVFNTM  RWD+  CGGGLRWQIF WNSGY+YKN+++NG LF IAARL R
Sbjct: 143 DEPQWLYLAQAVFNTMALRWDTDSCGGGLRWQIFQWNSGYDYKNSVSNGALFHIAARLAR 202

Query: 198 YTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVLGG 257
           YTGND+Y E A KV+DW+ DV  +       V+DG +  +NC++I K +WTYN G++L G
Sbjct: 203 YTGNDSYAEWAEKVYDWMVDVDLITQDQYYFVYDGVDSNDNCTTITKYQWTYNQGLILSG 262

Query: 258 AAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFSRM 317
            AY+YN T GS++W TR    L  +   FFN++I+YE ACQ   TCN DQRSFK+ FSR 
Sbjct: 263 CAYLYNYT-GSELWHTRTKNFLSSS-SVFFNDTILYEAACQNQETCNTDQRSFKAYFSRF 320

Query: 318 LGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMSA 377
           LG+T+ L P TRD I   I ASA GAA SC+GGTDGHTCG++W  G  DG YGLGEQM+A
Sbjct: 321 LGVTAQLVPETRDNIMKWIDASAYGAAESCSGGTDGHTCGINWFYGGWDGKYGLGEQMAA 380

Query: 378 LEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIITAI 437
           LEI+ N    D P P+T+ NGGSS GD  AG  +S+ N+  + L+IT   R GA IITA+
Sbjct: 381 LEILVNTRALDRPAPYTSSNGGSSTGDGAAGTETSATNL--SPLNITAGSRAGAGIITAV 438

Query: 438 VLGVMIGGSVWMV 450
           +   ++  + W+V
Sbjct: 439 IGISIVACACWLV 451

>NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570
          Length = 453

 Score =  471 bits (1212), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 237/436 (54%), Positives = 296/436 (67%), Gaps = 5/436 (1%)

Query: 16  VHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDN 75
           V A+ LD +  +S+  ATSL+  G++DYY G +YG TVGMF  PYYWWQAG A+G MLD 
Sbjct: 23  VSALTLDLNDTESLQNATSLVAYGLMDYYTGNQYGKTVGMFSDPYYWWQAGGAWGSMLDY 82

Query: 76  IYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPT 135
            Y  +N+TY D I  A++ QTG++ DY+P NQS  EGNDDQ  WGI +M A ERNFTNP 
Sbjct: 83  WYYMNNDTYNDDIMAALLHQTGDDNDYVPLNQSTTEGNDDQAFWGIAVMTAAERNFTNP- 141

Query: 136 KEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARL 195
            E  P WL + QAVFNTM  RWDS  CGGGLRWQIF WNSGY+YKNT++NG LF IA+RL
Sbjct: 142 PEDQPQWLYLAQAVFNTMAMRWDSDTCGGGLRWQIFIWNSGYDYKNTVSNGALFHIASRL 201

Query: 196 GRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVL 255
            RYTGN +Y++ A KV+DW+ DV  +       V+DG NI +NC+++   +WTYN G++L
Sbjct: 202 ARYTGNQSYVDWAEKVYDWMYDVHLISNGSYMYVYDGVNIGDNCTTVTPYQWTYNQGLLL 261

Query: 256 GGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFS 315
            G AY+YN T G ++W  R   +L  A   FFNNSI+YE ACQG  TCN DQRSFK+ FS
Sbjct: 262 SGCAYLYNFT-GEELWHNRTKNLLTAA-GVFFNNSILYEAACQGHNTCNTDQRSFKAYFS 319

Query: 316 RMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQM 375
           R LG T+ L P TR+ I   I  SA  AA+SC+GGTDGHTCG++W     DG YGLGEQM
Sbjct: 320 RFLGTTAQLVPETRNQIMHWINTSAVAAAQSCSGGTDGHTCGINWFADGWDGMYGLGEQM 379

Query: 376 SALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIIT 435
           +ALEIM N        P+T+ NGGSSVGD  AG      N+    L IT   R GA IIT
Sbjct: 380 AALEIMVNTKALSKAAPYTSSNGGSSVGDGAAGTEPHPTNLAP--LHITKGSRAGAGIIT 437

Query: 436 AIVLGVMIGGSVWMVF 451
           A++   ++  ++W+VF
Sbjct: 438 AVIGISIVTCALWLVF 453

>Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score =  470 bits (1210), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 231/435 (53%), Positives = 302/435 (69%), Gaps = 5/435 (1%)

