Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0A09460g2.532ON24024012511e-177
NCAS0D026402.532ON2602494318e-52
NDAI0I022702.532ON2772724328e-52
TPHA0C041802.532ON2642573849e-45
KAFR0A018502.532ON2562523812e-44
Kwal_26.80162.532ON2402483653e-42
KLTH0D06820g2.532ON2602613646e-42
Kpol_1018.342.532ON2922653607e-41
CAGL0K02981g2.532ON2782313466e-39
TDEL0A030602.532ON2442253166e-35
KNAG0C058202.532ON2711872924e-31
YMR069W (NAT4)2.532ON2852492926e-31
Smik_13.2482.532ON2552492844e-30
TBLA0G022202.532ON2782732655e-27
Skud_13.2252.532ON2542482425e-24
ZYRO0B01980g2.532ON1881562308e-23
Ecym_72562.532ON2432402121e-19
Suva_13.2442.532ON2571531893e-16
KLLA0E18569g2.532ON2151641125e-06
NDAI0F02330na 1ON14839653.7
NDAI0F02210na 2ON14839653.7
Agos_YGOB_Anc_2.5322.532ON187133647.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0A09460g
         (240 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly ...   486   e-177
NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON...   170   8e-52
NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.53...   171   8e-52
TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.53...   152   9e-45
KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.53...   151   2e-44
Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W ...   145   3e-42
KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some si...   144   6e-42
Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {...   143   7e-41
CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly...   137   6e-39
TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.53...   126   6e-35
KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {...   117   4e-31
YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N alph...   117   6e-31
Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W...   114   4e-30
TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.53...   106   5e-27
Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W...    98   5e-24
ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some si...    93   8e-23
Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON} ...    86   1e-19
Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)...    77   3e-16
KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa] ...    48   5e-06
NDAI0F02330 Chr6 complement(560955..561401) [447 bp, 148 aa] {ON}      30   3.7  
NDAI0F02210 Chr6 (535857..536303) [447 bp, 148 aa] {ON}                30   3.7  
Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187...    29   7.3  

>SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069W NAT4 N alpha-acetyl-transferase involved in
           acetylation of the N-terminal residues of histones H4
           and H2A
          Length = 240

 Score =  486 bits (1251), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 240/240 (100%), Positives = 240/240 (100%)

Query: 1   MVDYPANVLLPYVLDSFPTSITLKDGSLATRKVLVIDEPSSGIAPSGQVCTWSGDRQSSN 60
           MVDYPANVLLPYVLDSFPTSITLKDGSLATRKVLVIDEPSSGIAPSGQVCTWSGDRQSSN
Sbjct: 1   MVDYPANVLLPYVLDSFPTSITLKDGSLATRKVLVIDEPSSGIAPSGQVCTWSGDRQSSN 60

Query: 61  SLLIQFLKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYFQGVSPLMFL 120
           SLLIQFLKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYFQGVSPLMFL
Sbjct: 61  SLLIQFLKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYFQGVSPLMFL 120

Query: 121 SFLLTDEPDFLPDPVKVVYLYEIQLLPEVQGQRLGTQMLQVYLKNTVHSLSRLDPLLKGI 180
           SFLLTDEPDFLPDPVKVVYLYEIQLLPEVQGQRLGTQMLQVYLKNTVHSLSRLDPLLKGI
Sbjct: 121 SFLLTDEPDFLPDPVKVVYLYEIQLLPEVQGQRLGTQMLQVYLKNTVHSLSRLDPLLKGI 180

Query: 181 ELTVFSDNDAALHLYYSIGMALAPGSPTDEIATSQRRTRHSTTDLQTVSRPDYYLMFLPV 240
           ELTVFSDNDAALHLYYSIGMALAPGSPTDEIATSQRRTRHSTTDLQTVSRPDYYLMFLPV
Sbjct: 181 ELTVFSDNDAALHLYYSIGMALAPGSPTDEIATSQRRTRHSTTDLQTVSRPDYYLMFLPV 240

>NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON}
           Anc_2.532 YMR069W
          Length = 260

 Score =  170 bits (431), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 106/249 (42%), Positives = 148/249 (59%), Gaps = 22/249 (8%)

Query: 13  VLDSFPTS--ITLKDG-SLATRKVLVI--DEPSSGIAPSGQVCTWSGDRQSSNSLLIQFL 67
           +L+ FP +  +TL++      RK+L+I  D  +SG   S  V          + +L QFL
Sbjct: 11  ILEEFPLTLEVTLQEQLKCLKRKILIIEPDNCTSG-KNSQDVVYMKCSTDQGDKMLDQFL 69

