Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0A09504g2.534ON1671678701e-121
TDEL0A030802.534ON1671677451e-102
KLTH0D06864g2.534ON1671677421e-101
YMR071C (TVP18)2.534ON1671677401e-101
NCAS0F008902.534ON1671677401e-101
CAGL0K03025g2.534ON1671677331e-100
NDAI0H013902.534ON1671677331e-100
Skud_13.2272.534ON1671677321e-100
Suva_13.2482.534ON1671677301e-99
KNAG0C058002.534ON1671677118e-97
TPHA0G035202.534ON2041687052e-95
KAFR0A018702.534ON1671676822e-92
Smik_13.2502.534ON1671676805e-92
TBLA0G022402.534ON1671676795e-92
AGL072W2.534ON1671675685e-75
Ecym_72542.534ON1671675417e-71
ZYRO0B02024g2.534ON1661585408e-71
Kpol_348.92.534ON1301305342e-70
KLLA0E18525g2.534ON1711655062e-65
Kwal_26.80252.534ON64642852e-33
NDAI0D003707.492ON27845810.026
KNAG0H03860singletonON239107780.068
KNAG0J009903.242ON29065653.8
ABR227C8.18ON75736646.1
Ecym_15258.18ON75736638.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0A09504g
         (167 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0A09504g Chr1 complement(833526..833958,834035..834105) [504...   339   e-121
TDEL0A03080 Chr1 complement(550148..550651) [504 bp, 167 aa] {ON...   291   e-102
KLTH0D06864g Chr4 complement(599324..599756,599835..599905) [504...   290   e-101
YMR071C Chr13 complement(410762..411265) [504 bp, 167 aa] {ON}  ...   289   e-101
NCAS0F00890 Chr6 (179151..179654) [504 bp, 167 aa] {ON} Anc_2.53...   289   e-101
CAGL0K03025g Chr11 complement(283076..283579) [504 bp, 167 aa] {...   286   e-100
NDAI0H01390 Chr8 (338958..339461) [504 bp, 167 aa] {ON} Anc_2.53...   286   e-100
Skud_13.227 Chr13 complement(385097..385600) [504 bp, 167 aa] {O...   286   e-100
Suva_13.248 Chr13 complement(392000..392503) [504 bp, 167 aa] {O...   285   1e-99
KNAG0C05800 Chr3 (1126605..1127108) [504 bp, 167 aa] {ON} Anc_2....   278   8e-97
TPHA0G03520 Chr7 complement(751783..752397) [615 bp, 204 aa] {ON...   276   2e-95
KAFR0A01870 Chr1 complement(389508..390011) [504 bp, 167 aa] {ON...   267   2e-92
Smik_13.250 Chr13 complement(394856..395359) [504 bp, 167 aa] {O...   266   5e-92
TBLA0G02240 Chr7 complement(581646..582149) [504 bp, 167 aa] {ON...   266   5e-92
AGL072W Chr7 (574009..574512) [504 bp, 167 aa] {ON} Syntenic hom...   223   5e-75
Ecym_7254 Chr7 (536391..536894) [504 bp, 167 aa] {ON} similar to...   213   7e-71
ZYRO0B02024g Chr2 complement(163601..164101) [501 bp, 166 aa] {O...   212   8e-71
Kpol_348.9 s348 complement(17797..18189) [393 bp, 130 aa] {ON} c...   210   2e-70
KLLA0E18525g Chr5 (1647606..1648121) [516 bp, 171 aa] {ON} simil...   199   2e-65
Kwal_26.8025 s26 complement(615707..615901) [195 bp, 64 aa] {ON}...   114   2e-33
NDAI0D00370 Chr4 (77608..78444) [837 bp, 278 aa] {ON} Anc_7.492 ...    36   0.026
KNAG0H03860 Chr8 complement(712040..712759) [720 bp, 239 aa] {ON}      35   0.068
KNAG0J00990 Chr10 complement(173785..174657) [873 bp, 290 aa] {O...    30   3.8  
ABR227C Chr2 complement(827285..829558) [2274 bp, 757 aa] {ON} S...    29   6.1  
Ecym_1525 Chr1 complement(1080846..1083119) [2274 bp, 757 aa] {O...    29   8.1  