Query: 17  HAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNI 76
           +A++LD  + +S+  ATSLI  G++DYY G +YG T+GMF  PYYWW+AG A+G MLD  
Sbjct: 20  NAVELDLDNYESLENATSLIAYGLMDYYTGNQYGKTIGMFSDPYYWWEAGGAWGCMLDYW 79

Query: 77  YLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTK 136
           +  DN+TY D I  AM+ Q+G++ DYIP NQS  EGNDDQ  WGI  M A ERNFTNP  
Sbjct: 80  FFMDNDTYNDEIIAAMVHQSGDDNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPPA 139

Query: 137 EGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLG 196
           +  P WL + QAVFNTM  RWD+  CGGGLRWQIF WNSGY+YKNT++NG LF IAARL 
Sbjct: 140 D-EPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAARLA 198

Query: 197 RYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVLG 256
           RYTGN TY++ A KV++W+  V  +       V+DG +I +NC+ +   +WTYN G++L 
Sbjct: 199 RYTGNQTYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIGDNCTKVTSYQWTYNQGLLLA 258

Query: 257 GAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFSR 316
           G+AY+YN T GSD+W TR  + L+ + + FF + I+YE ACQG  +CN DQRSFK+ F+R
Sbjct: 259 GSAYLYNFT-GSDLWHTRTKEFLNSS-QVFFQDGIVYEAACQGPNSCNTDQRSFKAYFAR 316

Query: 317 MLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMS 376
            LG+T+ L P TR+ I   +  SA  AA+SC+GGTDGHTCGL+W  G  DG YGLGEQM+
Sbjct: 317 FLGVTAQLVPETRNQIMTWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDGMYGLGEQMA 376

Query: 377 ALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIITA 436
           ALE+M N    D P P+TAD GGSS GD  AG  +   N+    L+IT   + GA IITA
Sbjct: 377 ALEVMVNTRALDKPAPYTADEGGSSAGDGAAGTQAQPTNLAP--LNITKGSKAGAGIITA 434

Query: 437 IVLGVMIGGSVWMVF 451
           ++   ++  ++W+VF
Sbjct: 435 VIGISIVACALWLVF 449

>TBLA0H02590 Chr8 complement(612543..613895) [1353 bp, 450 aa] {ON} 
          Length = 450

 Score =  459 bits (1180), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 231/437 (52%), Positives = 294/437 (67%), Gaps = 7/437 (1%)

Query: 16  VHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDN 75
            +A+ +D     S+  ATSLI  GM+DYY G  YG  +GMF  PYYWW+AG A+G +LD 
Sbjct: 18  TNALKIDLDDFSSLQNATSLIAYGMMDYYNGHDYGQVIGMFAKPYYWWEAGGAWGCLLDY 77

Query: 76  IYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPT 135
            Y   N+TY DLI +A++ QTG+  DY+P NQS  EGNDDQ  WGI  + A ERNFTNP 
Sbjct: 78  WYYMQNDTYNDLITEALLYQTGDRNDYVPLNQSTTEGNDDQAFWGIAAITAAERNFTNPP 137

Query: 136 KEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARL 195
            +  P WL + QAVFNTM  RWD   C GGLRWQIF WNSGY+YKN+++NG LF IAARL
Sbjct: 138 PDK-PQWLYLAQAVFNTMALRWDDSTCNGGLRWQIFVWNSGYSYKNSVSNGALFHIAARL 196

Query: 196 GRYTGNDTYLEVASKVWDWLEDVGFVV--LQDKANVFDGANIENNCSSIVKIEWTYNHGV 253
            RYTGN +Y+E A K++DW+   G +    +    V+DGANIE NC+ I + +WTYN G+
Sbjct: 197 ARYTGNQSYVEWADKIYDWMFGTGIISDEYETYKFVYDGANIETNCTDITRYQWTYNQGL 256

Query: 254 VLGGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSI 313
           VL G AY+YN T   + W  R  Q L+G+V FF +N ++YE ACQ +  CNNDQRSFK+ 
Sbjct: 257 VLAGCAYLYNHTQ-DEKWLIRTEQFLNGSVVFFRDN-VIYEAACQPNKNCNNDQRSFKAY 314

Query: 314 FSRMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGE 373
           F+R LG+T+ L P TRDTI   I  SA  AA++C+GGTDGHTCG+DW     DGYYGLGE
Sbjct: 315 FARFLGVTAQLIPSTRDTIMRWINTSAYAAAQACSGGTDGHTCGMDWVWKGWDGYYGLGE 374

