Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0A09482g2.533ON38838815490.0
KNAG0C058102.533ON5541273453e-35
TDEL0A030702.533ON2391263293e-35
KLTH0D06842g2.533ON5061263373e-34
Ecym_72552.533ON5441543374e-34
AGL071C2.533ON3961283281e-33
KLLA0E18547g2.533ON4311323212e-32
TPHA0G035102.533ON3871363148e-32
Kwal_26.80212.533ON5071263181e-31
Kpol_1018.332.533ON5891253182e-31
CAGL0K03003g2.533ON6471303166e-31
Smik_13.2492.533ON4731313101e-30
ZYRO0B02002g2.533ON2941272992e-30
TBLA0G022302.533ON2161242923e-30
NCAS0F009002.533ON5251513057e-30
YMR070W (MOT3)2.533ON4901403048e-30
Skud_13.2262.533ON4751433002e-29
NDAI0K018602.533ON7301403033e-29
KAFR0A018602.533ON4901242985e-29
NCAS0A048002.533ON5111272978e-29
NDAI0H014002.533ON5411392961e-28
Suva_13.2462.533ON419652588e-24
TBLA0I014802.533ON513592502e-22
KAFR0J003402.533ON2181092162e-19
KNAG0A070402.533ON3521372204e-19
TPHA0C041902.533ON417862083e-17
SAKL0B11330g2.598ON499771659e-12
Suva_11.1642.598ON639731589e-11
CAGL0F05995g2.598ON597551552e-10
CAGL0M13189g2.598ON541551515e-10
Kpol_185.32.598ON647591516e-10
ABR089C2.598ON571551516e-10
Smik_11.1862.598ON641871516e-10
Suva_13.2062.598ON709531516e-10
NCAS0A129102.598ON822581508e-10
Smik_13.2072.598ON703531508e-10
NCAS0H030802.598ON730821509e-10
Kwal_26.83512.598ON698531491e-09
KLLA0F26961g2.598ON694551491e-09
YMR037C (MSN2)2.598ON704531491e-09
Skud_13.1932.598ON704531481e-09
NDAI0B013402.598ON769661482e-09
YKL062W (MSN4)2.598ON630581462e-09
Skud_11.1672.598ON628581462e-09
KLTH0D08734g2.598ON677531462e-09
NDAI0C005602.598ON972551472e-09
Ecym_23012.598ON767551453e-09
ZYRO0F01012g2.598ON584511453e-09
TBLA0G019202.598ON523511435e-09
TDEL0B069102.598ON437661417e-09
KNAG0H005502.598ON620531428e-09
KAFR0A023202.598ON443691409e-09
TPHA0C025802.598ON365511391e-08
Kwal_26.80112.531ON190581332e-08
Kpol_1013.212.598ON494531382e-08
Smik_5.2768.144ON442741382e-08
YER130C8.144ON443741372e-08
TDEL0B046708.144ON312781353e-08
KAFR0F020702.598ON370581363e-08
TPHA0N014602.598ON519491373e-08
KNAG0M023102.598ON660551373e-08
KLLA0C17072g8.144ON474641363e-08
NCAS0C040708.144ON289741334e-08
Kwal_47.172418.144ON403721354e-08
Skud_5.2488.144ON442741346e-08
TBLA0H028302.598ON746511347e-08
KLTH0E06688g8.144ON397641338e-08
NDAI0C06260na 1ON582611348e-08
Suva_5.2518.144ON449741338e-08
Kpol_1031.428.144ON359641329e-08
KNAG0G012808.144ON472641321e-07
KLLA0F20636gsingletonON285821292e-07
SAKL0H24816g8.144ON410641292e-07
Ecym_84038.144ON573641302e-07
ACL057W8.144ON520701302e-07
NDAI0B019308.144ON436641292e-07
Ecym_4128na 2ON312481282e-07
Suva_7.523.518ON400751292e-07
ZYRO0G19140g8.144ON557541283e-07
KLTH0H08800g8.117ON168571224e-07
CAGL0K02145g8.144ON317481264e-07
KAFR0B063608.425ON627951274e-07
Skud_13.614.351ON1253971276e-07
Suva_13.704.351ON777651267e-07
AGR186Cna 2ON287481237e-07
TPHA0D010508.144ON439641257e-07
KAFR0A008001.326ON753521267e-07
TBLA0F003708.144ON687641258e-07
Kpol_541.398.116ON291571238e-07
KAFR0B021608.144ON453871249e-07
YML081W (TDA9)4.351ON1251651251e-06
Smik_13.584.351ON1253651251e-06
KNAG0I020702.162ON572511241e-06
ADL042Wna 3ON281491211e-06
YGL209W (MIG2)3.518ON382751221e-06
KNAG0M003504.351ON1076721242e-06
Kpol_1026.84.80ON412841222e-06
NCAS0B05750singletonON505831222e-06
SAKL0A10582gsingletonON288961202e-06
TPHA0B003804.351ON1310531232e-06
SAKL0F01980g3.518ON385601212e-06
Ecym_62951.326ON663761222e-06
TPHA0B029102.162ON717561222e-06
TBLA0E04210singletonON454501203e-06
KAFR0C003403.298ON394591194e-06
NCAS0B046008.144ON547641204e-06
TBLA0B012802.162ON823561204e-06
CAGL0L03916g2.162ON642651204e-06
Smik_7.543.518ON382791194e-06
KAFR0C031408.117ON370671184e-06
KNAG0D021208.144ON402501194e-06
NCAS0A062504.351ON1341671204e-06
SAKL0H12958g8.425ON1129911204e-06
TDEL0F026904.80ON350741185e-06
CAGL0L05786g8.116ON348511185e-06
KNAG0B067104.351ON1053751195e-06
CAGL0K04631g4.214ON1013661195e-06
Suva_6.1321.326ON878521195e-06
AGR172W8.425ON1057771195e-06
Kpol_505.152.162ON5101141186e-06
TBLA0B061604.351ON1384671196e-06
ZYRO0B14894g4.351ON1119671196e-06
Ecym_8379na 3ON305491166e-06
NDAI0G058001.326ON836601196e-06
KLLA0F01463g1.326ON781521186e-06
Kpol_1001.14.351ON1341601196e-06
Kwal_47.178882.162ON786641186e-06
NCAS0B069602.162ON839571186e-06
Kpol_1052.83.298ON386521176e-06
NDAI0C048608.425ON1350671196e-06
Skud_7.593.518ON383791177e-06
SAKL0G18062g4.351ON1238651187e-06
ZYRO0G20526g1.326ON849521187e-06
KLTH0E09922g8.425ON1119641187e-06
KLTH0E09724g2.162ON768641187e-06
TPHA0C021608.425ON1375621188e-06
KAFR0B025508.234ON890501178e-06
Kwal_23.54007.543ON429961168e-06
TBLA0F013001.326ON985531178e-06
Ecym_8388na 4ON223501138e-06
NCAS0G037302.303ON5711121169e-06
SAKL0E10714g2.162ON819491171e-05
Kwal_47.166214.351ON1178591171e-05
TBLA0G032403.298ON511521161e-05
ADL051Wna 4ON173501111e-05
SAKL0H20394g8.117ON359511151e-05
KAFR0B068104.351ON1155621171e-05
AER159C4.351ON1191651171e-05
SAKL0H20416g8.116ON317501141e-05
KLTH0D18062g4.351ON1128591161e-05
TDEL0D006704.351ON1199531161e-05
TBLA0E042208.234ON519651151e-05
TBLA0E047704.351ON1655721161e-05
NDAI0B042902.162ON1064671161e-05
CAGL0L06072g8.144ON300541131e-05
Smik_4.4638.425ON1324631152e-05
Ecym_54242.162ON775641152e-05
NCAS0B028408.425ON1152711152e-05
NCAS0C042308.117ON338501132e-05
CAGL0H04213g4.351ON1321531152e-05
YDR216W (ADR1)8.425ON1323631152e-05
TPHA0G002707.543ON472521142e-05
ACR264W2.162ON769641142e-05
Suva_2.3838.425ON1319631152e-05
KLTH0G01826g3.518ON307991122e-05
AEL174W1.326ON661531142e-05
TBLA0I020603.298ON833521142e-05
TBLA0I027004.214ON737581142e-05
TDEL0F055008.425ON1207571142e-05
CAGL0E04884g8.425ON1489591142e-05
Skud_4.4788.425ON1323631142e-05
NCAS0F009202.531ON354511122e-05
KLLA0B04477g4.351ON1332651142e-05
KLLA0F13046g8.425ON1379621143e-05
Skud_10.1521.326ON879521133e-05
CAGL0M00594g4.351ON1020661133e-05
NCAS0F00910singletonON350511123e-05
ZYRO0E02684g8.116ON133501053e-05
YJL056C (ZAP1)1.326ON880521133e-05
AEL278W7.543ON476711123e-05
TBLA0A016058.486ON224591093e-05
CAGL0J01595g8.117ON344501113e-05
NDAI0D032404.351ON1362951133e-05
ADR308Cna 5ON278501103e-05
ZYRO0A09416g8.425ON1346571133e-05
KNAG0G011408.117ON519501123e-05
TPHA0A04530singletonON501521123e-05
Skud_16.4907.543ON407351114e-05
YPL230W (USV1)6.256ON391471114e-05
KNAG0C060305.586ON314671104e-05
NCAS0A023104.214ON8791001124e-05
Smik_15.2912.162ON909571124e-05
YOR113W (AZF1)2.162ON914571124e-05
Suva_8.1662.162ON948571124e-05
SAKL0H04070g4.214ON899561124e-05
TDEL0F011708.116ON162501064e-05
Kwal_14.22068.117ON254641094e-05
Skud_15.2762.162ON917571124e-05
NCAS0A018204.80ON455631114e-05
Kpol_529.138.425ON1410621124e-05
NDAI0B019408.116ON336541104e-05
KAFR0A018402.531ON4141221104e-05
KAFR0B045802.162ON729341114e-05
KLLA0A10373gna 6ON206951074e-05
Kwal_27.114602.303ON531551114e-05
Kpol_1050.193.518ON221581085e-05
Smik_10.1841.326ON885821115e-05
TDEL0D058603.518ON330591095e-05
KLLA0A04609gsingletonON423551105e-05
Skud_4.3548.234ON916641115e-05
ZYRO0B07568g4.214ON616621105e-05
Ecym_21596.256ON460471105e-05
Kpol_1050.1097.543ON384551105e-05
Suva_16.766.256ON392471096e-05
KLLA0F23782g2.162ON782631106e-05
NCAS0A152707.543ON433351096e-05
Skud_16.486.256ON398471096e-05
Ecym_8387na 7ON179641056e-05
KAFR0C029808.144ON225691076e-05
Kwal_47.190453.518ON266781086e-05
TPHA0A039103.298ON351521096e-05
KNAG0B005903.518ON439561096e-05
NDAI0B02080singletonON273501086e-05
CAGL0G08107g8.234ON625531106e-05
KNAG0A044608.425ON1290621107e-05
Smik_6.4356.256ON386471097e-05
Ecym_28177.543ON431721097e-05
Kpol_1072.582.162ON794561107e-05
TBLA0B060502.303ON762831107e-05
AFR580C4.214ON838611107e-05
KNAG0G018708.234ON875501107e-05
Ecym_27604.214ON938641107e-05
NDAI0A075403.298ON370521087e-05
KNAG0H034802.162ON796591098e-05
KNAG0D037104.80ON459571088e-05
SAKL0F16170g7.543ON437641088e-05
CAGL0A01628g4.80ON424771089e-05
Smik_5.1513.518ON3881171071e-04
TDEL0B052502.162ON714561081e-04
ZYRO0B11770g8.234ON867501081e-04
TBLA0F038308.234ON967501081e-04
TBLA0I032803.518ON330951071e-04
Smik_16.4507.543ON432331071e-04
KAFR0C057105.586ON442941071e-04
ZYRO0B16148g2.162ON930651081e-04
NDAI0I029003.518ON524591071e-04
Suva_16.3358.116ON317501061e-04
Smik_16.2538.116ON317501061e-04
Skud_5.1373.518ON3941121071e-04
YPR013C8.116ON317501061e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0A09482g
         (388 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...   601   0.0  
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...   137   3e-35
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...   131   3e-35
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...   134   3e-34
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...   134   4e-34
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...   130   1e-33
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...   128   2e-32
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...   125   8e-32
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...   127   1e-31
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...   127   2e-31
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...   126   6e-31
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...   124   1e-30
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...   119   2e-30
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...   117   3e-30
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...   122   7e-30
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...   121   8e-30
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...   120   2e-29
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...   121   3e-29
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...   119   5e-29
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...   119   8e-29
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...   118   1e-28
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...   103   8e-24
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...   100   2e-22
KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}       88   2e-19
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...    89   4e-19
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    85   3e-17
SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {...    68   9e-12
Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062...    65   9e-11
CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {...    64   2e-10
CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa...    63   5e-10
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    63   6e-10
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    63   6e-10
Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062...    63   6e-10
Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {...    63   6e-10
NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa] ...    62   8e-10
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    62   8e-10
NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {O...    62   9e-10
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    62   1e-09
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    62   1e-09
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    62   1e-09
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    62   1e-09
NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598     62   2e-09
YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}  MSN4Trans...    61   2e-09
Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062...    61   2e-09
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    61   2e-09
NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598     61   2e-09
Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar t...    60   3e-09
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    60   3e-09
TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {O...    60   5e-09
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    59   7e-09
KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598...    59   8e-09
KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {O...    59   9e-09
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    58   1e-08
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...    56   2e-08
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    58   2e-08
Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON...    58   2e-08
YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON} P...    57   2e-08
TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.14...    57   3e-08
KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.5...    57   3e-08
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    57   3e-08
KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {...    57   3e-08
KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weak...    57   3e-08
NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144      56   4e-08
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    57   4e-08
Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C ...    56   6e-08
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    56   7e-08
KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly...    56   8e-08
NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON}             56   8e-08
Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON...    56   8e-08
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    55   9e-08
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    55   1e-07
KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa] ...    54   2e-07
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    54   2e-07
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    55   2e-07
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    55   2e-07
NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144     54   2e-07
Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to...    54   2e-07
Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)    54   2e-07
ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]...    54   3e-07
KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some si...    52   4e-07
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    53   4e-07
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    54   4e-07
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    54   6e-07
Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W...    53   7e-07
AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON} ...    52   7e-07
TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {O...    53   7e-07
KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {O...    53   7e-07
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    53   8e-07
Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON...    52   8e-07
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    52   9e-07
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    53   1e-06
Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081...    53   1e-06
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    52   1e-06
ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic hom...    51   1e-06
YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc fin...    52   1e-06
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    52   2e-06
Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa] ...    52   2e-06
NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa] ...    52   2e-06
SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {O...    51   2e-06
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    52   2e-06
SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some s...    51   2e-06
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    52   2e-06
TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {O...    52   2e-06
TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON}             51   3e-06
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    50   4e-06
NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {O...    51   4e-06
TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {O...    51   4e-06
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    51   4e-06
Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)    50   4e-06
KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON}               50   4e-06
KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.1...    50   4e-06
NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]...    51   4e-06
SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa...    51   4e-06
TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.8...    50   5e-06
CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa] ...    50   5e-06
KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]...    50   5e-06
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    50   5e-06
Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C ...    50   5e-06
AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic...    50   5e-06
Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON} (42259..4...    50   6e-06
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    50   6e-06
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    50   6e-06
Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON} ...    49   6e-06
NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa] ...    50   6e-06
KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some s...    50   6e-06
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    50   6e-06
Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113...    50   6e-06
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    50   6e-06
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    50   6e-06
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    50   6e-06
Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W (...    50   7e-06
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    50   7e-06
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    50   7e-06
KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakl...    50   7e-06
KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly...    50   7e-06
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    50   8e-06
KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.2...    50   8e-06
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    49   8e-06
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    50   8e-06
Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON} ...    48   8e-06
NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303     49   9e-06
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    50   1e-05
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    50   1e-05
TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298     49   1e-05
ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No...    47   1e-05
SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weak...    49   1e-05
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    50   1e-05
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    50   1e-05
SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakl...    49   1e-05
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    49   1e-05
TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4....    49   1e-05
TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON} Anc_8...    49   1e-05
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    49   1e-05
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    49   1e-05
CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {...    48   1e-05
Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W...    49   2e-05
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    49   2e-05
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    49   2e-05
NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON}               48   2e-05
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    49   2e-05
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    49   2e-05
TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543...    49   2e-05
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    49   2e-05
Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W...    49   2e-05
KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some si...    48   2e-05
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    49   2e-05
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     49   2e-05
TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {O...    49   2e-05
TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON} Anc_...    49   2e-05
CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa] ...    49   2e-05
Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W...    49   2e-05
NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531     48   2e-05
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    49   2e-05
KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} wea...    49   3e-05
Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056...    48   3e-05
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    48   3e-05
NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON}               48   3e-05
ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly ...    45   3e-05
YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON} ...    48   3e-05
AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic ho...    48   3e-05
TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}                47   3e-05
CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some ...    47   3e-05
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    48   3e-05
ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON} ...    47   3e-05
ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} simil...    48   3e-05
KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {O...    48   3e-05
TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON}             48   3e-05
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    47   4e-05
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    47   4e-05
KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5....    47   4e-05
NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {O...    48   4e-05
Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113...    48   4e-05
YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}  AZF1Zinc-...    48   4e-05
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    48   4e-05
SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some s...    48   4e-05
TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.11...    45   4e-05
Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C ...    47   4e-05
Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113...    48   4e-05
NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80      47   4e-05
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    48   4e-05
NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {O...    47   4e-05
KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {O...    47   4e-05
KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.1...    47   4e-05
KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {O...    46   4e-05
Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {...    47   4e-05
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    46   5e-05
Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {...    47   5e-05
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    47   5e-05
KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {...    47   5e-05
Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W ...    47   5e-05
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    47   5e-05
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    47   5e-05
Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]...    47   5e-05
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    47   6e-05
KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weak...    47   6e-05
NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa] ...    47   6e-05
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    47   6e-05
Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON} ...    45   6e-05
KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.14...    46   6e-05
Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa] ...    46   6e-05
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    47   6e-05
KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518...    47   6e-05
NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON}                46   6e-05
CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly...    47   6e-05
KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {...    47   7e-05
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    47   7e-05
Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {O...    47   7e-05
Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa] ...    47   7e-05
TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON} Anc_2...    47   7e-05
AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}...    47   7e-05
KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.2...    47   7e-05
Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {O...    47   7e-05
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    46   7e-05
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    47   8e-05
KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.8...    46   8e-05
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    46   8e-05
CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} simila...    46   9e-05
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    46   1e-04
TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {O...    46   1e-04
ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} simila...    46   1e-04
TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.2...    46   1e-04
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    46   1e-04
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    46   1e-04
KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON} Anc_5...    46   1e-04
ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weak...    46   1e-04
NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {O...    46   1e-04
Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {O...    45   1e-04
Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {O...    45   1e-04
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    46   1e-04
YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON} P...    45   1e-04
SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {...    46   1e-04
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    46   1e-04
NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.1...    46   1e-04
ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic ho...    46   1e-04
SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]...    46   1e-04
TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {O...    46   1e-04
Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON} si...    45   1e-04
KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.25...    45   1e-04
SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON} unipro...    46   1e-04
TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.2...    46   1e-04
Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {O...    45   1e-04
TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {O...    46   1e-04
KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {...    46   1e-04
TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON...    45   1e-04
KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some ...    45   2e-04
TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {O...    46   2e-04
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    46   2e-04
Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {O...    44   2e-04
NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80      45   2e-04
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    45   2e-04
Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W ...    46   2e-04
KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some s...    45   2e-04
KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {O...    45   2e-04
KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {...    45   2e-04
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    45   2e-04
Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}...    45   2e-04
Skud_10.351 Chr10 complement(617553..621332,621389..621469,62146...    45   2e-04
Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON} (1181...    45   2e-04
YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC d...    45   2e-04
AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON} S...    45   2e-04
KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {O...    45   2e-04
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    44   2e-04
KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some...    45   2e-04
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    44   2e-04
Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W ...    45   2e-04
TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa] ...    45   2e-04
YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}  ...    44   2e-04
Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa] ...    45   2e-04
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      44   2e-04
Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa] ...    45   2e-04
CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} simil...    45   2e-04
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    44   2e-04
ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No...    43   2e-04
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    44   2e-04
YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}...    45   2e-04
Smik_10.420 Chr10 complement(647997..651776,651798..651836,65184...    45   3e-04
Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON} (33422..3...    45   3e-04
TBLA0B04960 Chr2 complement(1167778..1169124) [1347 bp, 448 aa] ...    45   3e-04
KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.5...    45   3e-04
ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {O...    43   3e-04
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    45   3e-04
Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON} (31069..3...    45   3e-04
NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518     45   3e-04
KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON}               45   3e-04
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    43   3e-04
CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} som...    45   3e-04
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    45   3e-04
TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON} Anc_2...    45   3e-04
KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON}               45   3e-04
ZYRO0G09438g Chr7 complement(752797..753786) [990 bp, 329 aa] {O...    44   3e-04
CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some s...    45   3e-04
CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {...    44   3e-04
SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {...    45   3e-04
CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {...    45   3e-04
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    45   3e-04
Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463...    44   4e-04
KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON...    44   4e-04
NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234     45   4e-04
YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}  ...    44   4e-04
KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON...    44   4e-04
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    44   4e-04
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    44   4e-04
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    44   4e-04
KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.8...    44   4e-04
NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON}                44   4e-04
CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {O...    44   4e-04
TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {O...    44   4e-04
Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON...    44   5e-04
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               44   5e-04
NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {...    44   5e-04
KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]...    44   5e-04
AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; N...    44   5e-04
Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 ...    44   5e-04
YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC d...    44   5e-04
NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {O...    44   5e-04
Smik_4.500 Chr4 complement(908879..909460) [582 bp, 193 aa] {ON}...    42   6e-04
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    44   6e-04
KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.25...    44   6e-04
Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W ...    44   6e-04
NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa] ...    44   6e-04
KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {...    44   6e-04
Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C...    44   6e-04
Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...    44   6e-04
NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {O...    44   7e-04
Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}...    44   7e-04
Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W ...    44   7e-04
SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]...    44   7e-04
NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON...    43   8e-04
Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa...    44   8e-04
KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {...    43   8e-04
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    43   8e-04
KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON...    42   8e-04
YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON} P...    44   8e-04
TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {O...    43   8e-04
Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463...    43   8e-04
NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON}                42   8e-04
KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {O...    43   8e-04
Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W (...    43   8e-04
Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {...    44   8e-04
NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON} Anc_1...    43   9e-04
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    43   9e-04
TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4....    43   0.001
Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON...    43   0.001
Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {O...    42   0.001
Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON...    43   0.001
CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa] ...    43   0.001
KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {O...    43   0.001
NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {O...    43   0.001
TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.3...    43   0.001
Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON...    43   0.001
YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}  ...    43   0.001
Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {O...    43   0.001
SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {O...    42   0.001
Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON...    43   0.001
YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}  STP1Tran...    43   0.001
AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No...    42   0.001
KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON...    42   0.001
NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8....    43   0.001
KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.3...    43   0.001
KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.3...    43   0.001
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    42   0.001
KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} simi...    43   0.001
Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar t...    43   0.001
Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON} (65876..6...    43   0.001
KNAG0H03010 Chr8 (560630..562984) [2355 bp, 784 aa] {ON} Anc_8.2...    43   0.001
TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON...    42   0.001
Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}...    42   0.001
Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON...    42   0.001
KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {O...    40   0.001
Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W (...    42   0.001
TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1....    43   0.001
AFL136W Chr6 (178780..180009) [1230 bp, 409 aa] {ON} Syntenic ho...    42   0.002
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    42   0.002
Skud_4.515 Chr4 complement(918500..919063) [564 bp, 187 aa] {ON}...    41   0.002
Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {O...    42   0.002
TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa] ...    42   0.002
TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {...    42   0.002
YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON} P...    42   0.002
Suva_2.419 Chr2 complement(743569..744144) [576 bp, 191 aa] {ON}...    41   0.002
NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {O...    42   0.002
Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa] ...    42   0.002
YDR253C Chr4 complement(963990..964565) [576 bp, 191 aa] {ON}  M...    41   0.002
KAFR0A02380 Chr1 complement(493691..496393) [2703 bp, 900 aa] {O...    42   0.002
YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}  STP2Transc...    42   0.002
NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256     42   0.002
Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON...    42   0.002
Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {O...    41   0.002
KLLA0D11902g Chr4 (1015273..1016142) [870 bp, 289 aa] {ON} some ...    42   0.002
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    42   0.002
Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON} ...    42   0.002
KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some s...    42   0.002
CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some si...    42   0.002
SAKL0H11440g Chr8 (982180..982797) [618 bp, 205 aa] {ON} similar...    41   0.002
KAFR0A07120 Chr1 complement(1435398..1436345) [948 bp, 315 aa] {...    42   0.002
AFR471C Chr6 complement(1287518..1288687) [1170 bp, 389 aa] {ON}...    42   0.002
SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some si...    41   0.003
ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} simi...    42   0.003
TPHA0C01760 Chr3 (402424..402939) [516 bp, 171 aa] {ON} Anc_8.48...    40   0.003
KLTH0E11330g Chr5 complement(1013019..1013618) [600 bp, 199 aa] ...    40   0.003
CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some ...    41   0.003
KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {...    42   0.003
Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463...    42   0.003
KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5....    41   0.003
NCAS0D03910 Chr4 (729305..730255) [951 bp, 316 aa] {ON} Anc_6.256      41   0.003
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    41   0.003
Kwal_34.15946 s34 complement(130149..130988) [840 bp, 279 aa] {O...    41   0.003
ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} simila...    42   0.003
KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {...    41   0.003
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    41   0.003
KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar ...    41   0.003
Ecym_2536 Chr2 complement(1041642..1042364) [723 bp, 240 aa] {ON...    40   0.003
CAGL0L12562g Chr12 complement(1353174..1353845) [672 bp, 223 aa]...    40   0.004
KNAG0I00130 Chr9 (10977..11972) [996 bp, 331 aa] {ON}                  41   0.004
NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON}       38   0.004
SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some ...    40   0.004
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                40   0.004
Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}...    41   0.004
Kpol_1060.35 s1060 (84889..85725) [837 bp, 278 aa] {ON} (84889.....    40   0.004
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    39   0.004
AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if...    40   0.004
Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON} (1146...    41   0.005
TBLA0C01990 Chr3 complement(466321..467190) [870 bp, 289 aa] {ON...    40   0.005
KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some ...    40   0.005
Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to...    40   0.005
KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some s...    41   0.006
KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON} unipro...    40   0.006
Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)    40   0.006
NDAI0J00160 Chr10 (19695..21068) [1374 bp, 457 aa] {ON} Anc_7.543      40   0.007
NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {O...    40   0.008
CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakl...    40   0.008
TBLA0A00350 Chr1 complement(66653..67588) [936 bp, 311 aa] {ON} ...    40   0.008
TPHA0G03750 Chr7 complement(794102..795142) [1041 bp, 346 aa] {O...    40   0.010
KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {O...    40   0.011
TDEL0B01500 Chr2 (265906..266292) [387 bp, 128 aa] {ON} Anc_8.48...    38   0.011
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    39   0.011
NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586     40   0.012
KAFR0H01500 Chr8 (277542..278336) [795 bp, 264 aa] {ON} Anc_8.48...    39   0.012
AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}...    40   0.012
Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {O...    39   0.013
TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.3...    39   0.013
TPHA0E02650 Chr5 (554820..555743) [924 bp, 307 aa] {ON} Anc_6.25...    39   0.014
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    39   0.014
TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.5...    39   0.015
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    39   0.015
CAGL0G10021g Chr7 complement(959154..960338) [1185 bp, 394 aa] {...    39   0.015
NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa] ...    39   0.015
Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar t...    39   0.016
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    39   0.017
Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa] ...    39   0.017
NCAS0B02480 Chr2 (414819..415418) [600 bp, 199 aa] {ON} Anc_8.48...    38   0.018
AGL246W Chr7 (240857..241540) [684 bp, 227 aa] {ON} Syntenic hom...    38   0.018
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    38   0.019
Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 ...    39   0.019
ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic hom...    39   0.019
Kwal_27.11824 s27 complement(959535..960134) [600 bp, 199 aa] {O...    38   0.020
Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027...    39   0.020
Skud_7.13 Chr7 (26414..27304) [891 bp, 296 aa] {ON} YGL254W (REAL)     39   0.020
YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}  CRZ1Trans...    39   0.021
TBLA0A08460 Chr1 (2080390..2082015) [1626 bp, 541 aa] {ON} Anc_4...    39   0.021
SAKL0F00242g Chr6 (16275..17150) [876 bp, 291 aa] {ON} similar t...    39   0.022
Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027...    39   0.023
Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON} (53205....    39   0.023
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    37   0.025
TPHA0F00260 Chr6 (50020..51600) [1581 bp, 526 aa] {ON} Anc_4.21 ...    39   0.025
SAKL0B12672g Chr2 complement(1096894..1097751) [858 bp, 285 aa] ...    38   0.028
NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326     39   0.029
Ecym_6216 Chr6 (406161..407630) [1470 bp, 489 aa] {ON} similar t...    38   0.031
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    37   0.032
Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {...    39   0.032
CAGL0E03762g Chr5 complement(351240..352994) [1755 bp, 584 aa] {...    38   0.033
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      38   0.033
Skud_8.17 Chr8 (39078..40961) [1884 bp, 627 aa] {ON} YHL027W (REAL)    38   0.033
ZYRO0F08162g Chr6 complement(660746..661294) [549 bp, 182 aa] {O...    37   0.034
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    38   0.037
YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}  ...    38   0.038
NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8....    38   0.040
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    37   0.041
TDEL0G01700 Chr7 complement(334394..335848) [1455 bp, 484 aa] {O...    38   0.041
Smik_7.7 Chr7 (16965..17897) [933 bp, 310 aa] {ON} YGL254W (REAL)      37   0.042
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    37   0.047
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    37   0.047
NDAI0E03120 Chr5 (662597..663316) [720 bp, 239 aa] {ON} Anc_8.48...    37   0.047
YGL254W Chr7 (22304..23203) [900 bp, 299 aa] {ON}  FZF1Transcrip...    37   0.049
NCAS0J02140 Chr10 complement(410960..415012) [4053 bp, 1350 aa] ...    38   0.050
TPHA0A01540 Chr1 (306674..308914) [2241 bp, 746 aa] {ON} Anc_8.3...    38   0.051
NDAI0C05210 Chr3 complement(1209022..1209789) [768 bp, 255 aa] {...    37   0.056
YHL027W Chr8 (51111..52988) [1878 bp, 625 aa] {ON}  RIM101Transc...    37   0.058
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    37   0.058
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    37   0.060
CAGL0H07557g Chr8 (738086..739516) [1431 bp, 476 aa] {ON} some s...    37   0.060
Smik_8.14 Chr8 (34679..36568) [1890 bp, 629 aa] {ON} YHL027W (REAL)    37   0.060
Suva_8.24 Chr8 (53077..54972) [1896 bp, 631 aa] {ON} YHL027W (REAL)    37   0.063
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    37   0.064
KLLA0F22319g Chr6 complement(2086613..2087224) [612 bp, 203 aa] ...    36   0.065
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    36   0.066
TDEL0F01030 Chr6 (182054..185287) [3234 bp, 1077 aa] {ON} Anc_8....    37   0.067
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    37   0.068
Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON...    37   0.077
Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON...    37   0.080
Smik_16.197 Chr16 (357835..358350) [516 bp, 171 aa] {ON} YPL038W...    36   0.084
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    37   0.085
YPL038W Chr16 (480535..481068) [534 bp, 177 aa] {ON}  MET31Zinc-...    36   0.092
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    37   0.097
AFR190C Chr6 complement(783107..784405) [1299 bp, 432 aa] {ON} S...    37   0.099
TPHA0L01320 Chr12 complement(275431..275937) [507 bp, 168 aa] {O...    35   0.10 
CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some s...    37   0.10 
NCAS0E00170 Chr5 (20556..21539) [984 bp, 327 aa] {ON}                  36   0.11 
TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.3...    37   0.11 
ZYRO0D00902g Chr4 (68162..69379) [1218 bp, 405 aa] {ON} similar ...    36   0.11 
KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]...    37   0.11 
Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {...    37   0.12 
KNAG0F03980 Chr6 complement(754914..756041) [1128 bp, 375 aa] {O...    36   0.12 
ZYRO0G07964g Chr7 (645949..647400) [1452 bp, 483 aa] {ON} weakly...    36   0.13 
Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON...    36   0.13 
SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} simi...    36   0.17 
Suva_16.278 Chr16 (483789..484316) [528 bp, 175 aa] {ON} YPL038W...    35   0.17 
CAGL0L00583g Chr12 (71544..72710) [1167 bp, 388 aa] {ON} similar...    36   0.18 
KNAG0A02260 Chr1 (205510..206118) [609 bp, 202 aa] {ON} Anc_8.48...    35   0.18 
KNAG0J02850 Chr10 complement(545071..546573) [1503 bp, 500 aa] {...    36   0.19 
Skud_16.243 Chr16 (445581..446114) [534 bp, 177 aa] {ON} YPL038W...    35   0.20 
KLLA0E00793g Chr5 (80516..82069) [1554 bp, 517 aa] {ON} weakly s...    36   0.20 
NDAI0H00300 Chr8 (52362..54269) [1908 bp, 635 aa] {ON}                 36   0.20 
ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {...    36   0.20 
SAKL0H25674g Chr8 complement(2249157..2250503) [1347 bp, 448 aa]...    35   0.21 
Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {...    36   0.22 
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    35   0.23 
NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326     35   0.23 
YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON} ...    35   0.23 
KLTH0E05962g Chr5 (539474..540739) [1266 bp, 421 aa] {ON} weakly...    35   0.23 
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    35   0.24 
TDEL0H00280 Chr8 (38901..40175) [1275 bp, 424 aa] {ON} Anc_7.543...    35   0.25 
KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8....    35   0.29 
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    35   0.34 
CAGL0I02838g Chr9 complement(248704..250671) [1968 bp, 655 aa] {...    35   0.34 
NCAS0C05820 Chr3 complement(1197669..1199426) [1758 bp, 585 aa] ...    35   0.34 
SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some s...    35   0.34 
NCAS0C02430 Chr3 (453975..454574) [600 bp, 199 aa] {ON} Anc_8.486      34   0.35 
NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {O...    35   0.36 
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    35   0.36 
KLTH0G05104g Chr7 (412304..413920) [1617 bp, 538 aa] {ON} simila...    35   0.38 
KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.3...    35   0.41 
TPHA0B02390 Chr2 complement(547109..548149) [1041 bp, 346 aa] {O...    34   0.44 
Kwal_47.18337 s47 complement(787992..789602) [1611 bp, 536 aa] {...    35   0.45 
KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa] ...    35   0.46 
Kpol_388.8 s388 (25278..26939) [1662 bp, 553 aa] {ON} (25278..26...    35   0.48 
CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {...    34   0.52 
KLLA0E13487g Chr5 complement(1190615..1191307) [693 bp, 230 aa] ...    33   0.59 
Suva_13.247 Chr13 (391743..391805) [63 bp, 21 aa] {OFF} YMR070W ...    30   0.60 
Suva_1.89 Chr1 complement(157170..157334) [165 bp, 55 aa] {ON} Y...    31   0.71 
NDAI0J00990 Chr10 (226704..228863) [2160 bp, 719 aa] {ON} Anc_8....    34   0.72 
YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}  N...    33   0.81 
NCAS0J01300 Chr10 (225659..226966) [1308 bp, 435 aa] {ON} Anc_4....    33   0.90 
KNAG0A04030 Chr1 (542889..543515) [627 bp, 208 aa] {ON} Anc_8.48...    33   0.92 
KAFR0I01440 Chr9 complement(300092..301702) [1611 bp, 536 aa] {O...    33   0.96 
NCAS0B04020 Chr2 complement(726291..727118) [828 bp, 275 aa] {ON}      33   0.96 
Kwal_55.20634 s55 (498959..500218) [1260 bp, 419 aa] {ON} YHL027...    33   0.98 
NDAI0I03330 Chr9 complement(781013..782065) [1053 bp, 350 aa] {O...    33   1.1  
Kpol_1031.73 s1031 complement(186968..187513) [546 bp, 181 aa] {...    32   1.2  
CAGL0M04323g Chr13 complement(474158..476269) [2112 bp, 703 aa] ...    33   1.2  
KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weak...    33   1.3  
KAFR0J02980 Chr10 complement(567857..568816) [960 bp, 319 aa] {O...    33   1.3  
KLLA0F07073g Chr6 (675221..676897) [1677 bp, 558 aa] {ON} some s...    33   1.5  
TBLA0D02300 Chr4 (581398..584553) [3156 bp, 1051 aa] {ON} Anc_8....    33   1.7  
Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}...    32   2.0  
Kwal_27.10167 s27 (225940..226797) [858 bp, 285 aa] {ON} YGL254W...    32   2.1  
NDAI0J02060 Chr10 (505150..506619) [1470 bp, 489 aa] {ON} Anc_4....    32   2.1  
Kwal_56.23925 s56 complement(779625..781862) [2238 bp, 745 aa] {...    32   2.2  
CAGL0K02343g Chr11 (209474..212962) [3489 bp, 1162 aa] {ON} simi...    33   2.2  
Kwal_33.14227 s33 complement(577899..579554) [1656 bp, 551 aa] {...    32   2.4  
KLTH0E03124g Chr5 complement(280411..283056) [2646 bp, 881 aa] {...    32   2.7  
Suva_7.7 Chr7 (16721..17614) [894 bp, 297 aa] {ON} YGL254W (REAL)      32   2.8  
TBLA0H01260 Chr8 (283947..285665) [1719 bp, 572 aa] {ON} Anc_8.3...    32   3.3  
TBLA0I02770 Chr9 (650889..652730) [1842 bp, 613 aa] {ON} Anc_4.2...    32   3.3  
SAKL0H24464g Chr8 complement(2118553..2121405) [2853 bp, 950 aa]...    32   4.0  
YPR022C Chr16 complement(603911..607312) [3402 bp, 1133 aa] {ON}...    32   4.1  
Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}...    31   4.2  
AGL197W Chr7 (325717..328251) [2535 bp, 844 aa] {ON} Syntenic ho...    32   4.3  
KLTH0F06710g Chr6 complement(585209..586648) [1440 bp, 479 aa] {...    31   4.9  
Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}...    31   4.9  
Kpol_344.4 s344 complement(5351..7621) [2271 bp, 756 aa] {ON} co...    31   5.2  
Suva_16.349 Chr16 complement(610937..612562) [1626 bp, 541 aa] {...    31   5.3  
Smik_16.263 Chr16 complement(479612..482980) [3369 bp, 1122 aa] ...    31   5.4  
KAFR0H02240 Chr8 (426388..428259) [1872 bp, 623 aa] {ON} Anc_8.3...    31   5.6  
Skud_16.307 Chr16 complement(568219..570672,570703..571623) [337...    31   5.9  
KAFR0B02050 Chr2 complement(402767..405958) [3192 bp, 1063 aa] {...    31   6.8  
TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {O...    31   6.9  
NCAS0B04360 Chr2 (791449..792276) [828 bp, 275 aa] {ON}                30   8.4  
AFR588W Chr6 (1496952..1497911) [960 bp, 319 aa] {ON} Syntenic h...    30   9.1  
Kpol_472.3 s472 complement(4365..5300) [936 bp, 311 aa] {ON} com...    30   9.5  
Kwal_23.4156 s23 complement(597084..599204) [2121 bp, 706 aa] {O...    30   10.0 

>SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 388

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/388 (78%), Positives = 303/388 (78%)

Query: 1   MLSVQKRTQVPVDHHLEMDFNAQHVFAKHENELLESDIHRQARXXXXXXXXXXXXXSATX 60
           MLSVQKRTQVPVDHHLEMDFNAQHVFAKHENELLESDIHRQAR             SAT 
Sbjct: 1   MLSVQKRTQVPVDHHLEMDFNAQHVFAKHENELLESDIHRQARYQQQLNQYNTQYLSATQ 60

Query: 61  XXXXXXXXXXXGIAISNYRNPYYDHNDWNAQQRFVKSAGTEXXXXXXXXXXXXXXXXXXX 120
                      GIAISNYRNPYYDHNDWNAQQRFVKSAGTE                   
Sbjct: 61  PQFVFSQVQPQGIAISNYRNPYYDHNDWNAQQRFVKSAGTENSVGNSTFNNSGSSSGSSI 120

Query: 121 XXXXXXXXXXXXXXXXPVGNVPSGIPSQAWNKAPALYAPFPWNVNSAPPIXXXXXXXXXX 180
                           PVGNVPSGIPSQAWNKAPALYAPFPWNVNSAPPI          
Sbjct: 121 GSSISSSISSNGSIGNPVGNVPSGIPSQAWNKAPALYAPFPWNVNSAPPIPQQQQQQQKQ 180

Query: 181 XXXXXXXXXXXXXXXSYQEWNRGVFSNPEYPLSVYPVDSRGYSDPPHITSQHVASHQRPP 240
                          SYQEWNRGVFSNPEYPLSVYPVDSRGYSDPPHITSQHVASHQRPP
Sbjct: 181 QQNPQQQKQQQNPQPSYQEWNRGVFSNPEYPLSVYPVDSRGYSDPPHITSQHVASHQRPP 240

Query: 241 AAVQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDN 300
           AAVQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDN
Sbjct: 241 AAVQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDN 300

Query: 301 LLQHMKLKHTPQVLQELQSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMTSIK 360
           LLQHMKLKHTPQVLQELQSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMTSIK
Sbjct: 301 LLQHMKLKHTPQVLQELQSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMTSIK 360

Query: 361 TMIDDGTLNKDDVKRVLNMLINRSGMSM 388
           TMIDDGTLNKDDVKRVLNMLINRSGMSM
Sbjct: 361 TMIDDGTLNKDDVKRVLNMLINRSGMSM 388

>KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa]
           {ON} Anc_2.533 YMR070W
          Length = 554

 Score =  137 bits (345), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 71/127 (55%), Positives = 87/127 (68%), Gaps = 9/127 (7%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317
           H+CHLC+KSFKR+SWLKRHLLSHS+ + + CPWC SRHKRKDNLLQHMKLKH+  +L EL
Sbjct: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDEL 495

Query: 318 QSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMTSIKTMIDDGTLNKDDVKRVL 377
           ++A V          N  +  GQN   S+ P        +SIK ++  G LNKDDVKRVL
Sbjct: 496 KNANVS--------FNWGTYDGQNSTDSM-PKTLSGYPDSSIKKLLYRGILNKDDVKRVL 546

Query: 378 NMLINRS 384
           N +I RS
Sbjct: 547 NKIIERS 553

>TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.533
           YMR070W
          Length = 239

 Score =  131 bits (329), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 68/126 (53%), Positives = 84/126 (66%), Gaps = 25/126 (19%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317
           H+CHLC+KSFKRKSWL+RHLLSHS  + F+CPWC S+HKRKDNLLQHMKLKHT  VLQEL
Sbjct: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQEL 193

Query: 318 QSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMTSIKTMIDDGTLNKDDVKRVL 377
           +   V+            ST G              S   +I+T++ +G LNKD+VK+VL
Sbjct: 194 RLNNVY-----------VSTEG--------------SCKNNIRTLLYEGRLNKDEVKKVL 228

Query: 378 NMLINR 383
           N LI+R
Sbjct: 229 NSLIDR 234

>KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 506

 Score =  134 bits (337), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 83/126 (65%), Gaps = 15/126 (11%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317
           ++C +C+KSFKRKSW +RHLLSHSS KP+NCPWCQSRHKR+DNL QHMK KH  QVLQEL
Sbjct: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQEL 447

Query: 318 QSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMTSIKTMIDDGTLNKDDVKRVL 377
             AG           +L  + G N   ++     DM    SI+T++ DG + K+ VK VL
Sbjct: 448 MEAG-----------DLDGSMGTNVRLAI----DDMVAGPSIRTLVQDGRVKKERVKTVL 492

Query: 378 NMLINR 383
           N +I R
Sbjct: 493 NAVIAR 498

>Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}
           similar to Ashbya gossypii AGL071C
          Length = 544

 Score =  134 bits (337), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 94/154 (61%), Gaps = 19/154 (12%)

Query: 243 VQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLL 302
           V   Q  +P   EN H+CH C+K+FKRKSWLKRHLLSHS++KP++CPWC SRHKRKDNL 
Sbjct: 271 VTSSQLMDPNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLS 330

Query: 303 QHMKLKHTPQVLQELQSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMT----- 357
           QH+KLKH   +L+ L S   +P  ++  +  L S  G NG  ++     D S        
Sbjct: 331 QHLKLKHAEMLLERLSS---NPNTASHLMNRLHS--GANGAVAVTAASADSSATMVSSSS 385

Query: 358 ---------SIKTMIDDGTLNKDDVKRVLNMLIN 382
                    SIK MID G L+K++VK+ LN LIN
Sbjct: 386 SSAAGPTTFSIKDMIDSGMLSKNEVKKTLNSLIN 419

>AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR070W
           (MOT3)
          Length = 396

 Score =  130 bits (328), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 66/128 (51%), Positives = 84/128 (65%), Gaps = 6/128 (4%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVL 314
           EN H+CH C+K+FKRKSWLKRHLLSHS++KP++CPWC SRHKRKDNL QH+KLKH   +L
Sbjct: 182 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLL 241

Query: 315 QELQSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMTSIKTMIDDGTLNKDDVK 374
           + L S    P     +LIN   ++  +                SIK MID G L+K++VK
Sbjct: 242 ERLSSNPNTP----TSLINRLHSS--DAAAGSAAAAAGTPAAFSIKDMIDSGMLSKNEVK 295

Query: 375 RVLNMLIN 382
           + LN LIN
Sbjct: 296 KTLNSLIN 303

>KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]
           {ON} some similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 431

 Score =  128 bits (321), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 63/132 (47%), Positives = 89/132 (67%), Gaps = 3/132 (2%)

Query: 251 PADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHT 310
           P +  + +QCHLC+K F+RKSWLKRHLLSHS++K F+CPWC S HKRKDNLLQH+KLKHT
Sbjct: 299 PHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHT 358

Query: 311 PQVLQELQSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMTSIKTMIDDGTLNK 370
             +L E    G+   V+N +  N A+    +   ++  ++ + S  T+I+ M+D   L K
Sbjct: 359 QYLLHEFTLFGILMNVNNGS-GNTANLVTTSTGETICLINNEPS--TTIRDMLDSNALPK 415

Query: 371 DDVKRVLNMLIN 382
           D VKR LN +++
Sbjct: 416 DQVKRCLNYIVD 427

>TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.533
           YMR070W
          Length = 387