Query: 68  KVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYFQGVS--PLMFLSFLLT 125
            +LD+NLG KY  VS  +Y N R W  NKLEEM++ GLVYV Y+   S  P++FLSF+LT
Sbjct: 70  DILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESDEPMLFLSFMLT 129

Query: 126 DEPDFLPDP--VKVVYLYEIQLLPEVQGQRLGTQMLQVYLKNTVHSLSR-----LDPLLK 178
           +E  F  D   + VVYLYEIQ+LP ++ ++LGT++L  +L++    L       L+  L 
Sbjct: 130 EEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSENGELLEYPLI 189

Query: 179 GIELTVFSDNDAALHLYYSIGMALAPGSPTDEIAT-SQRRTRHSTTDLQT------VSRP 231
           GIELTVFSDN+ A+  Y SIGM L P SP D +A   +RRTR    ++ T      V +P
Sbjct: 190 GIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTRGMAQNISTSVGRTIVQKP 249

Query: 232 DYYLMFLPV 240
            YYL +LP+
Sbjct: 250 IYYLFYLPL 258

>NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.532
           YMR069W
          Length = 277

 Score =  171 bits (432), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 110/272 (40%), Positives = 151/272 (55%), Gaps = 39/272 (14%)

Query: 6   ANVLLPYVLDSFPTSITLKDGSLATRKVL----VIDEPSSGIAPSGQVCTWSGDRQSSNS 61
           ++ LL  V + FPT +   DG    R+ +      DE S  I  S +V   S D Q  + 
Sbjct: 6   SDALLNIVCEEFPTILQSADGVTTWRRRIHHKPSHDEVSIPIEHSSEVYNLSSDPQQRSD 65

Query: 62  LLIQFLKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYF--QGVSPLMF 119
           +L +FL +LD+NLG+KY  VS T+Y N +SW  NKLEEM + GL+YV Y+  +   PL+F
Sbjct: 66  VLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYWDEKYQEPLLF 125

Query: 120 LSFLLT-------------DEPDFLPDPVKVVYLYEIQLLPEVQGQRLGTQMLQVYLKNT 166
           LSF+LT             DE +     + V+YLYEIQ+LP+++GQ +GT++L V+L   
Sbjct: 126 LSFMLTEGDGFIGTHSNDDDENEHNDQLMSVIYLYEIQILPQLRGQGIGTKLLSVHLHQC 185

Query: 167 VHSL------SRLDPLLKGIELTVFSDNDAALHLYYSIGMALAPGSPTDEIATSQRR--- 217
             SL        L   L GIELTVFSDN  A++ Y SIGM L P SPTDE+   ++R   
Sbjct: 186 CSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDEVYQIEKRQTR 245

Query: 218 ---------TRHSTTDLQTVSRPDYYLMFLPV 240
                    TR  T   Q + +P YYL +LP+
Sbjct: 246 NLRRINNAGTREVTK--QIIKKPVYYLYYLPI 275

>TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.532
           YMR069W
          Length = 264

 Score =  152 bits (384), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 141/257 (54%), Gaps = 31/257 (12%)

Query: 13  VLDS-FPTSITL-KDGSLATRKVLVIDEPSSGIAPS-----GQVCTWSGDRQSSNSLLIQ 65
           ++DS +P  I + K+ +   +K++V+D  +  I  S     G+  T+S +++       +
Sbjct: 10  IVDSHYPDEIYVNKNLTKLVKKIIVVDSETEDIKNSAELYNGRYLTYSQNKEECEIEFSK 69

Query: 66  FLKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYF---QGVSPLMFLSF 122
            L +LD NLG  Y   +  LYGN++ W ENK++EM+T GL+YV Y    +  +  ++LSF
Sbjct: 70  ILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVYHLEDEKKTVSLYLSF 129

Query: 123 LLTDEPDFLPDP---VKVVYLYEIQLLPEVQGQRLGTQMLQVYLKNT---VHSLSRLDPL 176
            LT E  FLPD      V+YLYEIQL PEV+   LGT+++  YLK+    VH     D +
Sbjct: 130 TLTKESGFLPDIDVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLKDCLVDVHENIHKDII 189

Query: 177 LKGIELTVFSDNDAALHLYYSIGMALAPGSPTDEIATSQRRTRHST-------------T 223
             GIELTVFSDN  A+  Y +IGM L P SP D+      R +  +             T
Sbjct: 190 --GIELTVFSDNTNAIRFYETIGMKLTPDSPNDKTINYGHRIKTRSQNSSKKGSSSDKPT 247