Query: 374 QMSALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAI 433
           QM+ALE M N    D+P P+T+ NGGSS G   AG      N+  + L IT   + GA+I
Sbjct: 375 QMAALEFMVNTRALDMPPPYTSFNGGSSTGSGAAGTERDPTNL--SPLHITAGSKAGASI 432

Query: 434 ITAIVLGVMIGGSVWMV 450
           IT IV   ++ G++W+V
Sbjct: 433 ITCIVSISILTGAMWLV 449

>TBLA0H02580 Chr8 complement(610287..611636) [1350 bp, 449 aa] {ON} 
          Length = 449

 Score =  453 bits (1165), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 225/435 (51%), Positives = 292/435 (67%), Gaps = 6/435 (1%)

Query: 18  AIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNIY 77
           A+ L+ +   S+  A SL+  G++DYY G +YG T+GMF  PYYWW+AG A+G M+D  Y
Sbjct: 20  AVHLNLNVTSSLQNAASLVAVGLMDYYNGDQYGQTIGMFSNPYYWWEAGGAWGCMIDYWY 79

Query: 78  LCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTKE 137
              N+TY D+I  A++ QTG+  DYIP NQS  EGNDDQ  WGIT+M A ERNFTNP  +
Sbjct: 80  FMQNDTYNDIISQALLYQTGDRNDYIPLNQSTTEGNDDQAFWGITVMSAAERNFTNPPPD 139

Query: 138 GVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLGR 197
             P WL + QAVFNTM  RWD   C GGLRWQIF WNSGY+YKN+++NG LF +AARL R
Sbjct: 140 K-PQWLYLAQAVFNTMALRWDDSTCNGGLRWQIFVWNSGYSYKNSVSNGALFHMAARLAR 198

Query: 198 YTGNDTYLEVASKVWDWLEDVGFVVLQDKAN-VFDGANIENNCSSIVKIEWTYNHGVVLG 256
           YTGN +Y++ A KV+DW+E  G +        V+DGA+IE NC+ I + +WTYN G++L 
Sbjct: 199 YTGNQSYVDWAVKVYDWMEKTGLISNDTYFKFVYDGASIETNCTDITQFQWTYNQGLILS 258

Query: 257 GAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFSR 316
           G AY+YN T  S  W TR  Q ++G+   FFNNSI+YE ACQGS  C+NDQRSF++ F+R
Sbjct: 259 GCAYLYNHTEDSK-WLTRTEQFVNGSA-VFFNNSIVYEAACQGSKRCDNDQRSFRAYFAR 316

Query: 317 MLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQMS 376
            LG+T+ L P T+D I   I  SA  AA++C+GGTDGHTCGL+W     DGYYGLGEQM 
Sbjct: 317 FLGVTAQLVPTTKDIIMDWINTSAYAAAQACSGGTDGHTCGLNWFNIGWDGYYGLGEQMG 376

Query: 377 ALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIITA 436
           ALE + N    D+P P+T+ NGGSS G+  AG      N+    L IT   + GA IIT 
Sbjct: 377 ALEFLVNTRALDMPAPYTSSNGGSSTGNGAAGTEKPPTNL--GPLHITDGSKAGAGIITC 434

Query: 437 IVLGVMIGGSVWMVF 451
           ++   ++  + W+  
Sbjct: 435 VIGLSILLCTTWLAL 449

>Kpol_1056.4 s1056 complement(6537..7889) [1353 bp, 450 aa] {ON}
           complement(6537..7889) [1353 nt, 451 aa]
          Length = 450

 Score =  452 bits (1163), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 224/413 (54%), Positives = 285/413 (69%), Gaps = 6/413 (1%)

Query: 17  HAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNI 76
           HA++LD ++ DS+  ATSL+  G++DYY G +YG T+GMF  PYYWW+AG A+G M+D  
Sbjct: 20  HAVELDLNNLDSLRNATSLVAYGLMDYYNGLQYGQTIGMFSNPYYWWEAGGAWGTMIDYW 79

Query: 77  YLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTK 136
           Y   N+TY D+I  A+  QTG N DY+P NQS  EGNDDQ  WGI +M A ERNFTNP  
Sbjct: 80  YYMQNDTYNDIIMQALQYQTGVNNDYVPLNQSTTEGNDDQAFWGIAVMSAAERNFTNPPA 139

Query: 137 EGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLG 196
           +  P WL + QAVFNTM  RWD Q C GGLRWQIF WNSGY+YKN+++NG LF I ARL 
Sbjct: 140 D-RPQWLYLAQAVFNTMALRWDDQTCNGGLRWQIFVWNSGYDYKNSVSNGALFHIGARLA 198