 Score =  125 bits (314), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 66/136 (48%), Positives = 87/136 (63%), Gaps = 17/136 (12%)

Query: 259 QCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQELQ 318
           +C++C K FKRKSWLKRHLLSHSS + ++CPWC S+HKRKDNLLQHMKLKH  QVLQE+ 
Sbjct: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQEMD 314

Query: 319 SAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMM-----------TSIKTMIDDGT 367
                   S++ L + +ST      P  +     +SM+            SI  M+D+GT
Sbjct: 315 KLS----ESSLELNDESSTGTDTASP--IVNETALSMLNDDSGSSSNDNVSIIAMVDNGT 368

Query: 368 LNKDDVKRVLNMLINR 383
           L K++VK+VLN +I R
Sbjct: 369 LKKENVKKVLNSIIER 384

>Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W
           (MOT3) - 2 Cys2-His2 zinc fingers at c-terminus,
           glutamine and asparagine rich [contig 55] FULL
          Length = 507

 Score =  127 bits (318), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 80/126 (63%), Gaps = 15/126 (11%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317
           ++C +CDKSFKR+SW KRHLLSHSS KP++CPWCQSRHKR+DNL QHMK KH   V+QEL
Sbjct: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448

Query: 318 QSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMTSIKTMIDDGTLNKDDVKRVL 377
              G    V    +  +  T+ ++            +   SIKT+I DG + K+ VK VL
Sbjct: 449 LEVG---DVDGSVMSGMQVTSDES------------APEPSIKTLIQDGQVKKERVKAVL 493

Query: 378 NMLINR 383
           N +I R
Sbjct: 494 NAVIAR 499

>Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {ON}
           complement(96025..97794) [1770 nt, 590 aa]
          Length = 589

 Score =  127 bits (318), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 85/125 (68%), Gaps = 19/125 (15%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317
           H CH+C K FKRKSWL+RHLLSHSS + F+CPWC S+HKRKDNLLQHMKLKH   VL++L
Sbjct: 477 HVCHICGKQFKRKSWLQRHLLSHSSERNFDCPWCLSKHKRKDNLLQHMKLKHAENVLEQL 536

Query: 318 QSAGVHPIVSNITLINL-ASTAGQNGVPSLVPVHGDMSMMTSIKTMIDDGTLNKDDVKRV 376
           +             INL A+    N  P+L   +GD     +I+T++ +G LNKD+VK++
Sbjct: 537 R-------------INLKANNPNDNSEPTL-EGNGDH----NIRTLMGEGILNKDEVKKL 578

Query: 377 LNMLI 381
           LN L+
Sbjct: 579 LNSLV 583

>CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakly
           similar to uniprot|P54785 Saccharomyces cerevisiae
           YMR070w MOT3
          Length = 647

 Score =  126 bits (316), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 82/130 (63%), Gaps = 20/130 (15%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQE 316
           PH+CHLC K FKRKSWLKRHLLSHS  + F CPWC SRHKR+DNLLQHMKLKH P +LQE
Sbjct: 533 PHRCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPWCNSRHKRRDNLLQHMKLKHVPNLLQE 592

Query: 317 LQSAGVH---PIVSNITLINLASTAGQNGVPSLVPVHGDMSMMTSIKTMIDDGTLNKDDV 373
           + S  +    PI+  ++                  + G +      KT+I +G LNKD++
Sbjct: 593 INSRNMRFNWPILERLS----------------KQIDGTIE-YPDTKTLIHEGLLNKDEL 635

Query: 374 KRVLNMLINR 383
           K +LN +I++
Sbjct: 636 KNILNTVIDK 645

>Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 aa]
           {ON} YMR070W (REAL)
          Length = 473

 Score =  124 bits (310), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 73/131 (55%), Positives = 87/131 (66%), Gaps = 7/131 (5%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317
           HQC  C+KSFKRKSWLKRHLLSHS  + F CPWC SR KRKDNLLQHMKLKHT  +L EL
Sbjct: 338 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 397

Query: 318 QSAGV------HPIVSNITLINLASTAGQNGVPSLVPVHGD-MSMMTSIKTMIDDGTLNK 370
           +   +        I SN +  N +++    G  +  P + D  S   +IKT+I+DG LNK
Sbjct: 398 KKNNIIFNYNNSSINSNNSNNNNSASGSGGGSAAAAPENEDGNSYDPNIKTLINDGVLNK 457

Query: 371 DDVKRVLNMLI 381
           DDVKRVLN LI
Sbjct: 458 DDVKRVLNNLI 468

>ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 294

 Score =  119 bits (299), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 63/127 (49%), Positives = 79/127 (62%), Gaps = 30/127 (23%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317
           H C +CDKSFKRKSWL+RHLLSHS  + F CPWC S+HKRKDNLLQHMKLKHT  VL++L
Sbjct: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKL 251

Query: 318 --QSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMTSIKTMIDDGTLNKDDVKR 375
             Q+ G+   V N                             +I+T++ +G LNK+DVK+
Sbjct: 252 RNQNVGIDGEVRN----------------------------DNIRTLLCEGRLNKEDVKK 283

Query: 376 VLNMLIN 382
           VLN LI+
Sbjct: 284 VLNGLID 290

>TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.533
           YMR070W
          Length = 216

 Score =  117 bits (292), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 59/124 (47%), Positives = 79/124 (63%), Gaps = 22/124 (17%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317
           H+C  C+K FKRKSWLKRH+LSHS  + ++CPWC SRHKRKDNLLQHMKLKHT +VL++L
Sbjct: 113 HKCPQCEKRFKRKSWLKRHMLSHSEERQYSCPWCISRHKRKDNLLQHMKLKHTDEVLKKL 172

Query: 318 QSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMTSIKTMIDDGTLNKDDVKRVL 377
           +                    G +G         +M    +I+TM+ +G L+KD+VK+VL
Sbjct: 173 KMT--------------CYLEGDDGE--------EMMNRDNIRTMLYEGLLDKDEVKKVL 210

Query: 378 NMLI 381
           N L+
Sbjct: 211 NELL 214

>NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {ON}
           Anc_2.533
          Length = 525

 Score =  122 bits (305), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 66/151 (43%), Positives = 93/151 (61%), Gaps = 12/151 (7%)

Query: 243 VQPHQGQNPADPENP-HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNL 301
           V P   +   D EN  + CH+C K+FKR+SWLKRHLLSHSS + + CPWC SRHKR+DNL
Sbjct: 372 VTPSPPRGTFDSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNL 431

Query: 302 LQHMKLKHTPQVLQELQSAGV----HPIVSNITLINLASTAGQNGVPSLVPVHG-----D 352
           LQHMKLKH+  ++ EL+   V    H       +        Q G+P    +HG     +
Sbjct: 432 LQHMKLKHSKNLINELKFRNVIFDWHNYHYQQQVQRHQQYQQQGGMPPQ--IHGANEPFN 489

Query: 353 MSMMTSIKTMIDDGTLNKDDVKRVLNMLINR 383
           ++   +I+T++ +G +NK+DVKRVLN L++ 
Sbjct: 490 INSEFTIRTLVTNGVVNKEDVKRVLNQLVDE 520

>YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}
           MOT3Transcriptional repressor and activator with two
           C2-H2 zinc fingers; involved in repression of a subset
           of hypoxic genes by Rox1p, repression of several DAN/TIR
           genes during aerobic growth, and repression of
           ergosterol biosynthetic genes in response to
           hyperosmotic stress; contributes to recruitment of the
           Tup1p-Cyc8p general repressor to promoters; involved in
           positive transcriptional regulation of CWP2 and other
           genes; can form the [MOT3+] prion
          Length = 490

 Score =  121 bits (304), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 71/140 (50%), Positives = 86/140 (61%), Gaps = 16/140 (11%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317
           HQC  C+KSFKRKSWLKRHLLSHS  + F CPWC SR KRKDNLLQHMKLKHT  +L EL
Sbjct: 346 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 405

Query: 318 QSAGV---------------HPIVSNITLINLASTAGQNGVPSLVPVHGDMSMM-TSIKT 361
           +   +               +   +N    + +  AG     +  P + D +   T+IKT
Sbjct: 406 KKNNIIFNYNNSSSSNNNNDNNNNNNSNSASGSGGAGAAAAAATAPENEDGNGYDTNIKT 465

Query: 362 MIDDGTLNKDDVKRVLNMLI 381
           +I+DG LNKDDVKRVLN LI
Sbjct: 466 LINDGVLNKDDVKRVLNNLI 485

>Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)
           [1428 bp, 475 aa] {ON} YMR070W (REAL)
          Length = 475

 Score =  120 bits (300), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 70/143 (48%), Positives = 80/143 (55%), Gaps = 19/143 (13%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317
           HQC  C+KSFKRKSWLKRHLLSHS  + F CPWC SR KRKDNLLQHMKLKHT  +L EL
Sbjct: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 387

Query: 318 QSAGV------------------HPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMT-S 358
           +   +                      S           G     +  P + D S    +
Sbjct: 388 KKNNIIFNYNKTSTNSNDNNNSTSTRTSASASSGGGGGGGGGAAAAAAPENEDGSSYDPN 447

Query: 359 IKTMIDDGTLNKDDVKRVLNMLI 381
           IKT+I+DG LNKDDVKRVLN LI
Sbjct: 448 IKTLINDGVLNKDDVKRVLNNLI 470

>NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {ON}
           Anc_2.533
          Length = 730

 Score =  121 bits (303), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 64/140 (45%), Positives = 85/140 (60%), Gaps = 23/140 (16%)

Query: 259 QCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQELQ 318
           QC  C KSFKR SWLKRHLL+HS  + ++CPWC S+HKRKDNLLQH+KLKHT  VLQ+L+
Sbjct: 561 QCSYCVKSFKRFSWLKRHLLAHSPERHYSCPWCLSKHKRKDNLLQHLKLKHTEMVLQQLR 620

Query: 319 SAGVHPIVSNITLINLAST----------------AGQNGVPSLVPVHGDMSMMTSIKTM 362
                  + NI +  +  T                 G +GV   + +       T+IKT+
Sbjct: 621 -------LENIEISTIEETMEDRRVDVHERSKSVDTGTSGVNDDIDIKNVKQPGTNIKTL 673

Query: 363 IDDGTLNKDDVKRVLNMLIN 382
           + DG LNK+DVK+VLN L++
Sbjct: 674 LYDGRLNKEDVKKVLNKLLD 693

>KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.533
           YMR070W
          Length = 490

 Score =  119 bits (298), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 78/124 (62%), Gaps = 18/124 (14%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317
           H CHLC+KSF+RKSWLKRHLLSHS+ + F CPWC SRHKRKDNLLQHMKLKH+  ++ EL
Sbjct: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIEL 412

Query: 318 QSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMTSIKTMIDDGTLNKDDVKRVL 377
           +              N A  +  NG          ++    I+ +I  G +NKDDVK+V+
Sbjct: 413 KK-------------NNAVFSCVNG-----GNREKLNDTDDIRNLISLGVINKDDVKKVI 454

Query: 378 NMLI 381
           N LI
Sbjct: 455 NKLI 458

>NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {ON}
           Anc_2.533
          Length = 511

 Score =  119 bits (297), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 62/127 (48%), Positives = 84/127 (66%), Gaps = 16/127 (12%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317
           +QCH+C KSF+R SWLKRHLL+HSS + ++CP C S+HKRKDNLLQH+KLKHT  VL++L
Sbjct: 387 YQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCPKCVSKHKRKDNLLQHLKLKHTAFVLEQL 446

Query: 318 QSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMTSIKTMIDDGTLNKDDVKRVL 377
           +   +         I  A   G+          G  S  T+IKT++ +G LNK+DVK+VL
Sbjct: 447 RQDNID--------IKTAKDEGEED-------QGTAS-NTNIKTLLVEGRLNKEDVKKVL 490

Query: 378 NMLINRS 384
           N LI+ +
Sbjct: 491 NRLIDSA 497

>NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {ON}
           Anc_2.533
          Length = 541

 Score =  118 bits (296), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 61/139 (43%), Positives = 89/139 (64%), Gaps = 13/139 (9%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317
           ++C +C+K FKR+SWLKRHLLSHSS + + CPWC SRHKR+DNLLQHMKLKH   ++ EL
Sbjct: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459

Query: 318 Q------SAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMT-------SIKTMID 364
           +      S      V+ +T    +  +  +G+ + V    D ++ T       +IK +I 
Sbjct: 460 KLRNFISSQTAAASVAFVTSAAPSIMSINDGMNNTVAGTVDNAVSTPGYETGITIKDLIS 519

Query: 365 DGTLNKDDVKRVLNMLINR 383
           +G +NK+DVKR+LN+LI+ 
Sbjct: 520 EGLINKEDVKRLLNILIDE 538

>Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070W
           (REAL)
          Length = 419

 Score =  103 bits (258), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 46/65 (70%), Positives = 51/65 (78%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317
           HQC  C+KSFKRKSWLKRHLLSHS  + F CPWC SR KRKDNLLQHMKLKHT  +L EL
Sbjct: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 386

Query: 318 QSAGV 322
           +   +
Sbjct: 387 KKNNI 391

>TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.533
           YMR070W
          Length = 513

 Score =  100 bits (250), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%)

Query: 259 QCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317
           QCHLC+KSFKRKSWLKRHLLSHS  + F+CP C S+HKRKDNL+QH+KLKH   +L++L
Sbjct: 341 QCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKHLDYILKKL 399

>KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON} 
          Length = 218

 Score = 87.8 bits (216), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 68/109 (62%), Gaps = 1/109 (0%)

Query: 211 PLSVYPVDSRGYSDPPHITSQHVASHQRPPAAVQPHQGQNPADPENPHQCHLCDKSFKRK 270
           P+  Y V S   + P  I      S  R   A    +G+N  +  + ++C++C+K F+R+
Sbjct: 73  PMQGYFVSSNNITGPI-IDYNRRESEPRCMYAYVKEEGKNEDEVTSVYRCNVCNKIFQRE 131

Query: 271 SWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQELQS 319
           +WL+RH LSH++ + F CPWC+S+HKR+DNL +H+KLKH   +++ ++ 
Sbjct: 132 AWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAIRE 180

>KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON}
           Anc_2.533 YMR070W
          Length = 352

 Score = 89.4 bits (220), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 72/137 (52%), Gaps = 29/137 (21%)

Query: 247 QGQNPADPE-NPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHM 305
           +G+ P  P    + C  C KSF+R +WLKRH ++H++  PF C WC+S HKR+DN+ +HM
Sbjct: 238 KGRTPKPPTMTSYPCPQCPKSFQRSAWLKRHSITHTNSHPFKCVWCKSEHKRRDNMFKHM 297

Query: 306 KLKHTPQVLQELQSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMTSIKTMIDD 365
           KLKH                      +NL     +N  P L    G       +K ++ D
Sbjct: 298 KLKH----------------------MNLLMKVIRNYYP-LAEFEGK-----DLKGLLAD 329

Query: 366 GTLNKDDVKRVLNMLIN 382
           G L+K+DVKRVL  ++N
Sbjct: 330 GRLHKEDVKRVLVDIVN 346

>TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.533
           YMR070W
          Length = 417

 Score = 84.7 bits (208), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 55/86 (63%), Gaps = 3/86 (3%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKH---TPQVL 314
           ++C +C K+FKR SWLKRH  SHS +K F+C WC  ++KRKDNL+QH++ KH   T +  
Sbjct: 324 YECKVCHKTFKRNSWLKRHFFSHSKLKNFSCNWCSGKYKRKDNLVQHIRKKHRDKTNKEP 383

Query: 315 QELQSAGVHPIVSNITLINLASTAGQ 340
            EL++    P+V+  +   L  T  Q
Sbjct: 384 NELENKSDEPVVNVTSTPGLIDTDSQ 409

>SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 499

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 49/77 (63%), Gaps = 2/77 (2%)

Query: 232 HVASHQRPPAAVQPHQGQNPADPEN-PHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCP 289
           ++A  +RP A+   ++  +PA+ E  P +C  C K+F+R   LKRH+ S HSS +PF+C 
Sbjct: 415 NLAKKKRPSASRPRNKSTSPAEEEEKPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCS 474

Query: 290 WCQSRHKRKDNLLQHMK 306
           +C  +  R DNL QH+K
Sbjct: 475 YCDKKFSRSDNLSQHLK 491

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 14/26 (53%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSH 280
           E P  C  CDK F R   L +HL +H
Sbjct: 468 ERPFHCSYCDKKFSRSDNLSQHLKTH 493

>Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062W
           (REAL)
          Length = 639

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 42/73 (57%), Gaps = 8/73 (10%)

Query: 242 AVQPHQ-------GQNPADPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQS 293
           AVQP +        QN  D   P  C  CDK+F+R   LKRH+ S HS+ +PF C +C+ 
Sbjct: 559 AVQPRKRKSIATIDQNNYDKNKPFNCKDCDKAFRRSEHLKRHIRSVHSAERPFACMFCEK 618

Query: 294 RHKRKDNLLQHMK 306
           +  R DNL QH+K
Sbjct: 619 KFSRSDNLSQHLK 631

 Score = 30.4 bits (67), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 24/45 (53%)

Query: 268 KRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQ 312
           KRKS       ++   KPFNC  C    +R ++L +H++  H+ +
Sbjct: 564 KRKSIATIDQNNYDKNKPFNCKDCDKAFRRSEHLKRHIRSVHSAE 608

>CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {ON}
           some similarities with uniprot|P33748 Saccharomyces
           cerevisiae YMR037c MSN2
          Length = 597

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 37/55 (67%), Gaps = 1/55 (1%)

Query: 253 DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           D + P  CHLC K+FKR   LKRH+ S HS+ +PF+C  C+ +  R DNL QH+K
Sbjct: 530 DIDKPFGCHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHIK 584

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 16/26 (61%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSH 280
           + P  CHLC+K F R   L +H+ +H
Sbjct: 561 DRPFSCHLCEKKFSRSDNLSQHIKTH 586

>CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa]
           {ON} weakly similar to uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 541

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 1/55 (1%)

Query: 253 DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           D   P QC  CDK+F+R   LKRH+ S HS+ +PF C +C+ +  R DNL QH+K
Sbjct: 479 DGAKPFQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQHLK 533

>Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON}
           complement(4290..6233) [1944 nt, 648 aa]
          Length = 647

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (67%), Gaps = 2/59 (3%)

Query: 250 NPADPEN-PHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           N AD E+ P +C  C+K+F+R   LKRH+ S HSS +PF C +C+ +  R DNL QH+K
Sbjct: 581 NLADDESKPFKCTDCEKAFRRSEHLKRHIRSVHSSERPFACNYCEKKFSRSDNLSQHLK 639

>ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL062W
           (MSN4) and YMR037C (MSN2)
          Length = 571

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 253 DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           + E P +C  C K+F+R   LKRH+ S HSS +PF C +C  +  R DNL QH+K
Sbjct: 499 EEEKPFKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHLK 553

>Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062W
           (REAL)
          Length = 641

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 46/87 (52%), Gaps = 8/87 (9%)

Query: 228 ITSQHVASHQRPPAAVQPHQGQ-------NPADPENPHQCHLCDKSFKRKSWLKRHLLS- 279
           IT     SH      VQP + +       N  D   P +C  C+K+F+R   LKRH+ S 
Sbjct: 547 ITLSPTISHNGGKVPVQPRKRKSITAIDPNNYDKNKPFKCKDCEKAFRRSEHLKRHIRSV 606

Query: 280 HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           HS+ +PF C +C+ +  R DNL QH+K
Sbjct: 607 HSTERPFACMFCEKKFSRSDNLSQHLK 633

>Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {ON}
           YMR037C (REAL)
          Length = 709

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           E P  CH+C KSFKR   LKRH+ S HS+ +PF C  C  +  R DNL QH+K
Sbjct: 649 EKPFHCHICSKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 701

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSH 280
           E P  CH+CDK F R   L +H+ +H
Sbjct: 678 ERPFACHICDKKFSRSDNLSQHIKTH 703

>NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa]
           {ON} Anc_2.598
          Length = 822

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 250 NPADPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           N +D     +C  C K+F+R   LKRH+ S HSS +PF CP C  +  R DNL QH+K
Sbjct: 757 NFSDENKTFKCETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDKKFSRSDNLAQHIK 814

>Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {ON}
           YMR037C (REAL)
          Length = 703

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 35/53 (66%), Gaps = 1/53 (1%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           E P  CH+C KSFKR   LKRH+ S HS+ +PF C  C+ +  R DNL QH+K
Sbjct: 643 EKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICEKKFSRSDNLSQHIK 695

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 16/26 (61%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSH 280
           E P  CH+C+K F R   L +H+ +H
Sbjct: 672 ERPFACHICEKKFSRSDNLSQHIKTH 697

>NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {ON}
           Anc_2.598
          Length = 730

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 45/82 (54%), Gaps = 2/82 (2%)

Query: 226 PHITSQHVASHQRPPAAVQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIK 284
           PH  S +  +H    A+V    G    D   P +C  C K+F+R   LKRH+ S HSS +
Sbjct: 642 PHNNSNNSTAHTSRRASVSVTPGS-LDDKNKPFKCSECIKAFRRSEHLKRHIRSVHSSER 700

Query: 285 PFNCPWCQSRHKRKDNLLQHMK 306
           PF C +C+ +  R DNL QH+K
Sbjct: 701 PFACMFCEKKFSRSDNLSQHLK 722

>Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {ON}
           YKL062W (MSN4) - zinc finger protein [contig 59] FULL
          Length = 698

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 1/53 (1%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           E P +C  C K+F+R   LKRH+ S HSS +PF+C +C  +  R DNL QH+K
Sbjct: 638 EKPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLK 690

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 14/26 (53%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSH 280
           E P  C  CDK F R   L +HL +H
Sbjct: 667 ERPFHCSYCDKKFSRSDNLSQHLKTH 692

>KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weakly
           similar to uniprot|P33748 Saccharomyces cerevisiae
           YMR037C MSN2 Transcriptional activator related to Msn4p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 694

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 1/55 (1%)

Query: 253 DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           + E P +C  C+K+F+R   LKRH+ S HS+ +PF+C +C  +  R DNL QH+K
Sbjct: 616 EEEKPFKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLSQHLK 670

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 14/26 (53%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSH 280
           E P  C  CDK F R   L +HL +H
Sbjct: 647 ERPFHCQFCDKKFSRSDNLSQHLKTH 672

>YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON}
           MSN2Transcriptional activator related to Msn4p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 704

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           E P  CH+C KSFKR   LKRH+ S HS+ +PF C  C  +  R DNL QH+K
Sbjct: 644 EKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 696

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSH 280
           E P  CH+CDK F R   L +H+ +H
Sbjct: 673 ERPFACHICDKKFSRSDNLSQHIKTH 698

>Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {ON}
           YMR037C (REAL)
          Length = 704

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           E P  CH+C KSFKR   LKRH+ S HS+ +PF C  C  +  R DNL QH+K
Sbjct: 644 EKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 696

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSH 280
           E P  CH+CDK F R   L +H+ +H
Sbjct: 673 ERPFACHICDKKFSRSDNLSQHIKTH 698

>NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598
          Length = 769

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 36/66 (54%), Gaps = 1/66 (1%)

Query: 242 AVQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDN 300
            ++     N  D   P QC  C KSF+R   LKRH+ S HS  +PF C  C+ +  R DN
Sbjct: 696 GIKTTTAYNYGDENKPFQCDQCTKSFRRSEHLKRHVRSVHSKERPFACNLCEKKFSRSDN 755