Query: 224 DLQTVSRPDYYLMFLPV 240
            L  V +PDYYL +LP+
Sbjct: 248 SLSVVKKPDYYLYYLPL 264

>KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.532
           YMR069W
          Length = 256

 Score =  151 bits (381), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 99/252 (39%), Positives = 141/252 (55%), Gaps = 21/252 (8%)

Query: 7   NVLLPYVLDSFPTSITLKDGSLATRKVLVIDEPSSGIAPSGQVCTWSGDRQS-----SNS 61
           N  L  V D FP  +  K  +L  RK+L I         S  V     D         + 
Sbjct: 8   NGFLKIVSDEFPKELRTKGQNLK-RKILYIASEDEENKESDSVINEQDDLTKFTEGIGSK 66

Query: 62  LLIQFLKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYF----QGVSPL 117
           LL  FL++LD NLG+KY  +S  +Y N  SW +NKL EM++ GL+YV Y+    +  +  
Sbjct: 67  LLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEKKTCA 126

Query: 118 MFLSFLLTDEPDFLPDPVK---VVYLYEIQLLPEVQGQRLGTQMLQVYLKNTVH-SLSRL 173
           +FLSF+LT+E DF+ D ++   V+YLYEIQL+ + +G +LGT++++  L N    +  ++
Sbjct: 127 LFLSFMLTEE-DFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKG-LSNVCQIAQVKI 184

Query: 174 DPL--LKGIELTVFSDNDAALHLYYSIGMALAPGSPTDEI-ATSQRRTRHSTTD--LQTV 228
            P   L GI+LTVFSDN  A+  Y  IGM    GSP DE+     R+TR S     L+ V
Sbjct: 185 RPAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRKTRTSVNRKTLKVV 244

Query: 229 SRPDYYLMFLPV 240
            +P YYL++LPV
Sbjct: 245 RKPIYYLLYLPV 256

>Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W -
           Hypothetical ORF [contig 55] FULL
          Length = 240

 Score =  145 bits (365), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 101/248 (40%), Positives = 135/248 (54%), Gaps = 20/248 (8%)

Query: 1   MVDYPANVLLPYVLDSFPTSITLKDGSLATRKVLVIDEPSSGIAPSGQVCTWSGDRQSSN 60
           M DYPA+ L+P+V DSFPT++TL  G    R V  +  P   +    ++           
Sbjct: 1   MADYPADYLVPHVTDSFPTTLTLASGQRIQRAVYGV--PMDTVRSRAEI--------PDP 50

Query: 61  SLLIQFLKVLDLNLGSKYRSVSATLYGN-TRSWTENKLEEMQTIGLVYVGYF-------- 111
            LL Q L ++D NLG  Y   +  LYG+   SW E K +EM T GLVYV Y         
Sbjct: 51  CLLEQLLALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEETGK 110

Query: 112 QGVSPLMFLSFLLTDEPDFLPDPVKVVYLYEIQLLPEVQGQRLGTQMLQVYLKNTVHSLS 171
           +G+  L FLS LLTDEP+  P P  VVYL EI +   ++G  LG  +L+  +  TV    
Sbjct: 111 EGLP-LAFLSLLLTDEPELGPAPAAVVYLMEIHVADIIRGLGLGGTLLREGVAGTVRGAR 169

Query: 172 RLDPLLKGIELTVFSDNDAALHLYYSIGMALAPGSPTDEIATSQRRTRHSTTDLQTVSRP 231
           R  P ++G ELTVF+DN+ AL LY  +GM +A  SP D      RRTR +  + + V+RP
Sbjct: 170 RAHPFIQGTELTVFTDNEGALRLYLRLGMQIAAWSPQDTCIEVHRRTRATRYESRKVTRP 229

Query: 232 DYYLMFLP 239
            YYL+F P
Sbjct: 230 TYYLLFWP 237

>KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl- transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 260

 Score =  144 bits (364), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 107/261 (40%), Positives = 143/261 (54%), Gaps = 24/261 (9%)

Query: 1   MVDYPANVLLPYVLDSFPTSITLKDGSLA-TRKVLVID-----------------EPSSG 42
           MVDYPA+ L P+V   FP  +TL +G    TR V  I                  +P  G
Sbjct: 1   MVDYPASELFPHVTQCFPLVLTLPNGQQQLTRAVYGIPSDATQHEERREPRAAGPKPEPG 60

Query: 43  IAPSGQVCTWSGDRQSSNSLLIQFLKVLDLNLGSKYRSVSATLYGNTR-SWTENKLEEMQ 101
             P+ + C  S  R  ++ LL Q L ++  NLG  Y   +  +YG  R SW   K  EM+
Sbjct: 61  PTPASE-CD-SVPRPPAD-LLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEME 117