>SAKL0A09504g Chr1 complement(833526..833958,834035..834105) [504
           bp, 167 aa] {ON} highly similar to uniprot|Q04767
           Saccharomyces cerevisiae YMR071C TVP18 Tlg2-Vesicle
           Protein of 18 kDa Integral membrane vesicle protein
          Length = 167

 Score =  339 bits (870), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 167/167 (100%), Positives = 167/167 (100%)

Query: 1   MALGIKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSI 60
           MALGIKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSI
Sbjct: 1   MALGIKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSI 60

Query: 61  IQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLI 120
           IQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLI
Sbjct: 61  IQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLI 120

Query: 121 VVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHEAVVREML 167
           VVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHEAVVREML
Sbjct: 121 VVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHEAVVREML 167

>TDEL0A03080 Chr1 complement(550148..550651) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  291 bits (745), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 157/167 (94%)

Query: 1   MALGIKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSI 60
           MALG++QFIN+AGIVKDLKSFNFS+YG+WFGYINI LC+ALGIANLFHV+AV+AFG+++I
Sbjct: 1   MALGVRQFINVAGIVKDLKSFNFSLYGRWFGYINIFLCIALGIANLFHVSAVIAFGIVAI 60

Query: 61  IQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLI 120
           +Q L+ILF+E+PFLLKICPLSDNFIEFIKRFETNG RTLFY  MA+IQWCS+A+  TSLI
Sbjct: 61  VQGLIILFVEIPFLLKICPLSDNFIEFIKRFETNGYRTLFYVVMAVIQWCSIAVQATSLI 120

Query: 121 VVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHEAVVREML 167
           VVA+GLTISA SYAVA +KHQ+FQNT+I+K+PT +DFPHEAVVREML
Sbjct: 121 VVAVGLTISACSYAVALTKHQEFQNTHILKDPTSDDFPHEAVVREML 167

>KLTH0D06864g Chr4 complement(599324..599756,599835..599905) [504
           bp, 167 aa] {ON} highly similar to uniprot|Q04767
           Saccharomyces cerevisiae YMR071C TVP18 Tlg2-Vesicle
           Protein of 18 kDa Integral membrane vesicle protein
          Length = 167

 Score =  290 bits (742), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 153/167 (91%)

Query: 1   MALGIKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSI 60
           MAL IKQFIN+AG+V+DLKSFNFSVYGQWFGYINI LC+ALGIANLFHV+AV+ FG+++I
Sbjct: 1   MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAI 60

Query: 61  IQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLI 120
           +Q LVILF+EVPFLL+ICPLSDNFI FIKRFETNGKRTLFY  MA +QWCSLA+M TSLI
Sbjct: 61  VQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLI 120

Query: 121 VVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHEAVVREML 167
            VAIGLTISAASY VA+ KHQQFQ T++IK+P D+DFPHEAVVREML
Sbjct: 121 AVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVVREML 167

>YMR071C Chr13 complement(410762..411265) [504 bp, 167 aa] {ON}
           TVP18Integral membrane protein localized to late Golgi
           vesicles along with the v-SNARE Tlg2p; may interact with
           ribosomes, based on co-purification experiments
          Length = 167

 Score =  289 bits (740), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 156/167 (93%)

Query: 1   MALGIKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSI 60
           MAL + QFIN+ G+VKDLKSFNFSVYG+WFGYINIILC+ALGIANLFHV+ V+AFG++SI
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 61  IQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLI 120
           IQ LVILFIE+PFLLKICPLSDNFIEFIKRFETNG R LFY AMAIIQ+ S+A+M TSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSDNFIEFIKRFETNGWRCLFYLAMAIIQYISIAVMATSLI 120