Query: 301 LLQHMK 306
           L QH+K
Sbjct: 756 LSQHLK 761

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSH 280
           E P  C+LC+K F R   L +HL +H
Sbjct: 738 ERPFACNLCEKKFSRSDNLSQHLKTH 763

>YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}
           MSN4Transcriptional activator related to Msn2p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 630

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 37/58 (63%), Gaps = 1/58 (1%)

Query: 250 NPADPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           N  D   P +C  C+K+F+R   LKRH+ S HS+ +PF C +C+ +  R DNL QH+K
Sbjct: 565 NNYDKNKPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLK 622

>Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062W
           (REAL)
          Length = 628

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 37/58 (63%), Gaps = 1/58 (1%)

Query: 250 NPADPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           N  D   P +C  C+K+F+R   LKRH+ S HS+ +PF C +C+ +  R DNL QH+K
Sbjct: 563 NNYDKNKPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLK 620

>KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 677

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 1/53 (1%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           E P +C  C K+F+R   LKRH+ S HS+ +PF+C +C  +  R DNL QH+K
Sbjct: 617 EKPFKCQECTKAFRRSEHLKRHIRSVHSTERPFHCSYCDKKFSRSDNLSQHLK 669

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 14/26 (53%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSH 280
           E P  C  CDK F R   L +HL +H
Sbjct: 646 ERPFHCSYCDKKFSRSDNLSQHLKTH 671

>NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598
          Length = 972

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (61%), Gaps = 1/55 (1%)

Query: 253 DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           D   P +C  C+K+F+R   LKRH  S HS+ +PF C +C  R  R DNL QH+K
Sbjct: 910 DQNKPFKCSDCEKAFRRSEHLKRHFRSVHSAERPFGCMFCTKRFSRSDNLSQHLK 964

>Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii ABR089C
          Length = 767

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 253 DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           + E P +C  C K+F+R   LKRH+ S HS+ +PF C +C  +  R DNL QH+K
Sbjct: 693 EEEKPFKCQECTKAFRRSEHLKRHIRSVHSTDRPFPCTYCDKKFSRSDNLSQHLK 747

>ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar to
           uniprot|P33749 Saccharomyces cerevisiae YKL062W MSN4
           Transcriptional activator related to Msn2p activated in
           stress conditions which results in translocation from
           the cytoplasm to the nucleus binds DNA at stress
           response elements of responsive genes inducing gene
           expression
          Length = 584

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (66%), Gaps = 1/51 (1%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           P +C  C K+F+R   LKRH+ S HSS +PF C +C+ +  R DNL QH+K
Sbjct: 526 PFKCKECSKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLK 576

>TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {ON}
           Anc_2.598 YMR037C
          Length = 523

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 34/51 (66%), Gaps = 1/51 (1%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           P +C  C+K+F+R   LKRH+ S HSS +PF C +C  R  R DNL QH+K
Sbjct: 465 PFKCGQCEKAFRRSEHLKRHVRSVHSSERPFPCTFCDKRFSRSDNLSQHLK 515

 Score = 30.4 bits (67), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 14/26 (53%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSH 280
           E P  C  CDK F R   L +HL +H
Sbjct: 492 ERPFPCTFCDKRFSRSDNLSQHLKTH 517

>TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa]
           {ON} Anc_2.598 YMR037C
          Length = 437

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 40/66 (60%), Gaps = 3/66 (4%)

Query: 242 AVQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDN 300
           ++ P  G  P +   P +C  C K+F+R   LKRH+ S HS+ +PF C +C+ +  R DN
Sbjct: 366 SITPMSG--PDEEVKPFKCKECAKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDN 423

Query: 301 LLQHMK 306
           L QH+K
Sbjct: 424 LSQHLK 429

>KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598
           YMR037C
          Length = 620

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           + P +C  C K+FKR   LKRH+ S HS+ +PF C  C+ +  R DNL QH+K
Sbjct: 560 DKPFKCGQCVKAFKRSEHLKRHVRSVHSNDRPFACTLCEKKFSRSDNLSQHLK 612

>KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {ON}
           Anc_2.598 YMR037C
          Length = 443

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 39/69 (56%), Gaps = 5/69 (7%)

Query: 243 VQPHQGQNPADP----ENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKR 297
           +  H+ +   DP    E P +C  C K+F+R   LKRH+ S HS+ +PF C  C  +  R
Sbjct: 367 LNEHRRKKSIDPIDENEKPFKCDTCYKAFRRSEHLKRHIRSVHSTERPFACTICDKKFSR 426

Query: 298 KDNLLQHMK 306
            DNL QH+K
Sbjct: 427 SDNLSQHLK 435

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 15/26 (57%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSH 280
           E P  C +CDK F R   L +HL +H
Sbjct: 412 ERPFACTICDKKFSRSDNLSQHLKTH 437

>TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.598
           YMR037C
          Length = 365

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (68%), Gaps = 1/51 (1%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           P +C+ C+K FKR   LKRH+ S HS+ +P++C +C+    R DNL QH+K
Sbjct: 307 PFKCNKCEKKFKRSEHLKRHIRSVHSTERPYHCQFCEKNFSRSDNLSQHLK 357

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 16/26 (61%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSH 280
           E P+ C  C+K+F R   L +HL +H
Sbjct: 334 ERPYHCQFCEKNFSRSDNLSQHLKTH 359

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 27/44 (61%), Gaps = 3/44 (6%)

Query: 272 WLKRHLLSHSSI---KPFNCPWCQSRHKRKDNLLQHMKLKHTPQ 312
           ++KR+ +S   I   KPF C  C+ + KR ++L +H++  H+ +
Sbjct: 291 FVKRNSISPQIIYSDKPFKCNKCEKKFKRSEHLKRHIRSVHSTE 334

>Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON}
           YPR013C - Hypothetical ORF [contig 55] FULL
          Length = 190

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKHTPQV 313
           +QC LC K F R S L+ HLL+H+  +PF CP+  C      K N+++H+K    P+V
Sbjct: 128 YQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLKTHKQPEV 185

>Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {ON}
           complement(39687..41171) [1485 nt, 495 aa]
          Length = 494

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           E P +C  C K F+R   LKRH+ S HS  +PF C +C  +  R DNL QH+K
Sbjct: 434 EKPFKCGDCTKQFRRSEHLKRHIRSVHSKERPFPCKYCDKKFSRSDNLSQHLK 486

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 14/26 (53%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSH 280
           E P  C  CDK F R   L +HL +H
Sbjct: 463 ERPFPCKYCDKKFSRSDNLSQHLKTH 488

>Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON}
           YER130C (REAL)
          Length = 442

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 39/74 (52%), Gaps = 4/74 (5%)

Query: 237 QRPPAAVQPHQGQNPA---DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQ 292
           ++   ++Q  +G+ P+   D      C  CD+ FKR+  LKRH+ S H   KPF C  C 
Sbjct: 364 KKKAGSMQKTRGRKPSLIPDASKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICN 423

Query: 293 SRHKRKDNLLQHMK 306
               R DNL QH+K
Sbjct: 424 KNFSRSDNLNQHVK 437

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 20/29 (68%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSI 283
           E P  CH+C+K+F R   L +H+ +H+S+
Sbjct: 414 EKPFTCHICNKNFSRSDNLNQHVKTHASL 442

>YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON}
           Protein of unknown function; transcription is regulated
           by Haa1p, Sok2p and Zap1p transcriptional activators;
           computational analysis suggests a role as a
           transcription factor; C. albicans homolog (MNL1) plays a
           role in adaptation to stress
          Length = 443

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 39/74 (52%), Gaps = 4/74 (5%)

Query: 237 QRPPAAVQPHQGQNPA---DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQ 292
           ++   ++Q  +G+ P+   D      C  CD+ FKR+  LKRH+ S H   KPF C  C 
Sbjct: 365 RKKTGSMQKTRGRKPSLIPDASKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICN 424

Query: 293 SRHKRKDNLLQHMK 306
               R DNL QH+K
Sbjct: 425 KNFSRSDNLNQHVK 438

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 20/29 (68%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSI 283
           E P  CH+C+K+F R   L +H+ +H+S+
Sbjct: 415 EKPFTCHICNKNFSRSDNLNQHVKTHASL 443

>TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.144
           YER130C
          Length = 312

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 41/78 (52%), Gaps = 4/78 (5%)

Query: 233 VASHQRPPAAVQPHQGQNPA---DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNC 288
            A  +R   ++   +G+ P+   D      C  CD+ FKR+  LKRH+ S H   KPFNC
Sbjct: 230 AAIAKRRSGSMPKTRGRKPSPIPDASKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFNC 289

Query: 289 PWCQSRHKRKDNLLQHMK 306
             C  +  R DNL QH+K
Sbjct: 290 HICDKKFSRSDNLNQHIK 307

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHS 281
           E P  CH+CDK F R   L +H+ +HS
Sbjct: 284 EKPFNCHICDKKFSRSDNLNQHIKTHS 310

>KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.598
           YMR037C
          Length = 370

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 250 NPADPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           N  D +   +C  C+K FKR   LKRH  S HS+ +PF C  C+ +  R DNL QH+K
Sbjct: 305 NDEDLDKQFKCSECEKGFKRSEHLKRHFRSVHSNERPFPCMLCEKKFSRSDNLSQHLK 362

 Score = 30.0 bits (66), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 15/26 (57%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSH 280
           E P  C LC+K F R   L +HL +H
Sbjct: 339 ERPFPCMLCEKKFSRSDNLSQHLKTH 364

>TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {ON}
           Anc_2.598 YMR037C
          Length = 519

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 35/49 (71%), Gaps = 1/49 (2%)

Query: 259 QCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           +C+ C+K+F+R   LKRH+ S HSS +PF C +C+ +  R DNL QH+K
Sbjct: 463 KCNNCEKAFRRSEHLKRHIRSVHSSERPFPCNYCEKKFSRSDNLSQHLK 511

>KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {ON}
           Anc_2.598 YMR037C
          Length = 660

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 253 DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           D E P  C  C K+FKR   LKRH+ S HS  +P+ C  C  +  R DNL QH+K
Sbjct: 598 DMEKPFHCEQCLKAFKRSEHLKRHVRSVHSQERPYGCNICDKKFSRSDNLSQHLK 652

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 17/26 (65%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSH 280
           E P+ C++CDK F R   L +HL +H
Sbjct: 629 ERPYGCNICDKKFSRSDNLSQHLKTH 654

>KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 474

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 247 QGQNPA---DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLL 302
           +G+ P+   D   P  C  CD+ FKR+  LKRH+ S H   KP+ C  C  +  R DNL 
Sbjct: 404 RGRKPSPILDASKPFGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLS 463

Query: 303 QHMK 306
           QH+K
Sbjct: 464 QHLK 467

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHS 281
           E P+ CHLC K F R   L +HL +H+
Sbjct: 444 EKPYGCHLCGKKFSRSDNLSQHLKTHT 470

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 18/26 (69%)

Query: 284 KPFNCPWCQSRHKRKDNLLQHMKLKH 309
           KPF C +C  R KR+++L +H++  H
Sbjct: 416 KPFGCEYCDRRFKRQEHLKRHIRSLH 441

>NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144
          Length = 289

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 41/74 (55%), Gaps = 5/74 (6%)

Query: 247 QGQNPA---DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLL 302
           +G+ P+   D    + CHLC K FKR   LKRH  + H  ++PF C  C  R  R DNL 
Sbjct: 209 RGRKPSILPDDSKQYFCHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLN 268

Query: 303 QHMKLKHTPQVLQE 316
           QH+++ H  Q + E
Sbjct: 269 QHVRI-HEQQPIME 281

>Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130C -
           Hypothetical ORF [contig 211] FULL
          Length = 403

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 4/72 (5%)

Query: 247 QGQNPA---DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLL 302
           +G+ P+   D      C  CD+ FKR+  LKRH+ S H   KPF+C  C  +  R DNL 
Sbjct: 332 RGRKPSPILDASKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHICGKKFSRSDNLN 391

Query: 303 QHMKLKHTPQVL 314
           QH+K     +VL
Sbjct: 392 QHIKTHTDGEVL 403

>Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C
           (REAL)
          Length = 442

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 37/74 (50%), Gaps = 4/74 (5%)

Query: 237 QRPPAAVQPHQGQNPA---DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQ 292
           ++     Q  +G+ P+   D      C  CD+ FKR+  LKRH+ S H   KPF C  C 
Sbjct: 364 RKKAGNTQKTRGRKPSLIPDASKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICN 423

Query: 293 SRHKRKDNLLQHMK 306
               R DNL QH+K
Sbjct: 424 KNFSRSDNLNQHVK 437

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSI 283
           E P  CH+C+K+F R   L +H+ +H S+
Sbjct: 414 EKPFTCHICNKNFSRSDNLNQHVKTHVSL 442

>TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {ON}
           Anc_2.598 YMR037C
          Length = 746

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (62%), Gaps = 1/51 (1%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           P +C  C K+F+R   LKRH+ S HS  +PF+C  C  +  R DNL QH+K
Sbjct: 688 PFKCDTCGKNFRRSEHLKRHIRSVHSMERPFSCDICLKKFSRSDNLSQHLK 738

>KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 397

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 247 QGQNPA---DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLL 302
           +G+ P+   D      C  CD+ FKR+  LKRH+ S H   KPF+C  C  +  R DNL 
Sbjct: 326 RGRKPSPILDASKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCQICGKKFSRSDNLN 385

Query: 303 QHMK 306
           QH+K
Sbjct: 386 QHVK 389

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 16/32 (50%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPF 286
           E P  C +C K F R   L +H+ +HS   P 
Sbjct: 366 EKPFDCQICGKKFSRSDNLNQHVKTHSEGGPL 397

>NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 259 QCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKHTPQVLQE 316
           QCH+C KS  R S L+ H+L H+  +PF C W  C  R   K N+ +H KL    Q+  E
Sbjct: 492 QCHICGKSVTRTSTLQTHMLVHTGDRPFECVWSGCHKRFNVKSNMNRHYKLHLKKQLANE 551

Query: 317 L 317
           +
Sbjct: 552 V 552

>Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON}
           YER130C (REAL)
          Length = 449

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 38/74 (51%), Gaps = 4/74 (5%)

Query: 237 QRPPAAVQPHQGQNPA---DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQ 292
           ++   + Q  +G+ P+   D      C  CD+ FKR+  LKRH+ S H   KPF C  C 
Sbjct: 371 RKKAGSSQKTRGRKPSLIPDATKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICN 430

Query: 293 SRHKRKDNLLQHMK 306
               R DNL QH+K
Sbjct: 431 KNFSRSDNLNQHVK 444

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 20/29 (68%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSI 283
           E P  CH+C+K+F R   L +H+ +H+S+
Sbjct: 421 EKPFTCHICNKNFSRSDNLNQHVKTHTSL 449

>Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa]
           {ON} complement(101434..102513) [1080 nt, 360 aa]
          Length = 359

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 38/64 (59%), Gaps = 4/64 (6%)

Query: 247 QGQNPA---DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLL 302
           +G+ P+   DP     C  CD+ FKR+  LKRH+ S H   KPF+C  C+ +  R DNL 
Sbjct: 289 RGRKPSPILDPLKLFACEHCDRRFKRQEHLKRHVRSLHMGEKPFSCHICEKKFSRSDNLN 348

Query: 303 QHMK 306
           QH+K
Sbjct: 349 QHIK 352

 Score = 33.9 bits (76), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSI 283
           E P  CH+C+K F R   L +H+ +HS+ 
Sbjct: 329 EKPFSCHICEKKFSRSDNLNQHIKTHSNF 357

>KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {ON}
           Anc_8.144 YER130C
          Length = 472

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 247 QGQNPA---DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLL 302
           +G+ P+   DP     C  C + FKR+  LKRH+LS H   K F CP C     R DNL 
Sbjct: 386 RGRKPSLVDDPSKQFGCKYCPRKFKRQEHLKRHILSLHVGEKRFGCPICGKNFSRSDNLN 445

Query: 303 QHMK 306
           QH+K
Sbjct: 446 QHIK 449

>KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa]
           {ON} some similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 285

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 40/82 (48%), Gaps = 10/82 (12%)

Query: 231 QHVASHQR---PPAAVQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFN 287
           QH++  QR    P  V   +    AD      C  C K F R S L+ H+L HS  KPF 
Sbjct: 207 QHISYAQRHHNSPTTVVKGKANGKAD-----ICAQCGKQFTRPSALRTHMLVHSGDKPFE 261

Query: 288 CPW--CQSRHKRKDNLLQHMKL 307
           C W  C  +   K NL++H+KL
Sbjct: 262 CTWEGCNKKFNVKSNLIRHLKL 283

>SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 410

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 247 QGQNPA---DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLL 302
           +G+ P+   D      C  CD+ FKR+  LKRH+ S H   KP+ C  C  +  R DNL 
Sbjct: 340 RGRKPSPILDASKQFGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNLN 399

Query: 303 QHMK 306
           QH+K
Sbjct: 400 QHIK 403

>Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii ACL057W
          Length = 573

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 247 QGQNPA---DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLL 302
           +G+ P+   D   P  C  C++ FKR+  LKRH+ S H   KP+ C  C  +  R DNL 
Sbjct: 500 RGRKPSPALDATKPFGCEFCERRFKRQEHLKRHVRSLHMGEKPYGCDICGKKFSRSDNLN 559

Query: 303 QHMK 306
           QH+K
Sbjct: 560 QHIK 563

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 20/28 (71%)

Query: 282 SIKPFNCPWCQSRHKRKDNLLQHMKLKH 309
           + KPF C +C+ R KR+++L +H++  H
Sbjct: 510 ATKPFGCEFCERRFKRQEHLKRHVRSLH 537

>ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER130C
          Length = 520

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 38/70 (54%), Gaps = 4/70 (5%)

Query: 241 AAVQPHQGQNPA---DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHK 296
           A +   +G+ P+   D   P  C  C++ FKR+  LKRH+ S H   KP+ C  C  +  
Sbjct: 440 AGMPKTRGRKPSPALDATKPFGCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFS 499

Query: 297 RKDNLLQHMK 306
           R DNL QH+K
Sbjct: 500 RSDNLNQHIK 509

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 20/28 (71%)

Query: 282 SIKPFNCPWCQSRHKRKDNLLQHMKLKH 309
           + KPF C +C+ R KR+++L +H++  H
Sbjct: 456 ATKPFGCEYCERRFKRQEHLKRHIRSLH 483

 Score = 30.4 bits (67), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 16/27 (59%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHS 281
           E P+ C +C K F R   L +H+ +HS
Sbjct: 486 EKPYGCDICGKKFSRSDNLNQHIKTHS 512

>NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144
          Length = 436

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 247 QGQNPA---DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLL 302
           +G+ P+   D      C  C++ FKR+  LKRH+ S H  +KP+ C  CQ    R DNL 
Sbjct: 370 RGRKPSLIPDASKQFGCEYCERRFKRQEHLKRHVRSLHIGVKPYTCHICQKNFSRSDNLS 429

Query: 303 QHMK 306
           QH+K
Sbjct: 430 QHIK 433

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 16/24 (66%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSH 280
           P+ CH+C K+F R   L +H+ +H
Sbjct: 412 PYTCHICQKNFSRSDNLSQHIKTH 435

>Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to
           Ashbya gossypii AGR186C
          Length = 312

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 32/48 (66%)

Query: 260 CHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           C LC KSF R+S L+ HLL H+++KPF C +C+     K NL +H ++
Sbjct: 173 CPLCGKSFTRRSTLQIHLLIHTNLKPFKCSFCEKEFNVKSNLNRHERI 220

>Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)
          Length = 400

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 41/75 (54%), Gaps = 4/75 (5%)

Query: 251 PADPEN-PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNC--PWCQSRHKRKDNLLQHMKL 307
           P D EN P +C  C++ F R    KRHL +H+  KP +C  P C     R D L +HM+ 
Sbjct: 9   PVDNENRPFRCDTCNRGFHRLEHKKRHLRTHTGEKPHHCGFPGCGKSFSRSDELKRHMRT 68

Query: 308 KHTPQVLQELQSAGV 322
            HT Q  + L+ +G+
Sbjct: 69  -HTGQSQRRLKKSGI 82

>ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 557

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 260 CHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQ 312
           C  CD+ FKR+  LKRH+ S H   KPF C  C  +  R DNL QH+K  HT Q
Sbjct: 505 CEYCDRRFKRQEHLKRHVRSLHMCEKPFGCHICGKKFSRSDNLNQHIK-THTHQ 557

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 16/27 (59%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHS 281
           E P  CH+C K F R   L +H+ +H+
Sbjct: 529 EKPFGCHICGKKFSRSDNLNQHIKTHT 555

>KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 168

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNC--PWCQSRHKRKDNLLQHMKLKHTPQ 312
           H+CH+C K+F R S L  H L H+  +PF C  P C  R   K NL++H K+   P+
Sbjct: 111 HECHVCGKTFSRPSGLNTHALIHTGHQPFVCDVPHCGKRFNVKSNLIRHKKIHDKPR 167

>CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some
           similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c
          Length = 317

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 260 CHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           C  CD+ FKR+  LKRH+ S H   KP+ C  C  +  R DNL QH+K
Sbjct: 266 CEFCDRRFKRQEHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQHIK 313

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 19/27 (70%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHS 281
           E P++CH+C+K F R   L +H+ +HS
Sbjct: 290 EKPYECHICNKKFSRSDNLNQHIKTHS 316

>KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON}
           Anc_8.425 YDR216W
          Length = 627

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 45/95 (47%), Gaps = 5/95 (5%)

Query: 248 GQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           G  P+  +    C +C K+F R+  L RHL SH++ KPF C  C     R+D L++H   
Sbjct: 39  GLTPSGNKRTFLCFVCQKAFARQEHLDRHLRSHTNEKPFKCAVCDKDFTRRDLLIRHSNK 98

Query: 308 KHTPQVLQELQSAGVHPIVSNITLINLASTAGQNG 342
            H+   + + +S           L   AS + Q+G
Sbjct: 99  LHSDTAIVQRKSCNARK-----KLYRRASFSAQSG 128

>Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 47/97 (48%), Gaps = 4/97 (4%)

Query: 221 GYSDPPHITSQHVASHQRPPAAVQPHQGQN-PADPENPHQCHLCDKSFKRKSWLKRHLLS 279
            +S PP + S      Q  P    P + +    D   P  CH+C + F R+  LKRH  +
Sbjct: 26  AFSAPPCVISTGNDEAQVLPI---PKKSRTIKTDKPRPFLCHICTRGFVRQEHLKRHQRA 82

Query: 280 HSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQE 316
           H++ KPF C +C     R+D +L+H    H+  V +E
Sbjct: 83  HTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKE 119

>Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W
           (REAL)
          Length = 777

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 36/65 (55%)

Query: 252 ADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTP 311
            D   P  CH+C + F R+  LKRH  +H++ KPF C +C     R+D +L+H    H+ 
Sbjct: 55  TDKPRPFLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSA 114

Query: 312 QVLQE 316
            V +E
Sbjct: 115 LVSKE 119

>AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON}
           NOHBY743; No homolog in Saccharomyces cerevisiae
          Length = 287

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 31/48 (64%)

Query: 260 CHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           C LC KSF R+S L+ HLL H+++KPF C +C      K NL +H ++
Sbjct: 169 CPLCGKSFTRRSTLQIHLLIHTNLKPFKCSFCDKEFNVKSNLNRHERI 216

>TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {ON}
           Anc_8.144 YER130C
          Length = 439

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 247 QGQNPA---DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLL 302
           +G+ P+   D      C  C++ FKR+  LKRH+ S H  +KP+ C  C  +  R DNL 
Sbjct: 372 RGRKPSPILDSSKQFGCDYCERRFKRQEHLKRHVRSLHMCVKPYACHICDKKFSRSDNLS 431

Query: 303 QHMK 306
           QH+K
Sbjct: 432 QHIK 435

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 17/25 (68%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHS 281
           P+ CH+CDK F R   L +H+ +H+
Sbjct: 414 PYACHICDKKFSRSDNLSQHIKTHT 438

 Score = 30.4 bits (67), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 282 SIKPFNCPWCQSRHKRKDNLLQHMKLKH 309
           S K F C +C+ R KR+++L +H++  H
Sbjct: 382 SSKQFGCDYCERRFKRQEHLKRHVRSLH 409

>KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {ON}
           Anc_1.326 YJL056C
          Length = 753

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 30/52 (57%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           E P +CHLCDKSF   + LK H+ +H+  KP  C  C  R     NL +HMK
Sbjct: 665 EKPFKCHLCDKSFSVSTSLKIHIRTHTGEKPLECKVCGRRFNESSNLSKHMK 716

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 1/65 (1%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQE 316
           P++C +C K F     LK+H   HS  KPF C  C        +L  H++  HT +   E
Sbjct: 639 PYKCEVCSKCFSSDETLKQHSRVHSGEKPFKCHLCDKSFSVSTSLKIHIRT-HTGEKPLE 697

Query: 317 LQSAG 321
            +  G
Sbjct: 698 CKVCG 702

 Score = 37.0 bits (84), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%)

Query: 261 HLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           H C+K F ++  + RHL  HS  KP+ C  C       + L QH ++
Sbjct: 615 HGCNKEFSQRQKIVRHLKVHSGFKPYKCEVCSKCFSSDETLKQHSRV 661

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 28/65 (43%), Gaps = 8/65 (12%)

Query: 243 VQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLL 302
           ++ H G      E P +C +C + F   S L +H+ +H     F CP C      +  + 
Sbjct: 687 IRTHTG------EKPLECKVCGRRFNESSNLSKHMKTHE--HNFKCPICSKGFNTQKRME 738

Query: 303 QHMKL 307
            HM+ 
Sbjct: 739 THMRF 743

>TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144
           YER130C
          Length = 687

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 247 QGQNPA---DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLL 302
           +G+ P+   DP     C  C++ FKR+  LKRH  S H   KPF+C  C  +  R DNL 
Sbjct: 620 RGRKPSPFNDPSKIFICPYCNRRFKRQEHLKRHNRSLHMGEKPFDCHICNKKFSRSDNLA 679

Query: 303 QHMK 306
           QH+K
Sbjct: 680 QHIK 683

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 40/91 (43%), Gaps = 28/91 (30%)

Query: 207 NPEYPLSVYPVDSRG-----YSDPPHI-----------TSQHVASHQRPPAAVQPHQGQN 250
           N   P+++ P+ +RG     ++DP  I             +H+  H R       H G+ 
Sbjct: 608 NTNLPITI-PLKTRGRKPSPFNDPSKIFICPYCNRRFKRQEHLKRHNR-----SLHMGEK 661

Query: 251 PADPENPHQCHLCDKSFKRKSWLKRHLLSHS 281
           P D      CH+C+K F R   L +H+ +HS
Sbjct: 662 PFD------CHICNKKFSRSDNLAQHIKTHS 686

>Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON}
           complement(124703..125578) [876 nt, 292 aa]
          Length = 291

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 259 QCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKHTPQV 313
           QCH+C K   R + LK HLL H+   PF CPW  C      K N+L+H+K     QV
Sbjct: 150 QCHICKKICSRPATLKTHLLIHTGDTPFKCPWENCPKSFNVKSNMLRHLKSHQRKQV 206

>KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {ON}
           Anc_8.144 YER130C
          Length = 453

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 39/87 (44%), Gaps = 16/87 (18%)

Query: 221 GYSDPPHITSQHVASHQRPPAAVQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLS- 279
           G SD P I         R P+ +     Q          C  CD+ FKR+  LKRH+ S 
Sbjct: 376 GISDTPKI-------RGRKPSLLDDGTKQ--------FSCEYCDRRFKRQEHLKRHIRSL 420

Query: 280 HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           H   KPF+C  C     R DNL QH+K
Sbjct: 421 HICEKPFHCHICDKHFSRSDNLNQHIK 447

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSS 282
           E P  CH+CDK F R   L +H+ +HS+
Sbjct: 424 EKPFHCHICDKHFSRSDNLNQHIKTHSN 451

>YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}
           TDA9DNA-binding protein, putative transcription factor;
           green fluorescent protein (GFP)-fusion protein localizes
           to the nucleus; null mutant is sensitive to expression
           of the top1-T722A allele; not an essential gene
          Length = 1251

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 36/65 (55%)

Query: 252 ADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTP 311
            D   P  CH+C + F R+  LKRH  +H++ KPF C +C     R+D +L+H    H+ 
Sbjct: 55  TDKPRPFLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSA 114

Query: 312 QVLQE 316
            V +E
Sbjct: 115 LVSKE 119

>Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 36/65 (55%)

Query: 252 ADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTP 311
            D   P  CH+C + F R+  LKRH  +H++ KPF C +C     R+D +L+H    H+ 
Sbjct: 55  TDKPRPFLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSA 114

Query: 312 QVLQE 316
            V +E
Sbjct: 115 LVSKE 119

>KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.162
           YOR113W
          Length = 572

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHM 305
           + P++C  C K F +   LK H+  H+  KPF+C +C  R  RK NL  H+
Sbjct: 413 DKPYKCTWCGKGFTQGGNLKTHVRLHTGEKPFSCEFCSKRFSRKGNLTAHL 463

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQ 312
           H+C++C K F + + L+ HL SH   KP+ C WC     +  NL  H++L HT +
Sbjct: 388 HECNICHKLFIQLTHLEVHLRSHLGDKPYKCTWCGKGFTQGGNLKTHVRL-HTGE 441

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 28/65 (43%), Gaps = 3/65 (4%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKHTPQ 312
           E P  C  C K F RK  L  HL++H  ++PF C    C     +  N+  H    H   
Sbjct: 441 EKPFSCEFCSKRFSRKGNLTAHLVTHEKVRPFVCKLNGCMKTFTQLGNMKSHQNRFH-QN 499

Query: 313 VLQEL 317
            L EL
Sbjct: 500 TLTEL 504

>ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR015C
          Length = 281

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 32/49 (65%), Gaps = 2/49 (4%)

Query: 260 CHLCDKSFKRKSWLKRHLLSHSSIKPFNCP--WCQSRHKRKDNLLQHMK 306
           C +C K FKR S L+ H++ H++ KP+NC    CQ R   K N+L+HM+
Sbjct: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275

>YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc finger
           transcriptional repressor; cooperates with Mig1p in
           glucose-induced repression of many genes including SUC2
           (invertase); binds to Mig1p-binding sites in SUC2
           promoter; under low glucose conditions Mig2p relocalizes
           to mitochondrion, where it regulates morphology,
           interacts with Ups1p and antagonizes mitochondrial
           fission factor, Dnm1p, indicative of a role in promoting
           mitochondrial fusion or regulating morphology
          Length = 382

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 251 PADPEN-PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNC--PWCQSRHKRKDNLLQHMKL 307
           P D EN P +C  C + F R    KRHL +H+  KP +C  P C     R D L +HM+ 
Sbjct: 9   PVDNENRPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRT 68

Query: 308 KHTPQVLQELQSAGV 322
            HT Q  + L+ A V
Sbjct: 69  -HTGQSQRRLKKASV 82

>KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.351
           YJR127C
          Length = 1076

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 41/72 (56%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQE 316
           P  C +C ++F R+  LKRH  SH++ KPF C +C     R+D +L+H    H+  +  E
Sbjct: 51  PFVCSVCTRAFIRQEHLKRHQRSHTNEKPFICVFCGRCFARRDLVLRHQHKLHSALIGTE 110

Query: 317 LQSAGVHPIVSN 328
           L    V+ ++++
Sbjct: 111 LHHENVNALLND 122

>Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa]
           {ON} (16151..16525,16527..17390) [1239 nt, 413 aa]
          Length = 412

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 42/84 (50%), Gaps = 2/84 (2%)

Query: 230 SQHVASHQRPPAAVQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNC- 288
           S+++ +  RP AA   +    P +   PH C +C+++F R     RH+ +H+  KP  C 
Sbjct: 11  SKNIPNSTRPTAATANNTVAKPKEKPRPHVCPICNRAFHRLEHQTRHMRTHTGEKPHECD 70

Query: 289 -PWCQSRHKRKDNLLQHMKLKHTP 311
            P C  +  R D L +H ++   P
Sbjct: 71  FPGCVKKFSRSDELTRHRRIHTNP 94

>NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa]
           {ON} 
          Length = 505

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 8/83 (9%)

Query: 227 HITSQHVASHQRPPAAVQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPF 286
            ++S+ V S +R P        Q     +   QC LC K   R S L+ H+L H+ ++PF
Sbjct: 422 ELSSKSVGSQRRNPRM------QELQTRKRKKQCKLCGKVVTRTSSLQTHMLIHTGVRPF 475

Query: 287 NCPW--CQSRHKRKDNLLQHMKL 307
           +C W  C+     K N+ +H+KL
Sbjct: 476 SCTWPGCKKTFNVKSNMNRHLKL 498

>SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {ON}
           conserved hypothetical protein
          Length = 288

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 44/96 (45%), Gaps = 3/96 (3%)

Query: 214 VYPVDSRGYSDPPHITSQHVASHQRPPAAVQPHQGQNPADPENPHQCHLCDKSFKRKSWL 273
           V PV+    +  P +      S Q     + P   + PA P+  H C  C KSF+R S L
Sbjct: 175 VTPVERDRSTSAPDLLIASKGSQQHS-GPLCPVVSEAPARPKLQHLCPECGKSFRRPSAL 233

Query: 274 KRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKL 307
           K H + H    P+ C W  C  R   K NLL+H ++
Sbjct: 234 KTHSIIHVGRSPYACTWNGCSKRFNVKGNLLRHYRI 269

>TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.351
           YJR127C
          Length = 1310

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%)

Query: 252 ADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQH 304
            D   P  C +C + F R+  LKRH +SH++ KPF C +C     RKD +L+H
Sbjct: 28  TDKPRPFLCSICTRGFVRQEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRH 80

>SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 385

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 3/60 (5%)

Query: 251 PAD-PENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNC--PWCQSRHKRKDNLLQHMKL 307
           PAD  + P++C LC+K F R    +RH+ +H+  KP  C  P C  R  R D L +H+++
Sbjct: 17  PADNDQRPYKCELCNKGFHRLEHKRRHIRTHTGEKPHACTFPGCMKRFSRSDELKRHLRI 76

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 41/99 (41%), Gaps = 11/99 (11%)

Query: 255 ENPHQCHL--CDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQ 312
           E PH C    C K F R   LKRHL  H+     N    ++R +R D   +       PQ
Sbjct: 50  EKPHACTFPGCMKRFSRSDELKRHLRIHT-----NTSKRKTRKRRADISSEEKAALDGPQ 104

Query: 313 ---VLQELQSAGVHPIVSNITLINLASTAGQNGVPSLVP 348
              ++  LQ   V P  + +  ++  ST     VP  +P
Sbjct: 105 HPVIVHHLQPLAV-PETAQVQPVSATSTTTTIYVPVTIP 142

>Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}
           similar to Ashbya gossypii AEL174W
          Length = 663

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 35/76 (46%), Gaps = 7/76 (9%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL------- 307
           E P +C  CDK F   S L+ H+ +H+  KP  C  C  R     NL +HMK+       
Sbjct: 571 ERPFKCQFCDKRFTTSSSLRIHIRTHTGEKPLACNVCGKRFNESSNLSKHMKIHERKYMC 630

Query: 308 KHTPQVLQELQSAGVH 323
           KH  +    LQ   +H
Sbjct: 631 KHCKRSFDRLQQYNIH 646

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 229 TSQHVASHQRPPAAVQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNC 288
            ++H A  Q+    ++ H G  P       +C  C K+F  +  L +H+ +HS  +PF C
Sbjct: 523 CTKHFAQRQKLLRHIKVHTGYKPF------KCPHCSKTFSTEDILSQHIRTHSGERPFKC 576

Query: 289 PWCQSRHKRKDNLLQHMK 306
            +C  R     +L  H++
Sbjct: 577 QFCDKRFTTSSSLRIHIR 594

>TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {ON}
           Anc_2.162 YOR113W
          Length = 717

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNL----LQHMKLK 308
           P QC  C K F +   L+ H   H+  KP+NC  C  R  RK NL    L H KLK
Sbjct: 436 PFQCEFCGKRFTQGGNLRTHQRLHTGEKPYNCEMCGKRFSRKGNLAAHALTHQKLK 491

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQ 312
           H+C  C + F + + L+ H+ SH   KPF C +C  R  +  NL  H +L HT +
Sbjct: 409 HECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEFCGKRFTQGGNLRTHQRL-HTGE 462

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 2/63 (3%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKHTPQ 312
           E P+ C +C K F RK  L  H L+H  +KP+ C    C     +  N+  H    H   
Sbjct: 462 EKPYNCEMCGKRFSRKGNLAAHALTHQKLKPYICKLENCNKSFTQLGNMKAHQNRFHLKT 521

Query: 313 VLQ 315
           +++
Sbjct: 522 LMR 524

>TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON} 
          Length = 454

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 260 CHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMKLK 308
           C+ C +SF     L RH  + H + KPF+CP C+ R KR+D++LQH+  K
Sbjct: 392 CYECCRSFSSSHHLTRHKKTVHLNEKPFSCPRCRKRFKRRDHVLQHLNKK 441

>KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}
           Anc_3.298
          Length = 394

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 251 PADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKL 307
           P+  +  + C +C K FKR S L  H+  H+  KP+ CP+  CQ     K N+L+H KL
Sbjct: 271 PSTDKVKYCCKVCSKRFKRPSSLSTHMNIHTGYKPYQCPFSNCQKSFNAKSNMLRHYKL 329

>NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {ON}
           Anc_8.144
          Length = 547

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 247 QGQNPA---DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLL 302
           +G+ P+   D      C  C++ FKR+  LKRH+ S H   KP+ C  C     R DNL 
Sbjct: 481 RGRKPSLLPDATKQFACDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNLT 540

Query: 303 QHMK 306
           QH+K
Sbjct: 541 QHIK 544

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 18/26 (69%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSH 280
           E P+ CH+C+K+F R   L +H+ +H
Sbjct: 521 EKPYACHICNKNFSRSDNLTQHIKTH 546

>TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {ON}
           Anc_2.162 YOR113W
          Length = 823

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNL----LQHMKLK 308
           P+QC+ C K F +   LK H   H+  KP++C  C  R  RK NL    L H KLK
Sbjct: 544 PYQCNFCGKKFTQGGNLKTHQRLHTGEKPYSCKICNKRFSRKGNLTAHVLTHKKLK 599

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKH 309
           E P+ C +C+K F RK  L  H+L+H  +KP+ C    C     +  N+  H    H
Sbjct: 570 EKPYSCKICNKRFSRKGNLTAHVLTHKKLKPYFCKLDNCNKTFTQLGNMKAHQNKFH 626

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           HQC  C + F + + L+ H+ SH   KP+ C +C  +  +  NL  H +L
Sbjct: 517 HQCPYCHRFFSQSTHLEVHIRSHIGYKPYQCNFCGKKFTQGGNLKTHQRL 566

>CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa]
           {ON} weakly similar to uniprot|P41696 Saccharomyces
           cerevisiae YOR113w AZF1 asparagine-rich zinc finger
           protein
          Length = 642

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKHTPQ 312
           E P +C  CDK+F R+  L  H  +H SIKP+ C    C  R  +  N+  H   K+ PQ
Sbjct: 533 ERPFKCDKCDKTFARRGNLTAHEFTHESIKPYICRLDNCFKRFSQLGNMKSHQN-KYHPQ 591

Query: 313 VLQEL 317
            ++EL
Sbjct: 592 TIKEL 596

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           +QC  C K F + + L  H+ +H   KPF C +C  R  +  NL  H +L
Sbjct: 480 YQCAYCSKMFSQSTHLDVHIKAHMGYKPFECEFCGKRFTQAGNLRTHRRL 529

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 22/48 (45%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQH 304
           P +C  C K F +   L+ H   H+  +PF C  C     R+ NL  H
Sbjct: 507 PFECEFCGKRFTQAGNLRTHRRLHTGERPFKCDKCDKTFARRGNLTAH 554

>Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)
          Length = 382

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 40/79 (50%), Gaps = 4/79 (5%)

Query: 247 QGQNPADPEN-PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNC--PWCQSRHKRKDNLLQ 303
           Q   P D EN P +C  C + F R    KRHL +H+  KP +C  P C     R D L +
Sbjct: 5   QTTFPVDNENRPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKR 64

Query: 304 HMKLKHTPQVLQELQSAGV 322
           HM+  HT Q  + L+ + V
Sbjct: 65  HMRT-HTGQSQRRLKKSSV 82

>KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON} 
          Length = 370

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 34/67 (50%), Gaps = 3/67 (4%)

Query: 259 QCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKHTPQVLQE 316
           QC +C K   R S LK H L H+   PF CPW  C      K N+L+H K  H  +   +
Sbjct: 299 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCPWKGCTKSFNVKSNMLRHFK-SHEKKAASK 357

Query: 317 LQSAGVH 323
            ++ G+H
Sbjct: 358 KETEGLH 364

>KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.144
           YER130C
          Length = 402

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           + C  C++ FKR+  LKRH+ S H   KP+ C  C  +  R DNL QH K
Sbjct: 349 YSCEYCERRFKRQEHLKRHIRSLHLGAKPYTCHICARKFSRSDNLNQHTK 398

>NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]
           {ON} Anc_4.351
          Length = 1341

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 34/67 (50%)

Query: 252 ADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTP 311
            D   P  C  C + F R+  LKRH  SH++ KPF C +C     R+D +L+H    H  
Sbjct: 66  TDKPRPFLCPTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHAA 125

Query: 312 QVLQELQ 318
            +  ELQ
Sbjct: 126 LIGNELQ 132

>SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa]
           {ON} similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1129

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 43/91 (47%)

Query: 248 GQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           G+ P+       C +C ++F R+  L RH  SH+  KP+ C  C  R  R+D LL+H   
Sbjct: 49  GKTPSGKPRLFVCKICTRAFARQEHLTRHERSHTKEKPYFCGICDRRFSRRDLLLRHAHK 108

Query: 308 KHTPQVLQELQSAGVHPIVSNITLINLASTA 338
            H     + ++       VS ++ I+   T+
Sbjct: 109 LHGGNCGETIKKGRKRKCVSVMSSIDHGDTS 139

>TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.80
           YGL035C
          Length = 350

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 3/74 (4%)

Query: 241 AAVQPHQGQNPA-DPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNC--PWCQSRHKR 297
           A  +P + +N   D   PH C +C ++F+R     RHL +H+  KP  C  P C  R  R
Sbjct: 11  ANTEPKKTRNSGKDAPRPHVCPICQRAFRRLEHQTRHLRTHTGEKPHACDFPGCAKRFSR 70

Query: 298 KDNLLQHMKLKHTP 311
            D L +H ++   P
Sbjct: 71  SDELTRHRRIHTNP 84

>CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa]
           {ON} some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 348

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 259 QCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKL 307
           QC +C K   R S LK H L H+   PF CPW  C+     K N+L+H+K 
Sbjct: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKC 336

>KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1053

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 40/75 (53%), Gaps = 2/75 (2%)

Query: 252 ADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTP 311
            D   P+ C +C + F R   LKRH  SH+  KP+ C +C     RKD +L+H    H P
Sbjct: 16  TDKPRPNICPVCSRGFVRLEHLKRHQRSHTREKPYLCVFCGRCFARKDLVLRHQGKLH-P 74

Query: 312 QVLQELQ-SAGVHPI 325
           +VL  L  +A + P+
Sbjct: 75  EVLSALGPTADIKPV 89

>CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]
           {ON} some similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067c
          Length = 1013

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%)

Query: 251 PADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHT 310
           P      H C  C+K+F R     RH  SH+ +KPF C  C     R+D L +H++  H 
Sbjct: 5   PTGKTKRHFCSFCNKAFSRSEHKTRHERSHAGVKPFECQVCSHSFVRRDLLQRHIRTVHR 64

Query: 311 PQVLQE 316
             +L++
Sbjct: 65  ILLLRD 70

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 12/48 (25%)

Query: 230 SQHVASHQRPPAAVQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHL 277
           S+H   H+R  A V+P +            C +C  SF R+  L+RH+
Sbjct: 24  SEHKTRHERSHAGVKPFE------------CQVCSHSFVRRDLLQRHI 59

>Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C
           (REAL)
          Length = 878

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 30/52 (57%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           E P++CH+CDK F   S LK H+ +H+  KP  C  C  R     NL +H+K
Sbjct: 791 EKPYKCHICDKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIK 842

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 258 HQC--HLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           +QC  H C ++F ++  L RHL  HS  KP+ C  C+     ++ L+QH +
Sbjct: 736 YQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTR 786

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 28/59 (47%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQ 315
           P++C  C + F  +  L +H  +HS  KP+ C  C  +     +L  H++     + LQ
Sbjct: 765 PYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICDKKFAISSSLKIHIRTHTGEKPLQ 823

>AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR216W (ADR1)
          Length = 1057

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 35/77 (45%)

Query: 248 GQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           G  P+       CH C ++F R+  L RH  SH++ KP+ C  C  R  R+D LL+H   
Sbjct: 39  GVTPSGKPRLFVCHTCTRAFARQEHLIRHKRSHTNEKPYICGICDRRFSRRDLLLRHAHK 98

Query: 308 KHTPQVLQELQSAGVHP 324
            H       L   G  P
Sbjct: 99  LHGGSCGDALLKKGSPP 115

>Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON}
           (42259..43791) [1533 nt, 511 aa]
          Length = 510

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 51/114 (44%), Gaps = 18/114 (15%)

Query: 208 PEYPLSVYPVDSR----GYSDPPHITSQHVASHQRPPAAVQPHQGQNPADPENPHQCHLC 263
           P+  L    VD R     Y D     + ++ +HQR       H G      E P++CH+C
Sbjct: 363 PKQELMEEVVDKRQHKCAYCDKRFSQTGNLNTHQRL------HTG------ERPYECHIC 410

Query: 264 DKSFKRKSWLKRHLLSHSSIKPFNCP--WCQSRHKRKDNLLQHMKLKHTPQVLQ 315
           +K F RK  L  H+++H  +KP+ C    C  +  +  N+  H    H   +L+
Sbjct: 411 NKRFSRKGNLTAHVITHKKLKPYICKVDGCNKKFTQLGNMKVHQNKFHYETILR 464

>TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1384

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 37/67 (55%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQE 316
           P+ C  C + F R+  LKRH  SH++ KPF C +C     R+D +L+H +  H+  +  +
Sbjct: 104 PYICQTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLILRHQRRLHSSLMTND 163

Query: 317 LQSAGVH 323
             ++  H
Sbjct: 164 SMNSTSH 170

>ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1119

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 35/67 (52%)