Query: 197 RYTGNDTYLEVASKVWDWLEDVGFVVLQDK-ANVFDGANIENNCSSIVKIEWTYNHGVVL 255
           R+TGND+Y+E A KV+DW+E V  +    K A V+DG NI +NC+ +  ++WTYNHG++L
Sbjct: 199 RFTGNDSYVEWAEKVYDWMESVNLIEDDGKGAFVYDGVNIGDNCTKVTNLQWTYNHGLIL 258

Query: 256 GGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFS 315
            G AY+YN T G   W  R  + L+ A   FFN ++M+E ACQG  TC  DQR+FK+ FS
Sbjct: 259 SGCAYLYNYT-GDAKWYNRTERFLEYAY-VFFNRTVMFEAACQGVHTCTTDQRTFKAYFS 316

Query: 316 RMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQM 375
           R LG+T+ L P T+ TI   + ASA GAA+SC+GG DGHTCG++W  G  DGYYGLGEQM
Sbjct: 317 RFLGMTAQLVPDTQHTIMTYMNASAYGAAQSCSGGYDGHTCGINWFYGGWDGYYGLGEQM 376

Query: 376 SALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDR 428
            ALE+M N     +PGP+ + NGGSS GD  AG      N+  + L+IT   R
Sbjct: 377 CALEVMINTRALHVPGPYNSTNGGSSTGDGAAGTEQHPTNL--SPLNITSGSR 427

>CAGL0L01727g Chr12 complement(184249..185589) [1341 bp, 446 aa]
           {ON} highly similar to uniprot|P36091 Saccharomyces
           cerevisiae YKL046c
          Length = 446

 Score =  446 bits (1146), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 232/436 (53%), Positives = 292/436 (66%), Gaps = 5/436 (1%)

Query: 16  VHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDN 75
           V  ++LD     S+  AT+L+  G++DYY G +YG TVGMF  PYYWWQAG A+G MLD 
Sbjct: 16  VFGLELDLDDYASLQNATALVAYGLMDYYTGDQYGKTVGMFSDPYYWWQAGGAWGCMLDY 75

Query: 76  IYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPT 135
            Y   N+TY D I  A++ QTG+N DY+P NQS  EGNDDQ  WGI +M A ER F NP 
Sbjct: 76  WYFMQNDTYNDKIMAALLHQTGDNNDYVPLNQSTTEGNDDQAFWGIAVMQAAERKFPNPP 135

Query: 136 KEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARL 195
            +  P WL + QAVFNTM  RWDS+ CGGGLRWQIF WNSGY+YKNT++NG LF IAARL
Sbjct: 136 DDK-PQWLYLTQAVFNTMALRWDSETCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAARL 194

Query: 196 GRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVL 255
            RYTGN +Y++ A +V+DW+EDV  +       V+DG +I +NC+++ K +WTYN G++L
Sbjct: 195 ARYTGNQSYVDWAERVYDWMEDVHLIDNGTYRYVYDGVSINDNCTTVTKYQWTYNQGLML 254

Query: 256 GGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFS 315
            G+AY++N T GSD+W  R T     A   FFNNSI+YE ACQG  TCN DQRSFK+ F+
Sbjct: 255 SGSAYLFNMT-GSDLWHER-THAFLNASRVFFNNSILYEAACQGPNTCNTDQRSFKAYFA 312

Query: 316 RMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQM 375
           R LG T+ L P TR  I   +  SA  AA+SC+GGTDGHTCGL+W     DG YGLGEQM
Sbjct: 313 RFLGSTAELVPETRQQIMTWLNTSALAAAKSCSGGTDGHTCGLNWFRDDWDGMYGLGEQM 372

Query: 376 SALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIIT 435
           +ALE+M N        P+ A NGG+S GD  AG      N+    L IT   R GA IIT
Sbjct: 373 AALEVMVNTQALKRAPPYNATNGGNSTGDGAAGTKPHPTNLAP--LHITGGSRAGAGIIT 430

Query: 436 AIVLGVMIGGSVWMVF 451
           AI+   +I  ++W+V+
Sbjct: 431 AIIGISIIACALWLVY 446

>ABR060W Chr2 (504045..505400) [1356 bp, 451 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL046C
          Length = 451

 Score =  443 bits (1140), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 219/437 (50%), Positives = 295/437 (67%), Gaps = 7/437 (1%)