Query: 121 VVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHEAVVREML 167
           VVA+GLTIS+ SYAVA++KHQ+FQNTNIIKNPTD+DFPHEAVVREML
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167

>NCAS0F00890 Chr6 (179151..179654) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  289 bits (740), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 153/167 (91%)

Query: 1   MALGIKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSI 60
           MAL IKQFIN AG+ KDLKSFNFSVYG+WFGYINIILC+ALG+ANLFHVNAV+AFG++SI
Sbjct: 1   MALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISI 60

Query: 61  IQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLI 120
           IQ LVILFIE+PFLLKICPLS+NFIEFIKRFETNG R LFY  MAIIQ+CS+ LM TSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLI 120

Query: 121 VVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHEAVVREML 167
           VVAIGLTIS+ SYAVA++ HQ+FQNTNIIKNP D DFPHEAVVREM+
Sbjct: 121 VVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVVREMV 167

>CAGL0K03025g Chr11 complement(283076..283579) [504 bp, 167 aa] {ON}
           highly similar to uniprot|Q04767 Saccharomyces
           cerevisiae YMR071c
          Length = 167

 Score =  286 bits (733), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 154/167 (92%)

Query: 1   MALGIKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSI 60
           MALGI QFINIAG++KDLKSFNFSVYG+WFGYINI LC+ALGIANLFHV+AV+AFG++ I
Sbjct: 1   MALGITQFINIAGLLKDLKSFNFSVYGKWFGYINIFLCIALGIANLFHVSAVIAFGIVGI 60

Query: 61  IQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLI 120
           +Q L+ILFIE+PFLLKICPLSD FIEFIKRFETNG R +FYT MAI+Q+CSLA+MTTSL+
Sbjct: 61  VQGLIILFIEIPFLLKICPLSDRFIEFIKRFETNGYRCIFYTLMAIVQYCSLAVMTTSLL 120

Query: 121 VVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHEAVVREML 167
           V+ I LTISA SY +A++KHQ+F NTNIIKNPTDEDFPH+AVVREML
Sbjct: 121 VLGITLTISAVSYGIAFTKHQEFANTNIIKNPTDEDFPHDAVVREML 167

>NDAI0H01390 Chr8 (338958..339461) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  286 bits (733), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 135/167 (80%), Positives = 153/167 (91%)

Query: 1   MALGIKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSI 60
           MALGI QFINIAGIVKDLKSFNFSVYG+WFGYINIILC+ LGI+NLFHVNAV+AFG++SI
Sbjct: 1   MALGITQFINIAGIVKDLKSFNFSVYGRWFGYINIILCIGLGISNLFHVNAVIAFGIVSI 60

Query: 61  IQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLI 120
           IQ LVILFIE+PFLLKICPLS+ FIEFIKRFETNG R +FY  MAIIQ+CS+ALM TSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSERFIEFIKRFETNGYRCVFYLVMAIIQYCSIALMATSLI 120

Query: 121 VVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHEAVVREML 167
           VVA+GLTIS+ SYA+A++ HQ+FQNT I+KNPTD DFP EAVVREML
Sbjct: 121 VVAVGLTISSISYAIAFTNHQEFQNTQILKNPTDPDFPREAVVREML 167

>Skud_13.227 Chr13 complement(385097..385600) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  286 bits (732), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 133/167 (79%), Positives = 156/167 (93%)

Query: 1   MALGIKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSI 60
           MAL + QFIN+ G+VKDLKSFNFSVYG+WFGYINIILC+ALGIANLFHV+ V+AFG++SI
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 61  IQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLI 120
           IQ LVILFIE+PFLLKICPLSDNF+EFIK+FETNG R +FY AMA+IQ+ S+A+M TSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSDNFVEFIKKFETNGWRCIFYLAMAVIQYVSIAVMATSLI 120