Query: 102 TIGLVYVGYFQGVS-PLMFLSFLLTDEPDFLPD-PVKVVYLYEIQLLPEVQGQRLGTQML 159
           T GLVYV Y    S PL+F+S LLTDEP+   +   +V+YL+EI +   ++GQ LGT +L
Sbjct: 118 TPGLVYVVYSDSHSQPLVFMSLLLTDEPELGQELAARVLYLFEIHVSDIIRGQGLGTHLL 177

Query: 160 QVYLKNTVHSLSRLDPLLKGIELTVFSDNDAALHLYYSIGMALAPGSPTDEIATSQRRTR 219
           +  L  T+ SLSR  P + G ELTVFS+N  AL LY ++GM +A  SP D  A  +RRTR
Sbjct: 178 RDCLGGTLASLSRASPSVLGAELTVFSENQRALRLYLALGMHVAAWSPQDRRAQVRRRTR 237

Query: 220 HSTTDLQTVSRPDYYLMFLPV 240
               D   V+RP YY++F P 
Sbjct: 238 AIAYDSSLVTRPAYYILFWPA 258

>Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {ON}
           complement(109063..109941) [879 nt, 293 aa]
          Length = 292

 Score =  143 bits (360), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 89/265 (33%), Positives = 141/265 (53%), Gaps = 41/265 (15%)

Query: 17  FPTSITLKDGSLAT--------RKVLVIDEPSSGIAPSGQVCTWSGDRQSSNSLLIQFLK 68
           FP ++ L + + +T        R+++ ID  ++ I     V ++  D    + +L + L 
Sbjct: 15  FPETLELLNDNSSTSNQKKVLHRQLIAIDSKNNQIDVRNNVLSYYKDNVKCDVVLNKLLD 74

Query: 69  VLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYFQGVS--PLMFLSFLLTD 126
           +LD NLG  Y   S+ +Y N + W ENK+ EM++ GL+YV Y   ++  PL+F+SF++TD
Sbjct: 75  ILDNNLGPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIYNDDITKEPLLFMSFMITD 134

Query: 127 EPDFL-----------PDPVKVVYLYEIQLLPEVQGQRLGTQMLQVYLKNTVHSLSR-LD 174
           +P  +                V+YLYEIQLL  ++ Q+LGT ++  YLK T+  L++   
Sbjct: 135 DPSLVVPTDNDSNELSNSTAAVIYLYEIQLLELIRNQKLGTILITNYLKKTIEILNKDYQ 194

Query: 175 PLLKGIELTVFSDNDAALHLYYSIGMALAPGSPTDEIATSQ-RRTRHSTTDLQTVSRP-- 231
             +  +ELTVFS+N  A++ Y  IGM   P SP D+I   Q RRTR +T  L++ +    
Sbjct: 195 KNIIALELTVFSNNINAINFYKKIGMLYTPDSPRDKIILPQKRRTRSTTIALESKNNEPS 254

Query: 232 ----------------DYYLMFLPV 240
                           DYYL+FLP+
Sbjct: 255 SRLTTSKPIKKIIKKPDYYLLFLPI 279

>CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069w
          Length = 278

 Score =  137 bits (346), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 94/231 (40%), Positives = 123/231 (53%), Gaps = 25/231 (10%)

Query: 4   YPANV---LLPYVLDSFPTSITLK-------DGSLATRKVLVIDEPSSGIAP---SGQVC 50
           Y  NV    L +VLD FP  IT K       +     RKVLVID     +A    + +V 
Sbjct: 7   YGTNVNDSFLHHVLDCFPKVITTKSNLPKDIEDVQLQRKVLVIDGDDYCLANKALTNEVV 66

Query: 51  TWSGDRQSSNSLLIQFLKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGY 110
             S   + S ++L   L++LD NLG KY   S  +YGN + W ENK+EEM T G++YV Y
Sbjct: 67  LRSKHIKESKNILSSLLELLDQNLGQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSY 126

Query: 111 FQGVS-----PLMFLSFLLTDEPDFL-PDPV-KVVYLYEIQLLPEVQGQRLGTQMLQVYL 163
           +  V      PL+FLSF+LT+E +    DPV  V++LYEIQ+  E++ Q LG   L   L
Sbjct: 127 WTKVDDEHTVPLLFLSFMLTEEENLTHNDPVSSVIFLYEIQISKELRKQGLGQYFLSNCL 186