Query: 17  HAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNI 76
             ++LD     SI  ATSL+  G++DYY G  YG TVG F  PYYWW+AG A+G +LD  
Sbjct: 20  RTLNLDVDDLQSIREATSLLATGLMDYYHGHDYGETVGKFSDPYYWWEAGGAWGSILDYW 79

Query: 77  YLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTK 136
           Y  +N TY DL+ D+++ Q GE+  Y P N++  EGNDDQ  WG+ +M A ER   NP  
Sbjct: 80  YYMENSTYNDLLTDSLLHQAGEDLSYTPWNETTTEGNDDQFFWGMAVMDAAERKNPNPPA 139

Query: 137 EGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLG 196
           +  P  LA+ QAVFNTM  RWD + C GGLRWQIF WN GY+YKN+++NG LF +AARL 
Sbjct: 140 D-QPQRLALAQAVFNTMALRWDMETCNGGLRWQIFRWNDGYHYKNSVSNGALFHMAARLT 198

Query: 197 RYTGNDTYLEVASKVWDWLEDVGFV-VLQDKANV-FDGANIENNCSSIVKIEWTYNHGVV 254
           RYTGN TYLE A +V+DW+  VG + ++Q   +V +DG +I +NC+++ K++WTYNHG++
Sbjct: 199 RYTGNATYLEWAERVYDWMYGVGLISIVQPNWHVVYDGTDINDNCTNLNKLQWTYNHGLI 258

Query: 255 LGGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIF 314
           + G A++YN T   ++W  R  + LD A   F +N  +YE  CQG   CN DQRSFK+ F
Sbjct: 259 MAGCAFIYNHTQ-DELWHQRTLRFLDSA-RIFLSNDTLYEAGCQGGDNCNIDQRSFKAYF 316

Query: 315 SRMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQ 374
           SR LGLT+ L P +R+TI   I+ASA+GAA SC+GG DGHTCGL+W +   DG +GLGEQ
Sbjct: 317 SRFLGLTAQLVPESRETIVRWIRASAQGAAASCSGGRDGHTCGLNWLINGWDGKWGLGEQ 376

Query: 375 MSALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAII 434
           M+ALEI+QNL   + P P+TA NGG+S GDP AG  + + N+    L I   DR GA II
Sbjct: 377 MAALEIIQNLRCLERPAPYTAMNGGTSPGDPAAGTKTKAENLPP--LDIKAGDRAGAGII 434

Query: 435 TAIVLGVMIGGSVWMVF 451
           TA++    +  ++W++ 
Sbjct: 435 TALIGSSFLACTLWLII 451

>Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {ON}
           similar to Ashbya gossypii ABR060W
          Length = 450

 Score =  441 bits (1135), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 221/436 (50%), Positives = 295/436 (67%), Gaps = 6/436 (1%)

Query: 16  VHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDN 75
           V A++LD     S+  ATSLI  G+LDYY G   G T+GMF  PYYWW+AG A+G ++D 
Sbjct: 19  VSALELDVDDFSSMQSATSLISTGVLDYYTGLDPGNTIGMFSSPYYWWEAGAAWGALIDY 78

Query: 76  IYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPT 135
            +  +N+TY D+I  A++ Q G+  DY+P NQS  EGNDDQ  WGI +M A E+ F NP 
Sbjct: 79  WFYMENDTYNDIIKQALLYQVGKYEDYVPLNQSTTEGNDDQAFWGIAVMSAAEKGFPNPD 138

Query: 136 KEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARL 195
            +  P WLA+ QAVFNTM  RWDS  C GGLRWQIFTWN+GY+YKN+++NG LF +AARL
Sbjct: 139 PDQ-PQWLALAQAVFNTMAYRWDSSSCNGGLRWQIFTWNTGYDYKNSVSNGALFHLAARL 197

Query: 196 GRYTGNDTYLEVASKVWDWLEDVGFV-VLQDKANVFDGANIENNCSSIVKIEWTYNHGVV 254
            RYTGN +Y + A KV+DW+  V  +    D   V+DGA I +NCS    ++W+YNHG++
Sbjct: 198 ARYTGNQSYADWAEKVYDWMASVQLINQTGDWTFVYDGAFIHDNCSRPSVLQWSYNHGLI 257

Query: 255 LGGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIF 314
           LGG AY+ + T GSD+W  R  ++L  A   FF N ++ E ACQ +GTCN DQRSFK+ F
Sbjct: 258 LGGCAYLTDFT-GSDVWHNRTLRLLRSA-SIFFPNGVVTEVACQEAGTCNTDQRSFKAYF 315