Query: 121 VVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHEAVVREML 167
           VVA+GLTIS+ SYAVA++KHQ+FQNTNIIKNPTD+DFPHEAVVREML
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167

>Suva_13.248 Chr13 complement(392000..392503) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  285 bits (730), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 133/167 (79%), Positives = 155/167 (92%)

Query: 1   MALGIKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSI 60
           MAL + QFIN+ G+VKDLKSFNFSVYG+WFGYINIILC+ALGIANLFHV+ V+AFG++SI
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 61  IQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLI 120
           IQ LVILFIE+PFLLKICPLSDNF+EFIKRFETNG R +FY AMA IQ+ S+A+M TSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSDNFVEFIKRFETNGWRCIFYLAMATIQYISIAVMATSLI 120

Query: 121 VVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHEAVVREML 167
           VVA+GLTIS+ SYAVA++KHQ+FQNTNI+KNPTD+DFPHEAVVREML
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNTNILKNPTDDDFPHEAVVREML 167

>KNAG0C05800 Chr3 (1126605..1127108) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  278 bits (711), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 150/167 (89%)

Query: 1   MALGIKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSI 60
           MAL IKQF N AG++KDL+SFNFSVYG+WFG+INIILC+ALGIANLFHV+ V+AFG++SI
Sbjct: 1   MALSIKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSI 60

Query: 61  IQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLI 120
           +Q L+ILFIE+PFLLKICPLSDNFIEFI RFETNG R +FY AMA+IQ+CS+ LM TSL+
Sbjct: 61  VQGLIILFIEIPFLLKICPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLL 120

Query: 121 VVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHEAVVREML 167
           VVAI LT+SA  YAVA+ KHQ+FQNTNIIKNP D DFPHEAVVREML
Sbjct: 121 VVAICLTVSAVFYAVAFVKHQEFQNTNIIKNPADADFPHEAVVREML 167

>TPHA0G03520 Chr7 complement(751783..752397) [615 bp, 204 aa] {ON}
           Anc_2.534 YMR071C
          Length = 204

 Score =  276 bits (705), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 154/168 (91%), Gaps = 1/168 (0%)

Query: 1   MALGIKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSI 60
           MAL IKQFIN AG++KDLKSFNFSVYGQ+FGYINIILC+ALGIANLFHVNAV+AFG+++I
Sbjct: 37  MALSIKQFINGAGMLKDLKSFNFSVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAI 96

Query: 61  IQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLI 120
           +QSLVILFIE+PFLLKICPLSDNF+ F+K FETNG R LF+T MAI+QWCSL L  TSLI
Sbjct: 97  VQSLVILFIEIPFLLKICPLSDNFVNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLI 156

Query: 121 VVAIGLTISAASYAVAWSKHQQFQNT-NIIKNPTDEDFPHEAVVREML 167
           VVAIGL+ISAA YA+A+ K Q+FQ+T N+IKNPTD+DFPHEAVVREML
Sbjct: 157 VVAIGLSISAAFYAIAFFKKQEFQHTSNVIKNPTDDDFPHEAVVREML 204

>KAFR0A01870 Chr1 complement(389508..390011) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  267 bits (682), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 152/167 (91%)

Query: 1   MALGIKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSI 60
           MAL IKQFIN+AGIVKDLKSFNFSVYG+WFGYINIILC+ALGI+NLFHVNAV+AFG++SI
Sbjct: 1   MALSIKQFINVAGIVKDLKSFNFSVYGRWFGYINIILCIALGISNLFHVNAVIAFGIISI 60

Query: 61  IQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLI 120
           IQ L+ILFIE+PFLLKICPLSDNF+EFIKRFETNG R +FY  MAIIQ+CS+ LM TSLI
Sbjct: 61  IQGLIILFIEIPFLLKICPLSDNFVEFIKRFETNGYRCVFYLVMAIIQYCSIILMATSLI 120