Query: 164 KNTVHSLSRLDPL-----LKGIELTVFSDNDAALHLYYSIGMALAPGSPTD 209
                 L   D L       GIELTVF+DN  A++LY  +GM   P SP D
Sbjct: 187 FQCAKRLLDNDSLNLEFPFAGIELTVFADNLPAINLYQKLGMTHTPESPKD 237

>TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.532
           YMR069W
          Length = 244

 Score =  126 bits (316), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 91/225 (40%), Positives = 119/225 (52%), Gaps = 25/225 (11%)

Query: 7   NVLLPYVLDSFPTSITLKDGSLATRKVLVIDEPSSGIAPSGQVCTWSGDRQSSNSLLIQF 66
           N ++ Y   +FPT+I    G   TRK+L ID     +  + Q  ++    + +  LL Q 
Sbjct: 7   NDVVKYANQNFPTTINAA-GIQLTRKLLAIDTEEYPVE-TDQCISYVHSPREAEKLLWQL 64

Query: 67  LKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYFQG------------V 114
           L++LD NLG KY   S  LY NTR W  NK  EM T GLVYV Y                
Sbjct: 65  LEILDENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSTAATTTATQRRNAPF 124

Query: 115 SPLMFLSFLLTDEPDFLP-DPVK---VVYLYEIQLLPEVQGQRLGTQMLQVYLKNTVHSL 170
           SPL+FLSF+LT+E   +  DP +   V+YLYE+QLLP V+   L  ++L  +L      L
Sbjct: 125 SPLLFLSFMLTEEDGLVADDPTEVWTVLYLYELQLLPRVRRLGLAARLLGDHLAQCGRQL 184

Query: 171 ---SRLDPLLK----GIELTVFSDNDAALHLYYSIGMALAPGSPT 208
              SR     K    G+ELTVF+DN  A+ LY S+GM LA  SPT
Sbjct: 185 CTRSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQLAADSPT 229

>KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {ON}
           Anc_2.532 YMR069W
          Length = 271

 Score =  117 bits (292), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 69/187 (36%), Positives = 102/187 (54%), Gaps = 17/187 (9%)

Query: 66  FLKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYFQGVS-PLMFLSFLL 124
           FL++LD NLG  Y  +S  +YGN++ W ENK  EM +  LVYV Y+   S P+++ SF+L
Sbjct: 86  FLEILDNNLGPVYARLSRKIYGNSKHWRENKWLEMLSAQLVYVSYWVSDSEPVLYTSFML 145

Query: 125 TDEPDF--LPDPVKVVYLYEIQLLPEVQGQRLGTQMLQVYLKNTVHSLSRLDPLLKGIEL 182
           T+E     +    +VVYLYEIQL+  ++ Q+LG  ++    +  + S     P +  + L
Sbjct: 146 TEENGISSIESTDRVVYLYEIQLIEAIRRQKLGQAIVSYLTECALES-----PEVAAVAL 200

Query: 183 TVFSDNDAALHLYYSIGMALAPGSPTDEIATSQRRTRHSTTDLQ---------TVSRPDY 233
           TVFSDN+ AL  Y  +       SP DE+    RR   + T L          T+ +P Y
Sbjct: 201 TVFSDNEKALKFYERLNFTYTIDSPRDEVTEKPRRRTAARTALDPARDSDVKVTIKKPTY 260

Query: 234 YLMFLPV 240
           YL++L V
Sbjct: 261 YLLYLEV 267

>YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N
           alpha-acetyl-transferase, involved in acetylation of the
           N-terminal residues of histones H4 and H2A
          Length = 285

 Score =  117 bits (292), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 82/249 (32%), Positives = 122/249 (48%), Gaps = 21/249 (8%)

Query: 9   LLPYVLDSFPTSITLKD----GSLAT----RKVLVI---DEPSSGIAPSGQVCTWSGDRQ 57
            L   ++ FP SI  KD    G+  T    R+++ I   D  S     S +   +   + 
Sbjct: 36  FLNLCVEKFPESIEHKDTDGNGNFTTAILEREIIYIPEDDTDSIDSVDSLKCINYKLHKS 95

Query: 58  SSNSLLIQFLKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYFQGVSPL 117
             + +L   ++++D +LG+KYR  S  +YGN + W  NKL EM++ GLVYV Y+      
Sbjct: 96  RGDQVLDACVQLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYWDNGVLG 155

Query: 118 MFLSFLLTDEPDFLPD------PVKVVYLYEIQLLPEVQGQRLGTQMLQVYLKNTV--HS 169
            F SF+LT+E   +         V V+YLYE+ +    +G  +G ++L+  L + V  H+
Sbjct: 156 AFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHALCDGVARHT 215