Query: 315 SRMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQ 374
            R LGLT+ L P +R+     I+ SA+GAA SC+GG DGHTCG++++ G +D  YGLGEQ
Sbjct: 316 MRFLGLTAQLIPESREIAMKWIRDSAKGAALSCSGGRDGHTCGMNYSRGSYDESYGLGEQ 375

Query: 375 MSALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAII 434
           ++ALE +QNL   +   P TA  GG+S+G+P AG N +   +  + L I++ DR GA II
Sbjct: 376 LAALETIQNLRCLEKGSPLTASEGGTSIGNPGAGGNRNLGTL--SPLDISNADRAGAGII 433

Query: 435 TAIVLGVMIGGSVWMV 450
           TA+V   +I   VW+V
Sbjct: 434 TALVGFSLISCIVWLV 449

>KNAG0A07180 Chr1 (1127961..1129352) [1392 bp, 463 aa] {ON} 
          Length = 463

 Score =  441 bits (1134), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 220/393 (55%), Positives = 275/393 (69%), Gaps = 5/393 (1%)

Query: 16  VHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDN 75
           V A+D+D  + DSI  ATSLI  G++DYY G +YG TVGMF  PYYWW+AG A+G MLD 
Sbjct: 26  VAALDIDLDNLDSIRNATSLIAYGLMDYYTGEQYGKTVGMFADPYYWWEAGGAWGSMLDY 85

Query: 76  IYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPT 135
            +  DN+TY   I  AM+ QTGE+ +YIP NQS  EGNDDQ  WGI  M A ERNFTNP 
Sbjct: 86  SWFMDNDTYDSQIMSAMLHQTGEHNNYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNP- 144

Query: 136 KEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARL 195
            E  P WL + QAVFNTM  RWD++ CGGGLRWQIF WNSGY+YKNT++NG LF +A+RL
Sbjct: 145 PEDKPQWLYLAQAVFNTMALRWDTESCGGGLRWQIFNWNSGYDYKNTVSNGALFHMASRL 204

Query: 196 GRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVL 255
            RYTGN +Y++ A KV+DW+ DV  +       V+DG +  +NCS++ + +WTYNHG++L
Sbjct: 205 ARYTGNQSYVDWAEKVYDWMWDVHVISNSTYMFVYDGVDANDNCSTVTQYQWTYNHGLLL 264

Query: 256 GGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNS--IMYERACQGSGTCNNDQRSFKSI 313
            G+AY+YN T G ++W  R T+ L  A + FFN++  IMYE ACQ + TCNNDQRSFK+ 
Sbjct: 265 AGSAYLYNFT-GDEVWHNR-TKKLVTAAQVFFNSTTGIMYEAACQAALTCNNDQRSFKAY 322

Query: 314 FSRMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGE 373
           FSR LGLT+ L P TR  I   +  SA  A +SC+GG DGHTCGL+W     DG YGLGE
Sbjct: 323 FSRFLGLTAQLVPETRTQIMGWLNTSAVAAGKSCSGGYDGHTCGLNWFKDGWDGMYGLGE 382

Query: 374 QMSALEIMQNLLIDDIPGPFTADNGGSSVGDPN 406
           QMSALE + N      P P+TA NGGSS G+ +
Sbjct: 383 QMSALECILNTRALMKPAPYTATNGGSSKGESS 415

>TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON}
           Anc_2.570 YKL046C
          Length = 447

 Score =  439 bits (1128), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 218/436 (50%), Positives = 291/436 (66%), Gaps = 5/436 (1%)

Query: 16  VHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDN 75
            +A+ +D ++ +SI  A+SL+  G++DYY G +YG T+GMF  PYYWW+AG A+G MLD 
Sbjct: 17  ANAVWIDLNNTESIHNASSLVAVGLMDYYTGLQYGETIGMFSDPYYWWEAGGAWGCMLDY 76

Query: 76  IYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPT 135
            +   N+TY D+I  A++ Q G + DY+P NQS  EGNDDQ  WGI  M A ERNFTNP 
Sbjct: 77  WWYMQNDTYNDIIMQALLYQVGTHNDYVPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPP 136

Query: 136 KEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARL 195
            +  P WL + QAVFNTM  RWD+  C GGLRWQIF WN+GY+YKNT++NG LF +AARL
Sbjct: 137 SDQ-PQWLYLAQAVFNTMALRWDTTSCNGGLRWQIFMWNTGYDYKNTVSNGALFNLAARL 195