Query: 121 VVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHEAVVREML 167
           VVAI LT+S ASY +A  K Q+FQNTNIIKNPTD DFPHEAVVREML
Sbjct: 121 VVAICLTVSCASYGIAAFKKQEFQNTNIIKNPTDTDFPHEAVVREML 167

>Smik_13.250 Chr13 complement(394856..395359) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  266 bits (680), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 156/167 (93%)

Query: 1   MALGIKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSI 60
           MAL + QFIN+ G+VKDLKSFNFSVYG+WFGYINIILC+ALGIANLFHV+ V+AFG++SI
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 61  IQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLI 120
           IQ L+ILFIE+PFLLKICPLSDNFIEFIK+FETNG R +FY AMAIIQ+ S+A+M TSLI
Sbjct: 61  IQGLIILFIEIPFLLKICPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLI 120

Query: 121 VVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHEAVVREML 167
           VVA+GLTIS+ SYAVA++KHQ+FQNTNIIKNPTD+DFPHEAVVREML
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167

>TBLA0G02240 Chr7 complement(581646..582149) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  266 bits (679), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 125/167 (74%), Positives = 148/167 (88%)

Query: 1   MALGIKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSI 60
           M + +++F+NI GIV+ LKSFNFS+YGQWFGYINI+LC+ALGIANLFHVN V+AFG++SI
Sbjct: 1   MGVALQEFLNINGIVRGLKSFNFSLYGQWFGYINILLCVALGIANLFHVNPVIAFGIVSI 60

Query: 61  IQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLI 120
           IQS +ILF+EVPFLLKICPLSDNFI FIK F+TNG R +FY AMA +QWCS+ L  TSLI
Sbjct: 61  IQSFIILFVEVPFLLKICPLSDNFIAFIKHFQTNGFRCIFYIAMATVQWCSIILKATSLI 120

Query: 121 VVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHEAVVREML 167
           VVAIGLTISA SYAVA+ K+Q+FQN +IIKNPTD+DFP EAVVREML
Sbjct: 121 VVAIGLTISAISYAVAYFKNQEFQNVSIIKNPTDDDFPREAVVREML 167

>AGL072W Chr7 (574009..574512) [504 bp, 167 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR071C (TVP18)
          Length = 167

 Score =  223 bits (568), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 134/167 (80%)

Query: 1   MALGIKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSI 60
           MAL  K F+N+ GI+ DL+SFNFSVYG+WFGYINI+LCLALGIAN+FH + V+AF +++I
Sbjct: 1   MALSWKSFVNVPGILADLRSFNFSVYGRWFGYINILLCLALGIANIFHFSIVIAFAIVAI 60

Query: 61  IQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLI 120
           +Q L+++F+EVP LLKICPLSDNFI  +K+ +TNG+RTL YTA+AI+Q+ SL++  TSL+
Sbjct: 61  VQGLLLIFVEVPILLKICPLSDNFIGLVKKCDTNGRRTLLYTALAIVQYASLSVQVTSLL 120

Query: 121 VVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHEAVVREML 167
            VAIGLTISA  Y   + K Q+F   N+I+NPTD  F  EA VRE+L
Sbjct: 121 AVAIGLTISAIFYGTGYLKKQEFLEGNVIRNPTDPAFMREAAVREVL 167

>Ecym_7254 Chr7 (536391..536894) [504 bp, 167 aa] {ON} similar to
           Ashbya gossypii AGL072W
          Length = 167

 Score =  213 bits (541), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 126/167 (75%)

Query: 1   MALGIKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSI 60
           MA+ +K FIN+ GIV DLKSFNFSVYG+WFGYINIILC+ALGIAN+FH   V+ F +L++
Sbjct: 1   MAVSLKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILAL 60

Query: 61  IQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLI 120
            Q   +LF+EVPFL+KICPLS+ F+  +K F +N KRT+ Y  MA+IQW SL    TSL+
Sbjct: 61  GQGFFLLFVEVPFLVKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLV 120