Query: 170 LSRLDPLLKGIELTVFSDNDAALHLYYSIGMALAPGSPTDEIATSQRRTRHSTTDLQTVS 229
               D    G+ LTVFSDN  A  LY ++G   APGSP     T  R TRH    +    
Sbjct: 216 RRMCDNFF-GVALTVFSDNTRARRLYEALGFYRAPGSPAPASPTI-RHTRHGGGRVVVPC 273

Query: 230 RPDYYLMFL 238
            P YY+  L
Sbjct: 274 DPLYYVYCL 282

>Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W
           (REAL)
          Length = 255

 Score =  114 bits (284), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 83/249 (33%), Positives = 122/249 (48%), Gaps = 20/249 (8%)

Query: 9   LLPYVLDSFPTSI--TLKDGSLAT-------RKVLVIDEPSSGIAPSGQVCTWSGDR--- 56
            L   +  FP ++  T  DG+  T       R++L I E  S    + ++ T    R   
Sbjct: 5   FLKICMQDFPETLEYTNTDGNNGTATTTVLKREMLFIPEGDSNSQDNIEIPTCVNYRLHK 64

Query: 57  QSSNSLLIQFLKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYFQGVSP 116
              N +L   ++++D +LG+KYR  S T+YGN + W  NKL EM++  LVYV Y+   + 
Sbjct: 65  SRGNHILDSCVQLIDEHLGAKYRRASRTMYGNRKPWKANKLAEMKSPNLVYVSYWDNGAL 124

Query: 117 LMFLSFLLTDEPDFLPD------PVKVVYLYEIQLLPEVQGQRLGTQMLQVYLKNTVHSL 170
             F SF+LT+E   +         V V+YLYE+ +    +G  +G ++L+  L   V   
Sbjct: 125 AAFASFMLTEETGLVEGDAAHEVSVPVIYLYEVHVACVHRGHGIGRRLLERALCEGVARH 184

Query: 171 SR-LDPLLKGIELTVFSDNDAALHLYYSIGMALAPGSPTDEIATSQRRTRHSTTDLQTVS 229
            R L     G+ LTVFSDN  A  LY ++G   APGSP     T+ R TRH    +    
Sbjct: 185 VRCLYEEFFGVALTVFSDNTRARRLYEALGFYRAPGSPAAGAPTT-RPTRHGGERVVVPR 243

Query: 230 RPDYYLMFL 238
            P YY+  L
Sbjct: 244 DPLYYVYCL 252

>TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.532
           YMR069W
          Length = 278

 Score =  106 bits (265), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 81/273 (29%), Positives = 132/273 (48%), Gaps = 41/273 (15%)

Query: 9   LLPYVLDSFPTSITLKDGSLATRKVLVIDEPSSGIAPSGQ--------VCTWSGDRQS-- 58
           L+  V ++FP SI+ K G    RK+ +I +  +    S Q        +  +  DR++  
Sbjct: 6   LVQLVDNAFPKSISTKQGITLERKIYIIGDSENNSLLSDQNNNSNDDEIYWYFKDRKNPT 65

Query: 59  -SNSLLIQFLKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYF--QGVS 115
             N +  Q  +++D NLG  Y+  S  +Y N   W+ NK EEM T  ++Y+ Y+  +  S
Sbjct: 66  VENIIKTQIFQLIDENLGKLYKKKSKKIYENDLDWSINKREEMFTSNMIYITYWDCKQNS 125

Query: 116 PLMFLSFLLTDEPDFLP--DPVKVVYLYEIQLLPEVQGQRLGTQMLQVYLKNTV---HSL 170
             +FLS L  +E   L   D  +V+YLYEI +  E Q Q +G ++++ YL   +     +
Sbjct: 126 VALFLSILSCEETYILENNDQGEVLYLYEIHITKEYQRQGIGERLIKDYLIEKLIKPLKI 185

Query: 171 SRLDPLLKGIELTVFSDNDAALHLYYS-IGMALAPGSPTDEIATSQRRTRHSTTD----- 224
            R D    G+ELTVFS+N+ A + Y++ I M    GSP DEI    +R   S  +     
Sbjct: 186 ERQDNNFIGLELTVFSENNDAQNFYFNKIQMQYTFGSPRDEIINVMKRITRSFDEKLGEH 245

Query: 225 -----------------LQTVSRPDYYLMFLPV 240
                             +++ +P+YY++  PV
Sbjct: 246 CEDNKLPSLNDKKKQLYRKSIRKPEYYILVFPV 278

>Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W
           (REAL)
          Length = 254

 Score = 97.8 bits (242), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 77/248 (31%), Positives = 119/248 (47%), Gaps = 19/248 (7%)