Query: 252 ADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTP 311
            D   P  C +C + F R+  LKRH  SH++ KPF C +C     R+D +L+H    H  
Sbjct: 69  TDKPRPFLCSICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHAA 128

Query: 312 QVLQELQ 318
            V + L+
Sbjct: 129 LVSKTLE 135

>Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii ADL042W
          Length = 305

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 31/49 (63%), Gaps = 2/49 (4%)

Query: 260 CHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMK 306
           C +C K FKR S L+ H++ H++ KP+ C    CQ R   K N+L+HM+
Sbjct: 251 CEICGKDFKRPSALRTHMVVHNNDKPYKCEHIDCQKRFNVKSNMLRHMR 299

>NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa]
           {ON} Anc_1.326
          Length = 836

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 30/60 (50%)

Query: 247 QGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           Q Q     E P QCHLCDK F   S LK H+ +H+  KP  C  C        NL +H+K
Sbjct: 755 QHQRTHTGEKPFQCHLCDKRFTIASSLKIHIRTHTGEKPLKCKICGKAFNESSNLSKHIK 814

 Score = 38.1 bits (87), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 35/80 (43%), Gaps = 6/80 (7%)

Query: 227 HITSQHVASHQRPPAAVQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPF 286
           H  S+     Q+    ++ H G  P       +C +C+K F     LK+H  +H+  KPF
Sbjct: 713 HGCSKKFTQRQKMVRHLKVHSGYKPC------KCPVCNKCFSNLETLKQHQRTHTGEKPF 766

Query: 287 NCPWCQSRHKRKDNLLQHMK 306
            C  C  R     +L  H++
Sbjct: 767 QCHLCDKRFTIASSLKIHIR 786

 Score = 37.4 bits (85), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 258 HQCHL--CDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           +QCH   C K F ++  + RHL  HS  KP  CP C       + L QH +
Sbjct: 708 YQCHWHGCSKKFTQRQKMVRHLKVHSGYKPCKCPVCNKCFSNLETLKQHQR 758

>KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some
           similarities with uniprot|P47043 Saccharomyces
           cerevisiae YJL056C ZAP1 Zinc-regulated transcription
           factor binds to zinc-responsive promoter elements to
           induce transcription of certain genes in the presence of
           zinc regulates its own transcription contains seven
           zinc- finger domains
          Length = 781

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           E P +CHLC KS+   S L+ H+ +H+  KP +CP C  R     NL +H++
Sbjct: 717 ERPFKCHLCPKSYSTSSSLRIHIRTHTGEKPLSCPICNKRFNESSNLAKHIR 768

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 25/45 (55%)

Query: 263 CDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           C+K F +K  L RHL  HS  KPF C  C      +D L QH+++
Sbjct: 669 CNKVFVQKQKLIRHLKVHSKYKPFRCAECGKCFNTQDILTQHLRV 713

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           P +C  C K F  +  L +HL  HS  +PF C  C   +    +L  H++
Sbjct: 691 PFRCAECGKCFNTQDILTQHLRVHSGERPFKCHLCPKSYSTSSSLRIHIR 740

>Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..7102)
           [4026 nt, 1342 aa]
          Length = 1341

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQE 316
           P  C +C + F R   LKRH +SH++ KPF C +C     RKD +L+H    H   V Q+
Sbjct: 35  PFLCSICTRGFVRHEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRHQYKLHPALVSQK 94

>Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113W
           (AZF1) - similar to Zn-finger transcription factors
           [contig 204] FULL
          Length = 786

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317
           H+C  C K F + + L+ H+ SH   KPF C +C  R  +  NL  H++L HT +   E 
Sbjct: 503 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL-HTGEKPYEC 561

Query: 318 QSAG 321
           +  G
Sbjct: 562 EKCG 565

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKH 309
           P QC  C K F +   L+ H+  H+  KP+ C  C  R  RK NL  H +L H
Sbjct: 530 PFQCEYCGKRFTQGGNLRTHVRLHTGEKPYECEKCGRRFSRKGNLAAH-RLTH 581

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKHTPQ 312
           E P++C  C + F RK  L  H L+H ++KPF+C    C     +  N+  H    H  Q
Sbjct: 556 EKPYECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAHQNRFHL-Q 614

Query: 313 VLQEL 317
            L EL
Sbjct: 615 TLNEL 619

>NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON}
           Anc_2.162
          Length = 839

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKH 309
           E P++C LCDK F RK  L  HLL+H  +KPF C    C     +  N+  H    H
Sbjct: 568 EKPYECELCDKKFSRKGNLAAHLLTHQKVKPFICKLDNCNRSFTQLGNMKAHQNRFH 624

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHM 305
           P+QC  C K F +   L+ H   H+  KP+ C  C  +  RK NL  H+
Sbjct: 542 PYQCGYCGKRFTQGGNLRTHQRLHTGEKPYECELCDKKFSRKGNLAAHL 590

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           H+C  C + F + + L+ H+ SH   KP+ C +C  R  +  NL  H +L
Sbjct: 515 HKCPYCHRLFAQSTHLEVHIRSHLGYKPYQCGYCGKRFTQGGNLRTHQRL 564

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKL 307
           + C +C K FKR S L  H+  H+  KPF CP+  C      K N+L+H KL
Sbjct: 305 YHCSICGKKFKRPSSLSTHMNIHTGNKPFTCPFTNCTKSFNAKSNMLRHYKL 356

>NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON}
           Anc_8.425
          Length = 1350

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 36/67 (53%)

Query: 248 GQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           G+ P+       C +C ++F R+  L RH  SH+  KP+NC  C  +  R+D L++H + 
Sbjct: 106 GKTPSGKVRLFVCEICTRAFARQEHLVRHERSHTKEKPYNCGICSKKFTRRDLLIRHAQK 165

Query: 308 KHTPQVL 314
            H   V+
Sbjct: 166 VHNGNVV 172

>Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W
           (REAL)
          Length = 383

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 40/79 (50%), Gaps = 4/79 (5%)

Query: 247 QGQNPADPEN-PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNC--PWCQSRHKRKDNLLQ 303
           Q   P D EN P +C  C + F R    KRHL +H+  KP +C  P C     R D L +
Sbjct: 5   QTNFPVDNENRPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKR 64

Query: 304 HMKLKHTPQVLQELQSAGV 322
           HM+  HT Q  + L+ + +
Sbjct: 65  HMRT-HTGQSQRRLKKSSI 82

>SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1238

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%)

Query: 252 ADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTP 311
            D   P  C +C + F R+  LKRH  SH++ KPF C +C     R+D +L+H +  H  
Sbjct: 67  TDKPRPFLCPICTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHAS 126

Query: 312 QVLQE 316
            + Q+
Sbjct: 127 LMDQD 131

>ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 849

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 29/52 (55%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           E P +CHLC KSF   S LK H+ +H+  KP  C  C  R     NL +H+K
Sbjct: 760 EKPFKCHLCGKSFSVSSSLKIHIRTHTGEKPLQCKICGKRFNESSNLNKHLK 811

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%)

Query: 263 CDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           C + F ++  + RHL  HS  KPF C  C      +D L QHM+
Sbjct: 712 CCRKFTQRQKMVRHLKVHSGYKPFKCQVCLKSFSSEDTLNQHMR 755

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQ 315
           P +C +C KSF  +  L +H+ +HS  KPF C  C        +L  H++     + LQ
Sbjct: 734 PFKCQVCLKSFSSEDTLNQHMRTHSGEKPFKCHLCGKSFSVSSSLKIHIRTHTGEKPLQ 792

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 2/37 (5%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWC 291
           E P QC +C K F   S L +HL +H   K + C  C
Sbjct: 788 EKPLQCKICGKRFNESSNLNKHLKTHR--KKYKCSCC 822

>KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakly
           similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1119

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%)

Query: 246 HQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHM 305
           ++GQ P+       C +C ++F R   L RH   H+  KP++C  C+ ++ R+D LL+H+
Sbjct: 41  YRGQTPSGKPRLFVCEVCTRAFARHEHLIRHERQHTKEKPYHCGVCERKYGRRDLLLRHV 100

Query: 306 KLKH 309
              H
Sbjct: 101 IKMH 104

>KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 768

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317
           H+C  C K F + + L+ H+ SH   KPF C +C  R  +  NL  H++L HT +   E 
Sbjct: 486 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL-HTGEKPYEC 544

Query: 318 QSAG 321
           +  G
Sbjct: 545 EKCG 548

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKH 309
           P QC  C K F +   L+ H+  H+  KP+ C  C  R  RK NL  H +L H
Sbjct: 513 PFQCEYCGKRFTQGGNLRTHVRLHTGEKPYECEKCGRRFSRKGNLAAH-RLTH 564

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKHTPQ 312
           E P++C  C + F RK  L  H L+H ++KPF+C    C     +  N+  H    H  Q
Sbjct: 539 EKPYECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAHQNRFHL-Q 597

Query: 313 VLQEL 317
            L EL
Sbjct: 598 TLNEL 602

>TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1375

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 34/62 (54%)

Query: 248 GQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           G+ P+       C +C ++F R+  L RH  SH+  KP+ C  CQ +  R+D LL+H + 
Sbjct: 34  GKTPSGKVRLFVCSICTRAFARQEHLTRHERSHTKEKPYCCGLCQRKFSRRDLLLRHAQK 93

Query: 308 KH 309
            H
Sbjct: 94  IH 95

>KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.234
           YER169W
          Length = 890

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 260 CHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMKLK 308
           C +C + F     L RH  S HS  KPF+CP C  R KR+D++LQH+  K
Sbjct: 783 CQICKRQFSSGHHLTRHKKSVHSGEKPFSCPKCGKRFKRRDHVLQHLNKK 832

>Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa]
           {ON} YPR186C (PZF1) - Transcription factor IIIA (TFIIIA)
           with putative Zn-fingers [contig 8] FULL
          Length = 429

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 42/96 (43%), Gaps = 17/96 (17%)

Query: 215 YPVDSRGYSDPPHITSQHVASHQRPPAAVQPHQGQNPADPENPHQCHLCDKSFKRKSWLK 274
           Y   S+ +S P  +T      HQ                   P QC +C + F RK+ L+
Sbjct: 54  YEGCSKAFSRPSQLTEHQEVVHQGI----------------KPFQCTVCARQFSRKTHLE 97

Query: 275 RHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHT 310
           RH+ SHS  KPF C +C      K  L +H ++ HT
Sbjct: 98  RHMFSHSEDKPFKCSYCGKGVTTKQQLRRH-EITHT 132

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 17/90 (18%)

Query: 231 QHVASHQRPPAAVQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW 290
           +H  +H R  + V PH+G              C++SF +   L+ H+L+   ++  NC  
Sbjct: 126 RHEITHTR--SFVCPHEG--------------CEESFYKHPQLRAHILAFH-LQKLNCEI 168

Query: 291 CQSRHKRKDNLLQHMKLKHTPQVLQELQSA 320
           C  R +R   L  H+   H P V+Q+ Q +
Sbjct: 169 CGKRFQRPYRLKNHIAKHHNPDVVQKYQCS 198

>TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.326
           YJL056C
          Length = 985

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           E P++C +C KSF   S LK H+ +H+  KPF C  C  R     N  +HMK+
Sbjct: 925 EKPYKCEICGKSFSISSSLKIHVRTHTGEKPFECKVCGKRFVESSNYSKHMKV 977

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 255 ENPHQC--HLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           +N ++C  H C K FK++  + RHL +HS  KPF C  C      K+ L+QH +
Sbjct: 867 KNSYECKWHNCHKVFKQRQKILRHLKTHSGFKPFKCDVCSRCFSSKETLIQHYR 920

>Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON}
           similar to Ashbya gossypii ADL051W
          Length = 223

 Score = 48.1 bits (113), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 260 CHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKL 307
           CH+C KSF RK+ L+ H+L H+ +KP+ C +  C      K NL +H ++
Sbjct: 161 CHICLKSFTRKTSLQTHMLIHTKVKPYRCSYQRCNKTFNVKSNLYRHERI 210

>NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303
          Length = 571

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 50/112 (44%), Gaps = 2/112 (1%)

Query: 198 QEWNRGVFSNPEYPLSVYPVDSRGYSDPPHIT--SQHVASHQRPPAAVQPHQGQNPADPE 255
           +E  R +  N E  L +  + +  +SD    +  S++V   + P  A +           
Sbjct: 390 EEKARSISENREKLLEMADLSTATHSDDDEESNESENVVIEKSPRKARRKSSQTTGRSGS 449

Query: 256 NPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
             + C LCDK+F R   LK HL +H++ KPF C  C     R+ +  +H  L
Sbjct: 450 GAYACELCDKTFTRPYNLKSHLRTHTNEKPFVCNICGKAFARQHDRKRHEDL 501

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 9/61 (14%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNC--------PW-CQSRHKRKDNLLQHM 305
           E P  C++C K+F R+   KRH   H+  K + C        PW C  +  R D L +H 
Sbjct: 477 EKPFVCNICGKAFARQHDRKRHEDLHTGKKRYVCGGVLKNGTPWGCHKKFARSDALGRHF 536

Query: 306 K 306
           K
Sbjct: 537 K 537

>SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 819

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 25/49 (51%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHM 305
           P QC  C K F +   L+ H   H+  KP++C  C  R  RK NL  HM
Sbjct: 567 PFQCEYCGKRFTQGGNLRTHTRLHTGEKPYSCEKCGKRFSRKGNLAAHM 615

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           H+C  C K F + + L+ H+ SH   KPF C +C  R  +  NL  H +L
Sbjct: 540 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHTRL 589

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKHTPQ 312
           E P+ C  C K F RK  L  H+L+H ++KP++C    C     +  NL  H    H  Q
Sbjct: 593 EKPYSCEKCGKRFSRKGNLAAHMLTHENLKPYHCKLDGCSKSFTQLGNLKAHQNRFHL-Q 651

Query: 313 VLQEL 317
            L +L
Sbjct: 652 TLNQL 656

>Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {ON}
           YML081W - Hypothetical ORF [contig 376] FULL
          Length = 1178

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 33/59 (55%)

Query: 252 ADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHT 310
            D   P  C +C + F R+  LKRH  +H++ KPF C +C     R+D +L+H +  H+
Sbjct: 72  TDRPRPFLCSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLHS 130

>TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298
          Length = 511

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKL 307
           + C +C K F+R S LK H+  H+ +KP+ CP+  C      K N+L+H KL
Sbjct: 415 YHCDICHKFFRRPSSLKTHMNIHTGVKPYLCPYNNCYKPFNAKSNMLRHFKL 466

>ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No
           homolog in Saccharomyces cerevisiae
          Length = 173

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 260 CHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKL 307
           C +C KSF RK+ L+ H+L H+  KP+ CP+  C      K NL +H ++
Sbjct: 118 CAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRHERI 167

>SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 359

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMK 306
           +QCH+C K   R S L+ H+L H+ +KP+ C W  C      K N+++H K
Sbjct: 285 NQCHICGKVCSRPSTLRTHVLVHTGVKPYPCEWPGCNRSFNVKSNMIRHYK 335

>KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1155

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%)

Query: 252 ADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTP 311
            D   P  C +C + F R+  LKRH  +H+S KPF C +C     R+D +L+H    H+ 
Sbjct: 48  TDKPRPFLCSICTRGFVRQEHLKRHQRAHTSEKPFLCTFCGRCFARRDLVLRHQHKLHSS 107

Query: 312 QV 313
            +
Sbjct: 108 LI 109

>AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML081W and
           YJR127C (ZMS1)
          Length = 1191

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%)

Query: 252 ADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTP 311
            D   P  C +C + F R+  LKRH  SH++ KPF C +C     R+D +L+H +  H  
Sbjct: 74  TDKPRPFLCPVCTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHAS 133

Query: 312 QVLQE 316
            + Q+
Sbjct: 134 LMDQD 138

>SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 317

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 259 QCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMK 306
           QC +C K   R S LK H L H+   PF CPW  C      K N+L+H K
Sbjct: 259 QCPICGKLCSRPSTLKTHFLIHTGATPFKCPWLNCNKSFNVKSNMLRHYK 308

>KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON}
           similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1128

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 33/59 (55%)

Query: 252 ADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHT 310
            D   P  C +C + F R+  LKRH  +H++ KPF C +C     R+D +L+H +  H+
Sbjct: 26  TDRPRPFLCSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLHS 84

>TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4.351
           YJR127C
          Length = 1199

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%)

Query: 252 ADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQH 304
            D   P+ C +C + F R+  LKRH  SH++ KPF C +C     R+D +L+H
Sbjct: 51  TDKPRPYLCPICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRH 103

>TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON}
           Anc_8.234 YER169W
          Length = 519

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 246 HQGQNPADPENPHQ-CHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQ 303
           H   NP    NP   C  C +SF     L RH  + H + KPF+CP C  R KR+D++LQ
Sbjct: 434 HNTPNPTLMINPSSYCFECRRSFSSSHHLTRHRKTVHLNEKPFSCPKCGKRFKRRDHVLQ 493

Query: 304 HMKLK 308
           H+  K
Sbjct: 494 HLNKK 498

>TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1655

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%)

Query: 252 ADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTP 311
            D   P+ C +C + F R+  L+RH  +H++ KPF C +C     R+D +L+H    H  
Sbjct: 81  TDKPRPYLCQICTRGFVRQEHLRRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHPT 140

Query: 312 QVLQELQSAGVH 323
            +  E   A ++
Sbjct: 141 LISMESTEAKIN 152

>NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON}
           Anc_2.162
          Length = 1064

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKHTPQ 312
           E P++C +CDK F RK  L  H L+H  +KPF C    C     +  N+  H    H  Q
Sbjct: 653 EKPYRCEICDKRFSRKGNLAAHKLTHRDVKPFVCKLDNCNKTFTQLGNMKAHQNKFHL-Q 711

Query: 313 VLQELQS 319
            L EL S
Sbjct: 712 TLLELTS 718

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKH 309
           P QC+ C K F +   L+ H   H+  KP+ C  C  R  RK NL  H KL H
Sbjct: 627 PFQCNFCGKRFTQGGNLRTHQRLHTGEKPYRCEICDKRFSRKGNLAAH-KLTH 678

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           H+C  C + F + + L+ H+ SH   KPF C +C  R  +  NL  H +L
Sbjct: 600 HECPYCHRLFSQSTHLEVHIRSHLGYKPFQCNFCGKRFTQGGNLRTHQRL 649

>CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {ON}
           some similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c or uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 300

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 259 QCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTP 311
           +C +C++ FKR+  LKRH+ S H   +P++C  C     R DNL QH +  + P
Sbjct: 219 KCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQHKRTHNNP 272

>Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W
           (REAL)
          Length = 1324

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 35/63 (55%)

Query: 248 GQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           G+ P+       C +C ++F R+  LKRH  SH++ KP+ C  C     R+D L++H + 
Sbjct: 100 GRTPSGKLRSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQK 159

Query: 308 KHT 310
            H+
Sbjct: 160 IHS 162

>Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii ACR264W
          Length = 775

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317
           H+C  C K F + + L+ H+ SH   KPF C +C  R  +  NL  H++L HT +   E 
Sbjct: 491 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL-HTGERPYEC 549

Query: 318 QSAG 321
              G
Sbjct: 550 DKCG 553

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 25/49 (51%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHM 305
           P QC  C K F +   L+ H+  H+  +P+ C  C  R  RK NL  HM
Sbjct: 518 PFQCEYCGKRFTQGGNLRTHVRLHTGERPYECDKCGKRFSRKGNLAAHM 566

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 30/65 (46%), Gaps = 3/65 (4%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKHTPQ 312
           E P++C  C K F RK  L  H+L+H + KPF C    C     +  N+  H    H  Q
Sbjct: 544 ERPYECDKCGKRFSRKGNLAAHMLTHENHKPFQCKLDDCNKSFTQLGNMKAHQNRFHL-Q 602

Query: 313 VLQEL 317
            L  L
Sbjct: 603 TLNRL 607

>NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {ON}
           Anc_8.425
          Length = 1152

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 36/71 (50%)

Query: 248 GQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           G  P+       C +C ++F R+  L RH  SH++ KP+ C  C  +  R+D LL+H + 
Sbjct: 68  GTTPSGKPRLFVCDVCSRAFARQEHLDRHARSHTNEKPYQCGICTKKFTRRDLLLRHAQK 127

Query: 308 KHTPQVLQELQ 318
            H     + +Q
Sbjct: 128 VHNGNCGETIQ 138

>NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON} 
          Length = 338

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 259 QCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMK 306
           QC +C K   R S LK H L H+   PF CPW  C      K N+L+H+K
Sbjct: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLK 320

>CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1321

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%)

Query: 252 ADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQH 304
            D   PH C +C + F R   LKRH  +H++ KPF C +C     R+D +L+H
Sbjct: 27  TDKPRPHLCPICTRGFVRLEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 79

>YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbon
           source-responsive zinc-finger transcription factor,
           required for transcription of the glucose-repressed gene
           ADH2, of peroxisomal protein genes, and of genes
           required for ethanol, glycerol, and fatty acid
           utilization
          Length = 1323

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 35/63 (55%)

Query: 248 GQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           G+ P+       C +C ++F R+  LKRH  SH++ KP+ C  C     R+D L++H + 
Sbjct: 94  GRTPSGKLRSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQK 153

Query: 308 KHT 310
            H+
Sbjct: 154 IHS 156

>TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543
           YPR186C
          Length = 472

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 240 PAAVQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWC 291
           P+ +  HQ       +N H C +C   F RKS L+RHL+SHS+ KPF+C +C
Sbjct: 91  PSTLTEHQQSIHLGIKN-HSCDVCGSKFSRKSHLERHLISHSAEKPFHCSFC 141

 Score = 33.5 bits (75), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 2/37 (5%)

Query: 254 PENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW 290
            E P  C  CDK    +  LKRH ++HS  K F C +
Sbjct: 132 AEKPFHCSFCDKGLTTRQQLKRHEITHS--KSFQCTF 166

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 53/121 (43%), Gaps = 21/121 (17%)

Query: 259 QCHLCDKSFKRKSWLKRHLLSHSS---IKPFNCPW--CQSRHKRKDNLLQHMKLKHTPQV 313
           +C  C KSF+R   LK HL  H +     P+ C +  C    K    L +H+K  H P+V
Sbjct: 192 KCQFCGKSFQRPYRLKNHLTKHHNPEVENPYPCSYNNCTKNFKTWTALQRHLKNDH-PKV 250

Query: 314 LQELQSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMTSIKTMIDDGTLNKDDV 373
             E+      P V            G++G+   + +H D  ++ + K  I +  L  +D+
Sbjct: 251 RCEVCDK---PCV------------GESGLKMHMKIHDDKLVIKNWKCNICEHELLDEDL 295

Query: 374 K 374
           K
Sbjct: 296 K 296

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 263 CDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHM 305
           C+KSF R S L  H  S H  IK  +C  C S+  RK +L +H+
Sbjct: 84  CNKSFARPSTLTEHQQSIHLGIKNHSCDVCGSKFSRKSHLERHL 127

>ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR113W (AZF1)
          Length = 769

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317
           H+C  C K F + + L+ H+ SH   KPF C +C  R  +  NL  H++L HT +   E 
Sbjct: 487 HKCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL-HTGERPYEC 545

Query: 318 QSAG 321
              G
Sbjct: 546 DKCG 549

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 25/49 (51%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHM 305
           P QC  C K F +   L+ H+  H+  +P+ C  C  R  RK NL  HM
Sbjct: 514 PFQCEYCGKRFTQGGNLRTHVRLHTGERPYECDKCGKRFSRKGNLAAHM 562