Query: 121 VVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHEAVVREML 167
           V+AI LT+SA  YA  W   Q+F+ +N+++ P  + FPHEA VREML
Sbjct: 121 VLAICLTVSAIFYASGWLTKQEFKESNVLRGPGSDTFPHEASVREML 167

>ZYRO0B02024g Chr2 complement(163601..164101) [501 bp, 166 aa] {ON}
           similar to uniprot|Q04767 Saccharomyces cerevisiae
           YMR071C TVP18 Tlg2-Vesicle Protein of 18 kDa Integral
           membrane vesicle protein
          Length = 166

 Score =  212 bits (540), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 127/158 (80%), Gaps = 1/158 (0%)

Query: 11  IAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSIIQSLVILFIE 70
           +  +V+ LKS+NFS+YG++  Y+NII C+A GIANLFHVNAV+AFGV+SI+Q  +ILF+E
Sbjct: 9   LGSLVQGLKSYNFSLYGKYVAYLNIIFCIAFGIANLFHVNAVIAFGVISIVQGAIILFLE 68

Query: 71  VPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLIVVAIGLTISA 130
           VPFLL+ICPLSDNFIEF+ RFETNG RT+FY   A++QW SLAL  TSLIVVA+GLTISA
Sbjct: 69  VPFLLRICPLSDNFIEFVSRFETNGWRTIFYIFNAVLQWASLALKITSLIVVAVGLTISA 128

Query: 131 ASYAVAWSKHQQFQNTNIIKNPTDEDFP-HEAVVREML 167
           A Y VA+ KHQ FQN++ IK P  E    +E  VREML
Sbjct: 129 AFYGVAYFKHQNFQNSSHIKEPVGEGVEANEQNVREML 166

>Kpol_348.9 s348 complement(17797..18189) [393 bp, 130 aa] {ON}
           complement(17797..18189) [393 nt, 131 aa]
          Length = 130

 Score =  210 bits (534), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 100/130 (76%), Positives = 119/130 (91%), Gaps = 1/130 (0%)

Query: 39  LALGIANLFHVNAVVAFGVLSIIQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRT 98
           +ALGIANLFHVNAV+AFG+++I+QSL+ILF+EVPFLLKICPLS+NFI FIK FETNG R 
Sbjct: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60

Query: 99  LFYTAMAIIQWCSLALMTTSLIVVAIGLTISAASYAVAWSKHQQFQN-TNIIKNPTDEDF 157
           +FYT MAI+QWCSLALM TSLIVVAI LTISA  YA+A+ K+Q+FQ+ TN+IKNPTD+DF
Sbjct: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120

Query: 158 PHEAVVREML 167
           PH+AVVREML
Sbjct: 121 PHDAVVREML 130

>KLLA0E18525g Chr5 (1647606..1648121) [516 bp, 171 aa] {ON} similar
           to uniprot|Q04767 Saccharomyces cerevisiae YMR071C TVP18
           Tlg2-Vesicle Protein of 18 kDa Integral membrane vesicle
           protein
          Length = 171

 Score =  199 bits (506), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 92/165 (55%), Positives = 125/165 (75%), Gaps = 2/165 (1%)

Query: 5   IKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSIIQSL 64
           +K   N++G+V DLKS NFS+YGQW  Y+NII CLA GIAN+FH +AV+ F +++I+Q L
Sbjct: 7   LKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHFSAVIVFSIIAIVQGL 66

Query: 65  VILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLIVVAI 124
           +ILFIEVPFLLKICPLSDNFI F+ +F+TN +R LFY  M  IQWCS+ + +TSLIVVA+
Sbjct: 67  IILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTSLIVVAV 126

Query: 125 GLTISAASYAVAWSKHQQFQNTNII--KNPTDEDFPHEAVVREML 167
           GL+I+A  YA+  +  Q+F+N+ I+  +        +EAVVR+ML
Sbjct: 127 GLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171