Query: 9   LLPYVLDSFPTSI---------TLKDGSLATRKVLVIDEPSSGI-APSGQVCT-WSGDRQ 57
            L   +D FP ++         T+   ++  R+++ I E +  + +  G  CT ++  + 
Sbjct: 5   FLSICIDEFPETLEYTESNENATVVTTTVLKREIMYIPEENGEVDSIDGPQCTNYNLHKS 64

Query: 58  SSNSLLIQFLKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYFQGVSPL 117
             + +L   ++++D +LG KYR  S T+YGN   W  NKL EM++ GL+YV Y+   +  
Sbjct: 65  HGDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWGNGALG 124

Query: 118 MFLSFLLTDEPDFLPD------PVKVVYLYEIQLLPEVQGQRLGTQMLQVYLKNTVHSLS 171
            F SF+LT+E   +         V V+YLYEI +    +G  LG ++L+  L   V    
Sbjct: 125 AFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVAHAHRGHGLGRRLLERALCEGVARRV 184

Query: 172 RLDPL-LKGIELTVFSDNDAALHLYYSIGMALAPGSPTDEIATSQRRTRHSTTDLQTVSR 230
           R       G+ LTVF DN  A  LY +IG   AP       A + R TRH    +     
Sbjct: 185 RRVRCDFFGVALTVFGDNTRARRLYEAIGFCRAP-GSPAPAAPALRPTRHGRKRVVVARD 243

Query: 231 PDYYLMFL 238
           P YY+  L
Sbjct: 244 PLYYVYCL 251

>ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl-transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 188

 Score = 93.2 bits (230), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 87/156 (55%), Gaps = 7/156 (4%)

Query: 57  QSSNSLLIQFLKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYFQGVSP 116
            S++ +L + L+++++NLGS Y   + T+Y N + W  NK +EM +  L +V Y+   S 
Sbjct: 15  NSNDKILEKQLQLIEINLGSYYNKYNKTIYKNNKRWQSNKWQEMCSENLFHVSYWNVESN 74

Query: 117 --LMFLSFLLTDEPDFLPDPVKVVYLYEIQLLPEVQGQRLGTQMLQVYLKNTVHSLSRLD 174
             + F S +  +E     +   ++YLYEI + PE + Q+ G  +L   LK  +   + L 
Sbjct: 75  ELVCFCSIMPCEESIVEGEMSNIIYLYEIHVAPEWRNQKFGKSILNA-LKEKLCPKAHLS 133

Query: 175 PLLKGIELTVFSDNDAALHLYYSIGMALAPGSPTDE 210
               GIELTVFS N+ A++ Y + G  L+  SP+D+
Sbjct: 134 ----GIELTVFSSNERAINFYRNNGFTLSYDSPSDK 165

>Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON}
           similar to Saccharomyces cerevisiae YMR069W
          Length = 243

 Score = 86.3 bits (212), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 99/240 (41%), Gaps = 54/240 (22%)

Query: 2   VDYPANVLLPYVLDSFPTSITLKDGSLATRKVLVIDEPSSGIAPSGQVCTWSGDRQSSNS 61
           ++YPA +L  Y+ D+FP  +  ++G   +R +++ D  S                 +   
Sbjct: 1   MEYPAEILALYINDAFPEQLACRNGCTLSRDIIITDRLSVA---------------ARQK 45

Query: 62  LLIQFLKVLDLNLGSKYRSVSATLY---GNTRSWTENKLEEMQTIGLVYVGYFQ---GVS 115
              Q   +++  LG  Y   +  LY     +R W  +K  E+Q +G  +V Y +   G +
Sbjct: 46  FAKQLTAIIERTLGCFYDVHAHLLYPRLTRSRPWQAHKRAELQGLGTCHVLYRKENPGGA 105

Query: 116 PLMFLSFLLTDEPDFL--------------------------------PDPVKVVYLYEI 143
              F+S L  DEP +                                 P P KVVY+ EI
Sbjct: 106 IAGFVSLLFCDEPHWPAGNGSRAAASTAERERGPSGRSAEPAFEETPPPPPCKVVYVMEI 165

Query: 144 QLLPEVQGQRLGTQMLQVYLKNTVHSLSRLDPLLKGIELTVFSDNDAALHLYYSIGMALA 203
            + P  Q Q LG+ ML +  +  V  +    P LKG+ELTVF+ N  AL LY   G   A
Sbjct: 166 HVSPSFQNQGLGSCML-LCARQLVQHMQPSFPQLKGLELTVFTGNRQALALYRRQGFKTA 224

>Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)
           [771 bp, 257 aa] {ON} YMR069W (REAL)
          Length = 257