Query: 196 GRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSSIVKIEWTYNHGVVL 255
            RYTGN +Y++ A KV+DW+  VG +   +   V+DG NI +NC++I   +W+YNHG++L
Sbjct: 196 ARYTGNQSYVDWADKVYDWMYGVGLISNGNSRFVYDGVNIAHNCANITGYQWSYNHGLML 255

Query: 256 GGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIFS 315
            G AY+YN T   + W  R  + L+ A   F+NNS++YE ACQ    CN DQRSFK+ F+
Sbjct: 256 SGCAYLYNMTK-DEKWGNRTFEYLNSA-SIFYNNSVLYEVACQTVNKCNTDQRSFKAYFT 313

Query: 316 RMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQM 375
           R LG+T+ L P  RD     I ASA GAA+SC+GG DGHTCG++W     DG YGLGEQM
Sbjct: 314 RFLGVTAELIPQARDQAMKWINASALGAAQSCSGGYDGHTCGINWFYDGWDGMYGLGEQM 373

Query: 376 SALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAIIT 435
           SALE + N    + P P+ + NGGSS GD  AG   S  N+  + L IT   R GA IIT
Sbjct: 374 SALEALVNTQALNRPPPYNSTNGGSSTGDGAAGTEESPTNL--SPLDITAGSRAGAGIIT 431

Query: 436 AIVLGVMIGGSVWMVF 451
            ++   ++  ++W++ 
Sbjct: 432 CVIGISILSCALWLIL 447

>TBLA0H02600 Chr8 complement(614887..616236) [1350 bp, 449 aa] {ON}
           Anc_2.570 YKL046C
          Length = 449

 Score =  433 bits (1113), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 228/436 (52%), Positives = 292/436 (66%), Gaps = 6/436 (1%)

Query: 16  VHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDN 75
            +A+ L+ +   S+  A +L+  G++DYY G +YG T+GMF  PYYWW+AG A+G MLD 
Sbjct: 18  TNAVSLNLNDSSSLDNAAALVAYGLMDYYNGNQYGQTIGMFSDPYYWWEAGGAWGCMLDY 77

Query: 76  IYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPT 135
            Y   N+TY D+IY+A+  QTG++ DYIP NQS  EGNDDQ  WGI  + A ERNFTNP 
Sbjct: 78  WYYMQNDTYNDVIYEALQYQTGDDNDYIPLNQSTTEGNDDQAFWGIAAITAAERNFTNPP 137

Query: 136 KEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARL 195
            +  P WL + QAVFNTM  RWDS  C GGLRWQIF WNSGY+YKN+++NG LF IAARL
Sbjct: 138 PDK-PQWLYLAQAVFNTMALRWDSDTCNGGLRWQIFVWNSGYSYKNSVSNGALFHIAARL 196

Query: 196 GRYTGNDTYLEVASKVWDWLEDVGFVVLQDKAN-VFDGANIENNCSSIVKIEWTYNHGVV 254
            RYTGN +Y++ + KV+DW+   G +        V DG NIE NC+ I   +WTYN G++
Sbjct: 197 ARYTGNQSYVDWSEKVYDWMLGTGLISNGTTYKFVHDGVNIETNCTDITPYQWTYNQGLL 256

Query: 255 LGGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIF 314
           L G AY+YN T   + W  R  Q L+G+   FFNNS++YE ACQ +  CNNDQRSFK+ F
Sbjct: 257 LAGCAYLYNFTQ-DEKWLIRTNQFLNGS-GVFFNNSVIYEAACQPNKNCNNDQRSFKAYF 314

Query: 315 SRMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQ 374
           +R LG+T+ L P TRDTI   I  SA  AA++C+GGTDGHTCG+DW     DGYYGLGEQ
Sbjct: 315 ARFLGVTAQLLPSTRDTIMQWIDTSAYAAAQACSGGTDGHTCGMDWNWNGWDGYYGLGEQ 374

Query: 375 MSALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAII 434
           M+ALE M N    D+P P+T+ NGGSS G   AG      N+    L+IT   + GA II
Sbjct: 375 MAALEFMVNTRALDLPPPYTSSNGGSSTGSGAAGTEQKPTNL--GPLNITAGSKAGAGII 432

Query: 435 TAIVLGVMIGGSVWMV 450
           T +V   ++  S+W+V
Sbjct: 433 TCVVGISILACSMWLV 448

>ZYRO0E06380g Chr5 (484736..486097) [1362 bp, 453 aa] {ON} similar
           to uniprot|P36091 Saccharomyces cerevisiae YKL046C DCW1
           Mannosidase GPI-anchored membrane protein required for
           cell wall biosynthesis homologous to Dfg5p
          Length = 453