>Kwal_26.8025 s26 complement(615707..615901) [195 bp, 64 aa] {ON}
           YMR071C - Hypothetical ORF [contig 55] FULL
          Length = 64

 Score =  114 bits (285), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 59/64 (92%)

Query: 104 MAIIQWCSLALMTTSLIVVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHEAVV 163
           MA +QWCS+ALM TSLIVVA+GLTISAASY+VA+ KHQQFQ T++IKNP DEDFPHEAVV
Sbjct: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFPHEAVV 60

Query: 164 REML 167
           REML
Sbjct: 61  REML 64

>NDAI0D00370 Chr4 (77608..78444) [837 bp, 278 aa] {ON} Anc_7.492
           YBL049W
          Length = 278

 Score = 35.8 bits (81), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%)

Query: 113 ALMTTSLIVVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDF 157
           +++TTSLI   +    S  SY      H+  QN + + +PTD DF
Sbjct: 74  SVVTTSLIYPHLNHESSTRSYRNGRRNHRNHQNRHTVFSPTDNDF 118

>KNAG0H03860 Chr8 complement(712040..712759) [720 bp, 239 aa] {ON} 
          Length = 239

 Score = 34.7 bits (78), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 18/107 (16%)

Query: 15  VKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSIIQSLVIL------- 67
            +DLK F  S     +G I   L     +ANL   N +V FG LS+     ++       
Sbjct: 123 ARDLKPF--SERENDYGRI-PPLTREAQLANL---NQIVGFGKLSMRPEGTMVETVWRDA 176

Query: 68  ----FIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYT-AMAIIQW 109
                I++P  L    L  ++IE++K+  TN KR    T A A ++W
Sbjct: 177 EAWDTIQMPLELVESHLPAHYIEYLKKHRTNRKRLQDDTIARAQVRW 223

>KNAG0J00990 Chr10 complement(173785..174657) [873 bp, 290 aa] {ON}
           Anc_3.242 YBR040W
          Length = 290

 Score = 29.6 bits (65), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 4/65 (6%)

Query: 24  SVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSIIQSLVILFIEVPFLLKICPLSDN 83
           S  G     +NI+    L   N+ H   ++A  +LSIIQ L ++++ +P +    PL D 
Sbjct: 130 SAAGSTPSTLNILKLAELTSVNVIHPYILMATVILSIIQILTLVYLAIPHI----PLKDV 185

Query: 84  FIEFI 88
            ++F+
Sbjct: 186 IVKFV 190

>ABR227C Chr2 complement(827285..829558) [2274 bp, 757 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR069C
           (MEF1)
          Length = 757

 Score = 29.3 bits (64), Expect = 6.1,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 20/36 (55%)

Query: 125 GLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHE 160
           G+TI +A+   +W K Q+  + N+I  P   DF  E
Sbjct: 121 GITIQSAATYCSWDKDQESYHFNLIDTPGHIDFTIE 156

>Ecym_1525 Chr1 complement(1080846..1083119) [2274 bp, 757 aa] {ON}
           similar to Ashbya gossypii ABR227C
          Length = 757

 Score = 28.9 bits (63), Expect = 8.1,   Method: Composition-based stats.
 Identities = 12/36 (33%), Positives = 22/36 (61%)

Query: 125 GLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHE 160
           G+TI +A+   +W+K+++  + N+I  P   DF  E
Sbjct: 120 GITIQSAATYCSWNKNEESYHFNLIDTPGHIDFTIE 155

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.141    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,495,037
Number of extensions: 598604
Number of successful extensions: 2302
Number of sequences better than 10.0: 30
Number of HSP's gapped: 2336
Number of HSP's successfully gapped: 30
Length of query: 167
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 66
Effective length of database: 41,900,133
Effective search space: 2765408778
Effective search space used: 2765408778
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 61 (28.1 bits)