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 30/65 (46%), Gaps = 3/65 (4%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKHTPQ 312
           E P++C  C K F RK  L  H+L+H + KPF C    C     +  N+  H    H  Q
Sbjct: 540 ERPYECDKCGKRFSRKGNLAAHMLTHENYKPFQCKLDDCNKSFTQLGNMKAHQNRFHL-Q 598

Query: 313 VLQEL 317
            L  L
Sbjct: 599 TLNRL 603

>Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W
           (REAL)
          Length = 1319

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 35/63 (55%)

Query: 248 GQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           G+ P+       C +C ++F R+  LKRH  SH++ KP+ C  C     R+D L++H + 
Sbjct: 94  GRTPSGKLRSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQK 153

Query: 308 KHT 310
            H+
Sbjct: 154 IHS 156

>KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 307

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 47/99 (47%), Gaps = 5/99 (5%)

Query: 256 NPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNC--PWCQSRHKRKDNLLQHMKLKHTPQV 313
            P +C +C K F R    +RH+ +H+  KP  C  P C  R  R D L +H++   +   
Sbjct: 11  RPFKCDMCGKGFHRLEHKRRHIRTHTGEKPHACNFPGCVKRFSRSDELKRHVRTHMSTSR 70

Query: 314 LQELQSAGVHPIVSNITLINL---ASTAGQNGVPSLVPV 349
            +  + +G  P + +  +++     S  G   +P LVPV
Sbjct: 71  GKSRKRSGSSPALEHPVVVHQLPPISVPGVAQMPPLVPV 109

>AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL056C (ZAP1)
          Length = 661

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           E P  CH C K F   S L+ H+ +H+  KP +C  C  R     NL +HMK+
Sbjct: 569 ERPFHCHYCRKQFSTSSSLRVHIRTHTGEKPLSCTVCGKRFNESSNLSKHMKI 621

 Score = 37.7 bits (86), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 245 PHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQH 304
           PHQG +      P  C  C K+F     L +H+ +HS  +PF+C +C+ +     +L  H
Sbjct: 534 PHQGTHR---HKPCSCPHCPKTFSTDDILAQHIRTHSGERPFHCHYCRKQFSTSSSLRVH 590

Query: 305 MK 306
           ++
Sbjct: 591 IR 592

>TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298
          Length = 833

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCP--WCQSRHKRKDNLLQHMKL 307
           ++C  C K F+R S LK HL  H+ I+PF CP   C      + N+L+H KL
Sbjct: 714 NKCEYCLKKFRRPSSLKTHLNIHTGIQPFKCPSKRCDKSFNARSNMLRHYKL 765

>TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {ON}
           Anc_4.214 YGR067C
          Length = 737

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 30/58 (51%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQ 315
           H C  C ++F R    KRH  SH  +KPF C  C     R+D L +H+K  H   +L+
Sbjct: 5   HVCAFCRRAFSRSEHRKRHERSHQGVKPFQCAVCNHVFVRRDLLKRHIKTVHRAWLLE 62

>TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1207

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%)

Query: 248 GQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQH 304
           G+ P+       C +C ++F R+  L RH  SH+  KP++C  C     R+D LL+H
Sbjct: 49  GKTPSGKPRLFVCQICTRAFARQEHLTRHERSHTKEKPYSCGICNRNFSRRDLLLRH 105

>CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa]
           {ON} weakly similar to uniprot|P07248 Saccharomyces
           cerevisiae YDR216w ADR1 zinc-finger transcription factor
          Length = 1489

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%)

Query: 246 HQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQH 304
           ++G  P+       C  C ++F R+  L RH  SH+  KP+ C  C  R  R+D LL+H
Sbjct: 18  YKGFTPSGKPRLFVCQTCTRAFARQEHLTRHERSHTKEKPYCCGICDRRFTRRDLLLRH 76

>Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W
           (REAL)
          Length = 1323

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 35/63 (55%)

Query: 248 GQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           G+ P+       C +C ++F R+  LKRH  SH++ KP+ C  C     R+D L++H + 
Sbjct: 94  GRTPSGKLRSFVCEVCTRAFARQEHLKRHHRSHTNEKPYPCGLCNRCFTRRDLLIRHAQK 153

Query: 308 KHT 310
            H+
Sbjct: 154 IHS 156

>NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531
          Length = 354

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMK 306
           H+C +CDK   R + L+ HLL H+  KP+ C W  C +    K N+ +H K
Sbjct: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYK 346

>KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081W
          Length = 1332

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%)

Query: 252 ADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTP 311
            D   P  C +C + F R+  L+RH  SH++ KPF C +C     R+D +L+H +  H  
Sbjct: 77  TDRPRPFLCPICTRGFARQEHLRRHERSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHAS 136

Query: 312 QVLQE 316
            + Q+
Sbjct: 137 LMDQD 141

>KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} weakly
           similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1379

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 33/62 (53%)

Query: 248 GQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           G  P+       C +C ++F R+  L RH  SH+  KP+ C  C+ R  R+D L++H + 
Sbjct: 115 GVTPSGKPRLFVCKVCTRAFARQEHLTRHERSHTKEKPYVCGICERRFTRRDLLIRHCQK 174

Query: 308 KH 309
            H
Sbjct: 175 LH 176

>Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056C
           (REAL)
          Length = 879

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           E P++CH+C+K F   S LK H+ +H+  KP  C  C  R     NL +H+K
Sbjct: 792 EKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIK 843

 Score = 37.7 bits (86), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 258 HQC--HLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           +QC  H C ++F ++  L RHL  HS  KP+ C  C+     ++ L+QH +
Sbjct: 737 YQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTR 787

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 28/59 (47%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQ 315
           P++C  C + F  +  L +H  +HS  KP+ C  C  +     +L  H++     + LQ
Sbjct: 766 PYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQ 824

 Score = 30.4 bits (67), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 28/65 (43%), Gaps = 8/65 (12%)

Query: 227 HITSQHVASHQRPPAAVQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPF 286
           HI ++  A        ++ H G      E P QC +C K F   S L +H+ +H   K +
Sbjct: 798 HICNKKFAISSSLKIHIRTHTG------EKPLQCKICGKRFNESSNLSKHIKTHK--KKY 849

Query: 287 NCPWC 291
            C  C
Sbjct: 850 KCSDC 854

>CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} similar
           to uniprot|P46974 Saccharomyces cerevisiae YJR127c ZMS1
           or uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1020

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 34/66 (51%)

Query: 252 ADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTP 311
            D   P  C +C + F R+  LKRH  SH+  KPF C  C     RKD +L+H++  H  
Sbjct: 21  TDKPRPFLCPICSRGFVRQEHLKRHQNSHTHEKPFLCLICGKCFARKDLVLRHLQKLHRD 80

Query: 312 QVLQEL 317
              ++L
Sbjct: 81  YKTEQL 86

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 26/62 (41%), Gaps = 17/62 (27%)

Query: 216 PVDSRGYSDPPHITSQHVASHQRPPAAVQPHQGQNPADPENPHQCHLCDKSFKRKSWLKR 275
           P+ SRG+     +  +H+  HQ            N    E P  C +C K F RK  + R
Sbjct: 30  PICSRGF-----VRQEHLKRHQ------------NSHTHEKPFLCLICGKCFARKDLVLR 72

Query: 276 HL 277
           HL
Sbjct: 73  HL 74

>NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON} 
          Length = 350

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMK 306
           H C +C KS  R + L+ H+L H+  +PF C W  C++    K N+ +H K
Sbjct: 285 HICVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFK 335

>ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 133

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 259 QCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMK 306
           QC +C K   R S LK H L H+   PF C W  CQ     K N+L+H+K
Sbjct: 67  QCPVCGKICSRPSTLKTHFLIHTGDTPFKCTWQNCQKSFNVKSNMLRHLK 116

>YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON}
           ZAP1Zinc-regulated transcription factor; binds to
           zinc-responsive promoters to induce transcription of
           certain genes in presence of zinc, represses other genes
           in low zinc; regulates its own transcription; contains
           seven zinc-finger domains
          Length = 880

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           E P++CH+C+K F   S LK H+ +H+  KP  C  C  R     NL +H+K
Sbjct: 793 EKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIK 844

 Score = 37.7 bits (86), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 258 HQC--HLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           +QC  H C ++F ++  L RHL  HS  KP+ C  C+     ++ L+QH +
Sbjct: 738 YQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTR 788

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 28/59 (47%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQ 315
           P++C  C + F  +  L +H  +HS  KP+ C  C  +     +L  H++     + LQ
Sbjct: 767 PYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQ 825

>AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR186C (PZF1)
          Length = 476

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 37/71 (52%), Gaps = 2/71 (2%)

Query: 240 PAAVQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKD 299
           P+ +  HQ Q        +QC  C + F +KS L+RHL SHS  KPF+C  C      + 
Sbjct: 133 PSLLTEHQ-QTAHQGIRAYQCEQCGRGFTKKSHLERHLFSHSETKPFSCTVCGKGVTTRQ 191

Query: 300 NLLQHMKLKHT 310
            L +H ++ HT
Sbjct: 192 QLRRH-EITHT 201

>TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}
          Length = 224

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 260 CHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQH---MKLKHTPQVLQ 315
           C+ CD  F R+S LKRH  +H S+ P  C  C     RKD+L +H   M+ K   + LQ
Sbjct: 140 CNKCDMEFTRQSDLKRHEKTHMSVGPHICSQCGKDFARKDSLKRHANTMQCKKNREKLQ 198

>CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some
           similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c or uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q03825 Saccharomyces
           cerevisiae YMR164c MSS11
          Length = 344

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 259 QCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMK 306
           QC +C K   R S LK H+L H+   PF C W  C+     K NLL+H+K
Sbjct: 285 QCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLK 334

>NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {ON}
           Anc_4.351
          Length = 1362

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 42/95 (44%), Gaps = 16/95 (16%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQE 316
           P  C  C + F R+  LKRH  SH++ KPF C +C     R+D +L+H    H   +   
Sbjct: 70  PFVCSTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHAALIGTS 129

Query: 317 LQSAGVHPIVSNITLINLASTAGQNGVPSLVPVHG 351
           + S                +++  NG+P  VP  G
Sbjct: 130 MDS--------------YTNSSNNNGIP--VPFQG 148

>ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON}
           NOHBY437; No homolog in Saccharomyces cerevisiae
          Length = 278

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 260 CHLCDKSFKRKSWLKRHLLSHSSIKPFNC--PWCQSRHKRKDNLLQHMKL 307
           C +C +  +R S LK H+L+H+  +PF+C  P C      + N+L+H +L
Sbjct: 206 CKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERL 255

>ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} similar
           to uniprot|P07248 Saccharomyces cerevisiae YDR216W ADR1
           Positive transcriptional regulator controls the
           expression of ADH2 peroxisomal protein genes and genes
           required for ethanol glycerol and fatty acid utilization
          Length = 1346

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%)

Query: 248 GQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQH 304
           G+ P+       C +C ++F R+  L RH  SH+  KP+ C  C  +  R+D LL+H
Sbjct: 76  GRTPSGKPRLFVCQVCTRAFARQEHLTRHERSHTKEKPYCCGICNRKFSRRDLLLRH 132

>KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {ON} 
          Length = 519

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 259 QCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMK 306
           QC +C K   R S LK H + H+   PF CPW  C      K N+ +H+K
Sbjct: 456 QCPVCGKICSRPSTLKTHYMIHTGDTPFKCPWEGCNKSFNVKSNMFRHLK 505

>TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON} 
          Length = 501

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKL 307
           HQC +C++   R   L  H+L H+  KPF C W  C      K NL +HMK+
Sbjct: 426 HQCPICNRVTTRSYSLHAHMLVHTKDKPFKCEWQDCGKAFSIKSNLSRHMKI 477

>Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {ON}
           YPR186C (REAL)
          Length = 407

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (68%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWC 291
           P QC  C KSF +KS L+RHL SHS  KPF C +C
Sbjct: 79  PFQCDKCPKSFVKKSHLERHLYSHSDTKPFQCSYC 113

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 263 CDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHM 305
           CDK+F R S L  H LS H  ++PF C  C     +K +L +H+
Sbjct: 56  CDKAFTRPSILTEHQLSVHQGLRPFQCDKCPKSFVKKSHLERHL 99

>YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putative
           transcription factor containing a C2H2 zinc finger;
           mutation affects transcriptional regulation of genes
           involved in growth on non-fermentable carbon sources,
           response to salt stress and cell wall biosynthesis
          Length = 391

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 24/47 (51%)

Query: 263 CDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKH 309
           C  SF R   L RH+  H+  KPF CP C     R DNL QH +  H
Sbjct: 49  CTMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVH 95

>KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5.586
           YHR006W
          Length = 314

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 12/67 (17%)

Query: 256 NPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQ------------SRHKRKDNLLQ 303
            P  CH CD  F+ + +L RH+  H+  K F CP+ Q                R+D    
Sbjct: 59  EPFVCHYCDARFRMRGYLTRHIKKHAIEKAFRCPFFQRGQPRDLQCHPSGGFSRRDTYKT 118

Query: 304 HMKLKHT 310
           H+K+KH 
Sbjct: 119 HLKVKHV 125

>NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {ON}
           Anc_4.214
          Length = 879

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 41/100 (41%)

Query: 245 PHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQH 304
           P     P   +    C  C K F R     RH  SH+ +KP+ C  C     R D  L+H
Sbjct: 2   PSNSTPPTTFQKRFICSFCAKGFSRAEHKIRHERSHTGLKPYKCKVCTHCFVRSDLALRH 61

Query: 305 MKLKHTPQVLQELQSAGVHPIVSNITLINLASTAGQNGVP 344
           +K  H  ++LQ  +        +     +L +T  ++ VP
Sbjct: 62  IKTVHKKEILQREEIEAEAETENATATRSLGTTGKESNVP 101

>Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113W
           (REAL)
          Length = 909

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKH 309
           E P+ C +CDK F RK  L  HL++H  +KPF C    C     +  N+  H    H
Sbjct: 636 EKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFH 692

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQ 312
           H+C  C + F + + L+ H+ SH   KPF C +C  R  +  NL  H +L HT +
Sbjct: 583 HECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERL-HTGE 636

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHM 305
           P  C  C K F +   L+ H   H+  KP++C  C  +  RK NL  H+
Sbjct: 610 PFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 658

>YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}
           AZF1Zinc-finger transcription factor, involved in
           induction of CLN3 transcription in response to glucose;
           genetic and physical interactions indicate a possible
           role in mitochondrial transcription or genome
           maintenance
          Length = 914

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKH 309
           E P+ C +CDK F RK  L  HL++H  +KPF C    C     +  N+  H    H
Sbjct: 646 EKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFH 702

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           H+C  C + F + + L+ H+ SH   KPF C +C  R  +  NL  H +L
Sbjct: 593 HECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERL 642

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHM 305
           P  C  C K F +   L+ H   H+  KP++C  C  +  RK NL  H+
Sbjct: 620 PFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 668

>Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W
           (REAL)
          Length = 948

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKH 309
           E P+ C +CDK F RK  L  HL++H  +KPF C    C     +  N+  H    H
Sbjct: 677 EKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCDKTFTQLGNMKAHQNRFH 733

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQ 312
           H+C  C + F + + L+ H+ SH   KPF C +C  R  +  NL  H +L HT +
Sbjct: 624 HECPYCHRLFSQATHLEVHVRSHIGYKPFACDYCGKRFTQGGNLRTHERL-HTGE 677

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHM 305
           P  C  C K F +   L+ H   H+  KP++C  C  +  RK NL  H+
Sbjct: 651 PFACDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 699

>SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 899

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%)

Query: 260 CHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQ 315
           C  C K+F R     RH  SH+ +KPF C  C     R+D L +H++  H   +LQ
Sbjct: 10  CSFCAKAFSRSEHRTRHERSHTGVKPFTCTVCAHSFVRRDLLQRHIRTVHRTFLLQ 65

>TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.117
           YPR015C
          Length = 162

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 259 QCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMK 306
           QC +C K   R S LK H L H+   PF C W  C      K N+L+H+K
Sbjct: 102 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCSWGNCTKSFNVKSNMLRHLK 151

>Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C -
           Hypothetical ORF [contig 227] FULL
          Length = 254

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 2/64 (3%)

Query: 246 HQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNC--PWCQSRHKRKDNLLQ 303
           H  ++ A     H+C +C K+F R S L  H L H+  +P+ C  P C  R   K NL++
Sbjct: 182 HTPRSAATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMR 241

Query: 304 HMKL 307
           H K+
Sbjct: 242 HRKI 245

>Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113W
           (REAL)
          Length = 917

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKH 309
           E P+ C +CDK F RK  L  HL++H  +KPF C    C     +  N+  H    H
Sbjct: 647 EKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFH 703

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           H+C  C + F + + L+ H+ SH   KPF C +C  R  +  NL  H +L
Sbjct: 594 HECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERL 643

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHM 305
           P  C  C K F +   L+ H   H+  KP++C  C  +  RK NL  H+
Sbjct: 621 PFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 669

>NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80
          Length = 455

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 2/63 (3%)

Query: 252 ADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNC--PWCQSRHKRKDNLLQHMKLKH 309
            D   PH C +C ++F R     RH+ +H+  KP  C  P C  +  R D L +H ++  
Sbjct: 62  GDAPRPHVCPICQRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTRHKRIHT 121

Query: 310 TPQ 312
            PQ
Sbjct: 122 NPQ 124

>Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON}
           complement(28325..32557) [4233 nt, 1411 aa]
          Length = 1410

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 32/62 (51%)

Query: 248 GQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           G  P+       C +C ++F R+  L RH  SH+  KP+ C  CQ +  R+D LL+H   
Sbjct: 108 GVTPSGKPRLFVCSICTRAFARQEHLTRHERSHTKEKPYCCGICQRKFSRRDLLLRHAHK 167

Query: 308 KH 309
            H
Sbjct: 168 IH 169

>NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {ON} 
          Length = 336

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMK 306
           +N  QC +C K   R S LK H L HS   PF C W  C      K N+L+H K
Sbjct: 252 KNKKQCDICGKICSRPSTLKTHYLIHSGDTPFKCAWKGCTKAFNVKSNMLRHFK 305

>KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {ON}
           Anc_2.531
          Length = 414

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 53/122 (43%), Gaps = 18/122 (14%)

Query: 211 PLSVYPVDSRGYSDPPHITSQHVASHQRPPAAVQPHQGQNPADPE-------NPHQCHLC 263
           P+ + P+ S GY++ P        S+Q        + G  PAD +         +QC +C
Sbjct: 290 PVYLTPIQSCGYANSP-------LSYQN--GIFTSNNGLIPADNQVWTKKVKKKNQCPIC 340

Query: 264 DKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKHTPQVLQELQSAG 321
            K+  R S L  H+  H+  +P+ C W  C      K N+ +H KL    +  Q  QS G
Sbjct: 341 GKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKEQREQSDG 400

Query: 322 VH 323
           V 
Sbjct: 401 VE 402

>KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.162
           YOR113W
          Length = 729

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 22/34 (64%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNC 288
           E P+QC LC K F RK  L  H+L+H  IKPF C
Sbjct: 546 EKPYQCELCGKRFSRKGNLAAHVLTHKKIKPFIC 579

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNL----LQHMKLK 308
           P+QC  C K F +   L+ H   H+  KP+ C  C  R  RK NL    L H K+K
Sbjct: 520 PYQCQYCGKKFTQGGNLRTHERLHTGEKPYQCELCGKRFSRKGNLAAHVLTHKKIK 575

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           H+C  C + F + + L+ H+ SH  IKP+ C +C  +  +  NL  H +L
Sbjct: 493 HECRYCHRFFTQLTHLEVHIRSHIGIKPYQCQYCGKKFTQGGNLRTHERL 542

>KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {ON}
           some similarities with uniprot|P32805 Saccharomyces
           cerevisiae YGL254W FZF1 Transcription factor involved in
           sulfite metabolism sole identified regulatory target is
           SSU1 overexpression suppresses sulfite-sensitivity of
           many unrelated mutants due to hyperactivation of SSU1
           contains five zinc fingers
          Length = 206

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 43/95 (45%), Gaps = 17/95 (17%)

Query: 214 VYPVDSRG--YSDPPHITSQHVASHQRPPAAVQPHQGQNPADPENPHQCHLCDKSFKRKS 271
           V P++S G  YS P  +  QHV SH        P  G              CDK+F R S
Sbjct: 9   VCPIESCGKKYSRPC-LLRQHVRSHTNEKPFHCPEPG--------------CDKAFLRPS 53

Query: 272 WLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMK 306
            L+ H+LSHS +KP+NC  C      K    +H +
Sbjct: 54  HLRVHMLSHSKVKPYNCSVCGKGFATKQQFQRHQQ 88

>Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {ON}
           YNL027W (CRZ1) - putative transcription factor [contig
           27] FULL
          Length = 531

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQ 312
           + C LCDK F R   LK HL +H+  +PF+C  C     R+ +  +H  L HT Q
Sbjct: 413 YACELCDKKFTRPYNLKSHLRTHTDERPFSCAICGKAFARQHDRKRHEDL-HTGQ 466

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 9/72 (12%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNC--------PW-CQSRHKRKDNLLQHM 305
           E P  C +C K+F R+   KRH   H+  K + C         W C  +  R D L +H 
Sbjct: 438 ERPFSCAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEWGCGKKFARSDALGRHF 497

Query: 306 KLKHTPQVLQEL 317
           K +   + +  L
Sbjct: 498 KTEGGKRCIAPL 509

>Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON}
           complement(48007..48672) [666 nt, 222 aa]
          Length = 221

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKHT 310
           E P+ C +C++ F R    KRHL  H+  KP+ C +  C  +  R D L +H K+ H+
Sbjct: 16  ERPYLCEVCNRGFYRLEHKKRHLKIHTGEKPYKCLYLNCSKKFSRSDELNRHSKVHHS 73

>Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {ON}
           YJL056C (REAL)
          Length = 885

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 7/82 (8%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHM-------KL 307
           E P++C +C+K F   S LK H+ +H+  KP  C  C  R     NL +H+       K 
Sbjct: 796 EKPYKCDICNKKFSISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHKKKYKC 855

Query: 308 KHTPQVLQELQSAGVHPIVSNI 329
            H P+   +L     H +  ++
Sbjct: 856 SHCPKSFDDLAKLNSHEMKCSL 877

 Score = 37.7 bits (86), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 258 HQC--HLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMK 306
           +QC  H C ++F ++  L RHL  HS  KP+ C  C+     ++ L+QH +
Sbjct: 741 YQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTR 791

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 28/59 (47%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQ 315
           P++C  C + F  +  L +H  +HS  KP+ C  C  +     +L  H++     + LQ
Sbjct: 770 PYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCDICNKKFSISSSLKIHIRTHTGEKPLQ 828

>TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 251 PAD-PENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMK 306
           PAD  E P +C LC + F R    KRH+ +H+  KP  C +  C     R D L +H++
Sbjct: 9   PADNEERPFKCELCSRGFHRLEHKKRHIRTHTGEKPHRCTFGSCGKSFSRSDELKRHLR 67

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 2/29 (6%)

Query: 255 ENPHQCHL--CDKSFKRKSWLKRHLLSHS 281
           E PH+C    C KSF R   LKRHL +H+
Sbjct: 42  EKPHRCTFGSCGKSFSRSDELKRHLRTHA 70

>KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {ON}
           weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C
          Length = 423

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 254 PENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMK 306
           P   +QCH+C +   R S L+ HL  H+  KP+ CP   C  R   K N+L+H K
Sbjct: 337 PLKKNQCHICGRICSRPSTLQTHLSIHTGDKPYKCPKRNCHKRFNVKSNMLRHYK 391

>Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W
           (REAL)
          Length = 916

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 37/64 (57%), Gaps = 3/64 (4%)

Query: 260 CHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQELQ 318
           C  C++ F     L RH  S HS  KP +CP C  R KR+D++LQH+  K  P   QE++
Sbjct: 852 CRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLN-KKIP-CTQEME 909

Query: 319 SAGV 322
           +A V
Sbjct: 910 NAKV 913

>ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 616

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVL 314
           +  + C  C K+F R     RH  SH+ +KPF C  C+    R+D L +H++  H   +L
Sbjct: 5   QRKYVCSFCSKAFSRSEHRARHERSHTGMKPFECKVCRHAFVRRDLLQRHIRTVHRELLL 64

Query: 315 QE 316
            +
Sbjct: 65  MK 66

>Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar to
           Ashbya gossypii AFL136W
          Length = 460

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 24/47 (51%)

Query: 263 CDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKH 309
           CD SF R   L RH+  H+  KPF C  C     R DNL QH +  H
Sbjct: 28  CDMSFTRAEHLARHIRKHTGEKPFQCEVCNRFFSRIDNLKQHRESVH 74

>Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]
           {ON} complement(246366..247520) [1155 nt, 385 aa]
          Length = 384

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 256 NPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHT 310
            P +C  CD +F +KS L+RHL SHSS KPF C  C      +  L +H ++ HT
Sbjct: 71  KPFKCDQCDSAFSKKSHLERHLFSHSSEKPFTCAVCNKGLTTRQQLKRH-EITHT 124

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 263 CDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHM 305
           CDK+F R   L  H  S H  IKPF C  C S   +K +L +H+
Sbjct: 49  CDKAFSRPVLLTDHQQSVHLRIKPFKCDQCDSAFSKKSHLERHL 92

 Score = 30.4 bits (67), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 2/35 (5%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCP 289
           E P  C +C+K    +  LKRH ++H+  K F CP
Sbjct: 98  EKPFTCAVCNKGLTTRQQLKRHEITHT--KSFVCP 130

>Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W
           (REAL)
          Length = 392

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 24/47 (51%)

Query: 263 CDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKH 309
           C  SF R   L RH+  H+  KPF CP C     R DNL QH +  H
Sbjct: 52  CAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVH 98

>KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 782

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 1/63 (1%)

Query: 259 QCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQELQ 318
           QC  C K F + + L+ H+ SH   KPF+C +C  R  +  NL  H++L HT +   E +
Sbjct: 524 QCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEFCGKRFTQGGNLRTHIRL-HTGEKPYECE 582

Query: 319 SAG 321
             G
Sbjct: 583 RCG 585

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 1/53 (1%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKH 309
           P  C  C K F +   L+ H+  H+  KP+ C  C  +  RK NL  H KL H
Sbjct: 550 PFSCEFCGKRFTQGGNLRTHIRLHTGEKPYECERCGRKFSRKGNLAAH-KLTH 601

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 3/65 (4%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKHTPQ 312
           E P++C  C + F RK  L  H L+H ++KPF C    C     +  N+  H    H  Q
Sbjct: 576 EKPYECERCGRKFSRKGNLAAHKLTHDNLKPFECKLDDCNKNFTQLGNMKAHQNRFHL-Q 634

Query: 313 VLQEL 317
            L  L
Sbjct: 635 TLNRL 639

>NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa]
           {ON} Anc_7.543
          Length = 433

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 24/35 (68%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWC 291
           P +C  CDK F RK+ L+RHL+SHS  KPF C  C
Sbjct: 87  PFKCEQCDKQFSRKTHLERHLISHSDSKPFCCLHC 121

 Score = 37.4 bits (85), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 263 CDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHM 305
           C K+F R S L  H L+ H  IKPF C  C  +  RK +L +H+
Sbjct: 64  CTKAFTRPSLLSEHQLTFHQGIKPFKCEQCDKQFSRKTHLERHL 107

>Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W
           (REAL)
          Length = 398

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 24/47 (51%)

Query: 263 CDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKH 309
           C  SF R   L RH+  H+  KPF CP C     R DNL QH +  H
Sbjct: 49  CAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVH 95

>Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON}
           similar to Ashbya gossypii ADL050W
          Length = 179

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 254 PENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNC--PWCQSRHKRKDNLLQHMKLKHTP 311
           P     C +C K F RK+ L  HLL H+ I+P+ C  P C+     K NL +H+K+ H  
Sbjct: 105 PLTDKTCPVCLKEFTRKTSLNTHLLIHADIRPYRCKYPDCKKTFNVKSNLNRHLKI-HKK 163

Query: 312 QVLQ 315
           Q L+
Sbjct: 164 QELK 167

>KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.144
           YER130C
          Length = 225

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 4/69 (5%)

Query: 247 QGQNPA---DPENPHQCHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLL 302
           +G+ P+   D      C  C + F+R+  +KRH+ S H + KP++C  C     R DNL 
Sbjct: 157 RGRKPSLVDDGTKKFACQYCHRRFRRQEHMKRHIRSLHIAEKPYSCQICSKAFSRNDNLK 216

Query: 303 QHMKLKHTP 311
           QH K    P
Sbjct: 217 QHRKTHKMP 225

>Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa]
           {ON} YGL209W (MIG2) - 1:1 [contig 188] FULL
          Length = 266

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNC--PWCQSRHKRKDNLLQHMKLKHTPQVL 314
           P +C +C K F R    +RH+ +H+  KP +C  P C  R  R D L +H++   +    
Sbjct: 13  PFKCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVRTHMSTSRG 72

Query: 315 QELQSAGVHPIVSNITLI 332
           +  + +G  P++ +  ++
Sbjct: 73  KGRKRSGSSPVLEHPVVV 90

>TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCP--WCQSRHKRKDNLLQHMKL 307
           + C++C K FKR S L  H+  H+  KP+ CP   C      K N+L+H KL
Sbjct: 270 YDCNICGKKFKRPSSLNTHMNIHTGQKPYRCPHISCSKAFNAKSNMLRHYKL 321

>KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518
           YGL209W
          Length = 439

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 253 DPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNC--PWCQSRHKRKDNLLQHMK 306
           D   P++C +C + F R    KRHL +H+  KP  C  P C     R D L +H++
Sbjct: 15  DENRPYKCGICSRGFHRLEHKKRHLRTHTGEKPHKCVFPGCTKGFSRGDELKRHLR 70

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 2/31 (6%)

Query: 255 ENPHQCHL--CDKSFKRKSWLKRHLLSHSSI 283
           E PH+C    C K F R   LKRHL +H+ I
Sbjct: 45  EKPHKCVFPGCTKGFSRGDELKRHLRTHTGI 75

>NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON} 
          Length = 273

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 259 QCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMK 306
           QC +C K   R S LK H L H+   PF C W  C      K N+L+HMK
Sbjct: 210 QCSVCGKVCSRPSTLKTHFLIHTGDTPFKCSWEGCHKAFNVKSNMLRHMK 259

>CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly
           similar to uniprot|Q03833 Saccharomyces cerevisiae
           YDR096w GIS1 DNA damage-responsive repressor of PHR1
          Length = 625

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 2/53 (3%)

Query: 260 CHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTP 311
           C +CD +F     L RH  S HS+ KP+NCP C    KRKD++ QH+K K TP
Sbjct: 564 CEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK-KKTP 615

 Score = 30.4 bits (67), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 23/56 (41%)

Query: 222 YSDPPHITSQHVASHQRPPAAVQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHL 277
           YSD        +  H  P +        +    E P+ C +C K FKRK  + +HL
Sbjct: 555 YSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHL 610

>KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1290

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%)

Query: 248 GQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           G  P+       C +C ++F R   L+RH  SH++ KP+ C  C     R+D LL+H   
Sbjct: 65  GVTPSGKPRRFVCKVCTRAFARSEHLERHERSHTNEKPYECGICDRMFTRRDLLLRHALK 124

Query: 308 KH 309
            H
Sbjct: 125 TH 126

>Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON}
           YPL230W (REAL)
          Length = 386

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 24/47 (51%)

Query: 263 CDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKH 309
           C  SF R   L RH+  H+  KPF CP C     R DNL QH +  H
Sbjct: 49  CAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVH 95

>Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {ON}
           similar to Ashbya gossypii AEL278W
          Length = 431

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 38/72 (52%), Gaps = 7/72 (9%)

Query: 243 VQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLL 302
           V  HQG  P      ++C  CD++F +KS L+RH  SHS  KPF+C  C      +  L 
Sbjct: 72  VSVHQGIKP------YKCTECDRAFVKKSHLERHFFSHSDKKPFSCSKCGKGVTTRQQLA 125

Query: 303 QHMKLKHTPQVL 314
           +H ++ HT   +
Sbjct: 126 RH-EITHTKSFV 136

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 263 CDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHM 305
           CDKSF R S L  H +S H  IKP+ C  C     +K +L +H 
Sbjct: 57  CDKSFNRPSLLTEHQVSVHQGIKPYKCTECDRAFVKKSHLERHF 100

>Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa]
           {ON} complement(131384..133768) [2385 nt, 795 aa]
          Length = 794

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNL----LQHMKLK 308
           P QC  C K F +   L+ H   H+  +P++C  C  +  RK NL    L H KLK
Sbjct: 535 PFQCEYCGKRFTQGGNLRTHQRLHTGERPYSCELCGKKFSRKGNLAAHFLTHQKLK 590

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           H+C  C + F + + L+ H+ SH   KPF C +C  R  +  NL  H +L
Sbjct: 508 HECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHQRL 557

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 2/63 (3%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKHTPQ 312
           E P+ C LC K F RK  L  H L+H  +KP+ C    C     +  N+  H    H   
Sbjct: 561 ERPYSCELCGKKFSRKGNLAAHFLTHQKLKPYVCKLDECNKSFTQLGNMKAHQNRFHLNT 620

Query: 313 VLQ 315
           +++
Sbjct: 621 LME 623

>TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON}
           Anc_2.303 YNL027W
          Length = 762

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 38/83 (45%), Gaps = 12/83 (14%)

Query: 233 VASHQRPPAAVQPHQG--------QNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIK 284
           V SH R    +Q   G        +NPA     + C LCDK F R   LK HL +H++ +
Sbjct: 622 VESHLREGETLQNLTGTTKKRLSQKNPA----IYACELCDKKFTRPYNLKSHLRTHTNER 677

Query: 285 PFNCPWCQSRHKRKDNLLQHMKL 307
           PF C  C     R+ +  +H  L
Sbjct: 678 PFICSICNKAFARQHDRKRHEDL 700

 Score = 37.0 bits (84), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 33/78 (42%), Gaps = 9/78 (11%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNC--------PW-CQSRHKRKDNLLQHM 305
           E P  C +C+K+F R+   KRH   H+  K + C         W C  +  R D L +H 
Sbjct: 676 ERPFICSICNKAFARQHDRKRHEDLHTGKKRYICGGKLKNGTSWGCGKKFARSDALGRHF 735

Query: 306 KLKHTPQVLQELQSAGVH 323
           K +   + +  L     H
Sbjct: 736 KTESGKRCIAPLYEEATH 753

>AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR067C
          Length = 838

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVL 314
           +  + C  C ++F R     RH  SH+ +KPF+C  C     R+D L +H++  H   +L
Sbjct: 5   QRKYICSFCAQAFSRSEHKTRHERSHTGVKPFSCKVCNHSFVRRDLLQRHIRTVHRSMLL 64

Query: 315 Q 315
           +
Sbjct: 65  E 65

>KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.234
           YER169W
          Length = 875

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 260 CHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMKLK 308
           C  C + F     L RH  S HS  KP++CP C  R KR+D++LQH+  K
Sbjct: 762 CQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKRFKRRDHVLQHLNKK 811

>Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {ON}
           similar to Ashbya gossypii AFR580C
          Length = 938

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVL 314
           +  + C  C ++F R     RH  SH+ +KPF+C  C     R+D L +H++  H   +L
Sbjct: 5   QRKYICCFCARAFSRSEHRTRHERSHTGVKPFSCKVCSHSFVRRDLLQRHIRTVHRSMLL 64

Query: 315 QELQ 318
            ELQ
Sbjct: 65  -ELQ 67

>NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON}
           Anc_3.298
          Length = 370

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKL 307
           + C  C+K FKR S L  H+  H+  KP+ CP+  C+     K N+L+H KL
Sbjct: 258 YGCKHCNKRFKRPSSLNTHMNIHTGNKPYVCPYEECRKSFNAKSNMLRHYKL 309

>KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.162
           YOR113W
          Length = 796

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%)

Query: 249 QNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKL 307
           Q P   +  H+C  C   F + + L+ H+ SH   KPF C +C  R  +  NL  H +L
Sbjct: 463 QTPQQQQKKHECPYCHHKFAQTTHLEVHVRSHLGYKPFECQFCGKRFTQGGNLRTHQRL 521

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 23/48 (47%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQH 304
           P +C  C K F +   L+ H   H+  KP+ C  C  R  RK NL  H
Sbjct: 499 PFECQFCGKRFTQGGNLRTHQRLHTGEKPYACQHCSKRFSRKGNLAAH 546

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 2/63 (3%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKHTPQ 312
           E P+ C  C K F RK  L  H L+H  +KPF C    C     +  N+  H    H+  
Sbjct: 525 EKPYACQHCSKRFSRKGNLAAHQLTHREVKPFLCKLDNCGKTFAQLGNMKNHQNRFHSQT 584

Query: 313 VLQ 315
           VL+
Sbjct: 585 VLE 587

>KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.80
           YGL035C
          Length = 459

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNC--PWCQSRHKRKDNLLQHMKLKHTP 311
           PH C +C ++F R     RH+ +H+  KP  C  P C  R  R D L +H ++   P
Sbjct: 42  PHVCPVCGRAFHRLEHQTRHMRTHTGEKPHACDFPGCTKRFSRSDELTRHKRIHTNP 98

>SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]
           {ON} similar to uniprot|P39933 Saccharomyces cerevisiae
           YPR186C PZF1 Transcription factor IIIA (TFIIIA) with
           putative Zn-fingers
          Length = 437

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 1/64 (1%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQE 316
           P +C  C+++F +KS L+RH+ +HS  KPF+C +C      K  L +H ++ HT     E
Sbjct: 85  PFKCDHCERTFAKKSHLERHMFTHSDNKPFHCSYCGKGVTTKQQLKRH-EITHTKSFKCE 143

Query: 317 LQSA 320
            +  
Sbjct: 144 YEGC 147

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 263 CDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHM 305
           C+KSF R S L  H L+ H  IKPF C  C+    +K +L +HM
Sbjct: 62  CNKSFTRPSLLTEHQLTVHQGIKPFKCDHCERTFAKKSHLERHM 105

>CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} similar
           to uniprot|P27705 Saccharomyces cerevisiae YGL035c MIG1
           transcriptional repressor
          Length = 424

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 6/77 (7%)

Query: 241 AAVQPHQGQNPA----DPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNC--PWCQSR 294
            +  P+ G++ A    D   PH C +C ++F R     RH+ +H+  KP  C  P C  R
Sbjct: 22  GSSTPNSGKSKAGKGDDAPRPHVCPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKR 81

Query: 295 HKRKDNLLQHMKLKHTP 311
             R D L +H ++   P
Sbjct: 82  FSRSDELTRHRRIHTNP 98

>Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON}
           YER028C (REAL)
          Length = 388

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 50/117 (42%), Gaps = 12/117 (10%)

Query: 247 QGQNPAD-PENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQ 303
           Q   PAD  + P +C +C + F R    KRH+ +H+  KP  C +  C     R D L +
Sbjct: 5   QNSFPADNDQRPFRCEICSRGFHRLEHKKRHVRTHTGEKPHKCSFQSCPKSFSRGDELKR 64

Query: 304 HMKLKHTPQVLQE--------LQSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGD 352
           H++  HT  V +         LQ + V    +  T +   + A     P L+ V  D
Sbjct: 65  HLR-THTNTVKKRSRRLKSKGLQKSAVDAATTISTTVKEQTRAASEISPVLISVAQD 120

>TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {ON}
           Anc_2.162 YOR113W
          Length = 714

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 27/56 (48%), Gaps = 4/56 (7%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNL----LQHMKLK 308
           P QC  C K F +   L+ H   H+  KP+ C  C  R  RK NL    + H KLK
Sbjct: 451 PFQCQYCGKRFTQGGNLRTHQRLHTGEKPYECELCGKRFSRKGNLAAHVVTHQKLK 506

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317
           H+C  C + F + + L+ H+ SH   KPF C +C  R  +  NL  H +L HT +   E 
Sbjct: 424 HECPYCHRFFTQSTHLEVHVRSHIGYKPFQCQYCGKRFTQGGNLRTHQRL-HTGEKPYEC 482

Query: 318 QSAG 321
           +  G
Sbjct: 483 ELCG 486

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 31/65 (47%), Gaps = 3/65 (4%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKHTPQ 312
           E P++C LC K F RK  L  H+++H  +KPF C    C     +  N+  H    H   
Sbjct: 477 EKPYECELCGKRFSRKGNLAAHVVTHQKLKPFICKLDGCNKTFTQLGNMKAHQNRFHL-N 535

Query: 313 VLQEL 317
            L EL
Sbjct: 536 TLNEL 540

>ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} similar
           to uniprot|P39956 Saccharomyces cerevisiae YER169W RPH1
           Transcriptional repressor of PHR1 which is a photolyase
           induced by DNA damage binds to AG(4) (C(4)T) sequence
           upstream of PHR1 Rph1p phosphorylation during DNA damage
           is under control of the MEC1-RAD53 pathway
          Length = 867

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 260 CHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMKLK 308
           C  C + F     L RH  S HS  KP++CP C  + KR+D++LQH+  K
Sbjct: 790 CQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKK 839

>TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.234
           YER169W
          Length = 967

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 260 CHLCDKSFKRKSWLKRHLLS-HSSIKPFNCPWCQSRHKRKDNLLQHMKLK 308
           C  C + F     L RH  S HS  KP +CP C  R KR+D++LQH+  K
Sbjct: 861 CQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 910

>TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 45/95 (47%), Gaps = 6/95 (6%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCP--WCQSRHKRKDNLLQHMKLKHTPQ 312
           E P +C +C + F R    KRH+ +H+  KP  CP   C     R D L +HMK+   P 
Sbjct: 13  ERPFKCPMCHRGFYRAEHKKRHIRTHTGEKPHLCPILGCNKSFSRTDELKRHMKVH--PA 70

Query: 313 VLQELQSAGVHPI-VSNITLINLASTAGQNGVPSL 346
               L S     + +SN T+ ++ S    N V +L
Sbjct: 71  STHNLHSTSTTSLNISNSTM-SMTSLLQSNSVSNL 104

>Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {ON}
           YPR186C (REAL)
          Length = 432

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 23/33 (69%)

Query: 259 QCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWC 291
           QC  C KSF +KS L+RHL SHS  KPF C +C
Sbjct: 84  QCDKCPKSFVKKSHLERHLYSHSDTKPFQCSYC 116

>KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON}
           Anc_5.586 YHR006W
          Length = 442

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 41/94 (43%), Gaps = 19/94 (20%)

Query: 228 ITSQHVASHQRPPAAVQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFN 287
           IT + +AS    P    P   +N  + E    CH CD  FK + +L RH+  H+  K F 
Sbjct: 99  ITPESIAS----PKDFTP---ENKKNDEEAFICHYCDAKFKIRGYLTRHIRKHAIEKAFK 151

Query: 288 CPW----------CQSR--HKRKDNLLQHMKLKH 309
           CP+          C S     R+D    H+K +H
Sbjct: 152 CPYFNATLPKTLRCHSTGGFSRRDTFKIHLKSRH 185

>ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 930

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 31/65 (47%), Gaps = 3/65 (4%)

Query: 255 ENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKHTPQ 312
           E P++C LC K F RK  L  H+++H  +KPF C    C     +  N+  H    H   
Sbjct: 615 EKPYECELCGKRFSRKGNLAAHIVTHQKLKPFVCKLDGCNKTFTQLGNMKAHQNRFHL-N 673

Query: 313 VLQEL 317
            L EL
Sbjct: 674 TLNEL 678

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 23/49 (46%)

Query: 257 PHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHM 305
           P  C  C K F +   L+ H   H+  KP+ C  C  R  RK NL  H+
Sbjct: 589 PFLCECCGKRFTQGGNLRTHQRLHTGEKPYECELCGKRFSRKGNLAAHI 637

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 1/64 (1%)

Query: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317
           H+C  C + F + + L+ H+ SH   KPF C  C  R  +  NL  H +L HT +   E 
Sbjct: 562 HECPYCHRFFTQSTHLEVHVRSHIGYKPFLCECCGKRFTQGGNLRTHQRL-HTGEKPYEC 620

Query: 318 QSAG 321
           +  G
Sbjct: 621 ELCG 624

>NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {ON}
           Anc_3.518
          Length = 524

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 251 PAD-PENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNC--PWCQSRHKRKDNLLQHMK 306
           PAD  E P +C +C + F R    KRH+ +H+  KP +C  P C     R D L +H++
Sbjct: 10  PADNDERPFKCDVCSRGFHRLEHKKRHMRTHTGEKPHHCNFPGCGKSFSRSDELKRHLR 68

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%), Gaps = 2/30 (6%)

Query: 255 ENPHQCHL--CDKSFKRKSWLKRHLLSHSS 282
           E PH C+   C KSF R   LKRHL +H+S
Sbjct: 43  EKPHHCNFPGCGKSFSRSDELKRHLRTHTS 72

>Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 259 QCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMK 306
           QC +C K   R S LK H L H+   PF C W  C      K N+L+H+K
Sbjct: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLK 304

>Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 259 QCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMK 306
           QC +C K   R S LK H L H+   PF C W  C      K N+L+H+K
Sbjct: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLK 304

>Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON}
           YER028C (REAL)
          Length = 394

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 46/112 (41%), Gaps = 6/112 (5%)

Query: 248 GQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHM 305
           G +  +   P +C +C + F R    KRH+ +H+  KP+ C    C     R D L +H 
Sbjct: 7   GFSSDNDRRPFRCEICSRGFHRLEHKKRHVRTHTGEKPYKCSSKNCTKSFSRSDELKRHF 66

Query: 306 KLKHTPQVLQE---LQSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMS 354
           +  HT  V +    L+S G    V     I  A+      V S    H  +S
Sbjct: 67  RT-HTRTVQRRPRGLRSKGCQKTVVETNNIISATFNDNTRVSSTTTSHSKIS 117

>YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON}
           Putative zinc finger protein; YPR013C is not an
           essential gene
          Length = 317

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 259 QCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMK 306
           QC +C K   R S LK H L H+   PF C W  C      K N+L+H+K
Sbjct: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLK 304

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.130    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,496,171
Number of extensions: 1187713
Number of successful extensions: 5402
Number of sequences better than 10.0: 654
Number of HSP's gapped: 5114
Number of HSP's successfully gapped: 953
Length of query: 388
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 277
Effective length of database: 40,753,473
Effective search space: 11288712021
Effective search space used: 11288712021
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)