 Score =  422 bits (1085), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 211/436 (48%), Positives = 292/436 (66%), Gaps = 7/436 (1%)

Query: 18  AIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYYWWQAGEAFGGMLDNIY 77
           A+D+D +   ++  A++L+ KG++DYY G +YG T+GMF  PYYWW+AG A+  ++D  +
Sbjct: 21  ALDIDLNDFKTLQNASALVAKGLMDYYTGDQYGQTIGMFSWPYYWWEAGGAWNTLIDYWF 80

Query: 78  LCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGITIMGAVERNFTNPTKE 137
              N+TY D + +A++ Q+G+N+DY+P NQS VEGNDDQ  WGI ++ A ER F NP  +
Sbjct: 81  YMKNDTYNDKVTEALLYQSGDNHDYVPLNQSTVEGNDDQAFWGIAVLNAAERKFPNPPDD 140

Query: 138 GVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKNTIANGCLFQIAARLGR 197
             P WL + QAVFNTM  RWD+  CGGGLRWQIFTWN+GY+YKNT++NG LF IAARL  
Sbjct: 141 Q-PQWLYLGQAVFNTMALRWDTATCGGGLRWQIFTWNTGYDYKNTVSNGALFHIAARLAY 199

Query: 198 YTGNDTYLEVASKVWDWLEDVGFVVLQDKAN--VFDGANIENNCS-SIVKIEWTYNHGVV 254
           +TGN +Y++ A +V+DW+ DV  +  ++  N  V+DG ++ NNCS  + +I WTYNHG+V
Sbjct: 200 FTGNSSYVDWAERVYDWMHDVKLIEPENDDNKYVYDGVDVSNNCSGPVTRIVWTYNHGLV 259

Query: 255 LGGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSGTCNNDQRSFKSIF 314
           L G AY+Y  T G  IW  R    L+ A + F+N+SI+YE +CQ S TCN DQRSFKS +
Sbjct: 260 LSGCAYLYKET-GDKIWYNRSKAFLETAAKLFYNDSILYEYSCQQSKTCNVDQRSFKSYY 318

Query: 315 SRMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWTLGHHDGYYGLGEQ 374
           S  L  T+ L P  R+ I  ++ A+A  AA++C GG DGHTCG++W     DG YGLGEQ
Sbjct: 319 STFLAATAQLIPDFREQIMKVVNATAYAAAQACVGGYDGHTCGINWNQKGWDGQYGLGEQ 378

Query: 375 MSALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNLSITHKDRVGAAII 434
           M+ALE +      + P P+ + NGG+S GD  AG  ++  N+    L IT   R GA II
Sbjct: 379 MAALEALVVTQAMNKPAPYNSTNGGNSTGDGAAGTQTAPTNL--KPLHITAGSRAGAGII 436

Query: 435 TAIVLGVMIGGSVWMV 450
           T +V   +I   +W+V
Sbjct: 437 TCVVGFSIIASFLWLV 452

>Smik_9.160 Chr9 complement(270288..274244) [3957 bp, 1318 aa] {ON}
           YIL030C (REAL)
          Length = 1318

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 6/61 (9%)

Query: 35  LIQKGMLDYYEGTKYGGTVGM------FQPPYYWWQAGEAFGGMLDNIYLCDNETYKDLI 88
           LI K +L ++E T+   T+G+         P  W   G+ +  MLD  Y    +  K LI
Sbjct: 116 LISKSILAFFEKTRLALTIGLAAVLYIIGVPLVWNMFGKLYTMMLDGSYPYPGDFVKSLI 175

Query: 89  Y 89
           Y
Sbjct: 176 Y 176

>KLLA0C09262g Chr3 (805512..807188) [1677 bp, 558 aa] {ON} highly
           similar to uniprot|P40055 Saccharomyces cerevisiae
           YER082C
          Length = 558

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 16/35 (45%)

Query: 349 GGTDGHTCGLDWTLGHHDGYYGLGEQMSALEIMQN 383
            G  GH   LDW  G   G   LGE + A   +QN
Sbjct: 133 AGRKGHVASLDWRKGELRGELNLGETVQAATYLQN 167

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,956,789
Number of extensions: 2245883
Number of successful extensions: 5066
Number of sequences better than 10.0: 67
Number of HSP's gapped: 5030
Number of HSP's successfully gapped: 67
Length of query: 451
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 338
Effective length of database: 40,524,141
Effective search space: 13697159658
Effective search space used: 13697159658
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)