 Score = 77.4 bits (189), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 74/153 (48%), Gaps = 12/153 (7%)

Query: 56  RQSSNSLLIQFLKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYF---- 111
           +   +  L   ++++D +LG+KYR  S T+YGN   W  NKL EM++ GLVYV Y+    
Sbjct: 63  KADGDQTLHSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWGNDA 122

Query: 112 QGVSPL-MFLSFLLTDEPDFL------PDPVKVVYLYEIQLLPEVQGQRLGTQMLQVYLK 164
           QG   L  F SF+LT+E   +         V V+YLYE+              + +   +
Sbjct: 123 QGERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVHXX-HRGRGLGRRLLAKALCE 181

Query: 165 NTVHSLSRLDPLLKGIELTVFSDNDAALHLYYS 197
                + R    L G+ LTVF DN  A  LY S
Sbjct: 182 GVAARVRRTCDDLFGVALTVFGDNTRARRLYES 214

>KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa]
           {ON} no similarity
          Length = 215

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 71/164 (43%), Gaps = 19/164 (11%)

Query: 53  SGDRQSSNSLLIQFLKVLDLNLGSKYRSVSATLYGNT--------RSWTENKLEEMQTIG 104
           SGD     S L + L ++  NL + Y    +++Y  T          W   K +EM    
Sbjct: 39  SGDPNYLGSTLPKCLAIIKQNLSTFYELHGSSIYNYTDDDKGKGNEKWIRFKWDEMLDKD 98

Query: 105 LVYVGYFQGVSPLM--FLSFLLTD----EPDFLPDPVKVVYLYEIQLLPEVQGQRLGTQM 158
           LVY+  F+  +  +  F S  L+D    E D        ++LYEI L+ E Q + LG+ +
Sbjct: 99  LVYIVLFKRDTTKIVGFTSVALSDPLNPELDHSKLNRPCLFLYEIHLMGEYQSRGLGSLI 158

Query: 159 LQVYLKNTVHSLSRLDPLLKGIELTVFSDNDAALHLYYSIGMAL 202
               L      L+R D     IEL VF+ ND A   Y  +G  L
Sbjct: 159 FNGLLI----PLAR-DLTCPSIELCVFTANDVACRWYKRLGFQL 197

>NDAI0F02330 Chr6 complement(560955..561401) [447 bp, 148 aa] {ON}
          Length = 148

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 2/39 (5%)

Query: 78  YR-SVSATLYGNTRS-WTENKLEEMQTIGLVYVGYFQGV 114
           YR S++A L  N    +  +  EE + +G+ ++GYFQGV
Sbjct: 104 YRESITAILPNNVEDDYVSSAKEEAEELGISFIGYFQGV 142

>NDAI0F02210 Chr6 (535857..536303) [447 bp, 148 aa] {ON}
          Length = 148

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 2/39 (5%)

Query: 78  YR-SVSATLYGNTRS-WTENKLEEMQTIGLVYVGYFQGV 114
           YR S++A L  N    +  +  EE + +G+ ++GYFQGV
Sbjct: 104 YRESITAILPNNVEDDYVSSAKEEAEELGISFIGYFQGV 142

>Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187
           aa] {ON} ANNOTATED BY YGOB -
          Length = 187

 Score = 29.3 bits (64), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 50/133 (37%), Gaps = 18/133 (13%)

Query: 73  NLGSKYRSVSATLYGNTR---SWTENKLEEMQTIGLVYVGYFQGVSPL-MFLSFLLTDEP 128
            L   YR+ +  LY   R   +W   K  E+     +++ Y      L  F+S LL    
Sbjct: 51  GLAPLYRAHARLLYPRLRDPAAWPRCKRAELLDPAALHILYRDPAGRLACFISLLLPGPA 110

Query: 129 DFLPDPVKVVYLYEIQLL-PEVQGQRLGTQMLQVYLKNTVHSLSRLDPLLKGIELTVFSD 187
           D       V+Y+ E+ +  P  +       +           L+RL       ELTVF+ 
Sbjct: 111 D------PVLYILELHVAAPFRRRGLAAALLDAATRTARAAGLTRL-------ELTVFTA 157

Query: 188 NDAALHLYYSIGM 200
           N  AL LY   G 
Sbjct: 158 NRPALALYARAGF 170

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,457,691
Number of extensions: 1059547
Number of successful extensions: 2621
Number of sequences better than 10.0: 25
Number of HSP's gapped: 2614
Number of HSP's successfully gapped: 26
Length of query: 240
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 134
Effective length of database: 41,326,803
Effective search space: 5537791602
Effective search space used: 5537791602
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)