Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0A09438g2.531ON44127212311e-167
NCAS0J00640na 1ON102572258e-22
KAFR0C031408.117ON370622252e-19
NCAS0B046708.116ON266612183e-19
ZYRO0E02684g8.116ON133572094e-19
Kwal_26.80112.531ON190572125e-19
NCAS0B05750singletonON505542245e-19
Suva_16.3388.117ON247622157e-19
NDAI0C06260na 1ON582552247e-19
KAFR0A018402.531ON414622218e-19
Skud_16.3008.117ON249622141e-18
Smik_16.2558.117ON247622141e-18
YPR015C8.117ON247622131e-18
CAGL0L05786g8.116ON348612172e-18
NCAS0C042308.117ON338732162e-18
NDAI0B030808.116ON460642192e-18
AEL077Wna 2ON336612152e-18
NDAI0B019408.116ON336582152e-18
SAKL0H20394g8.117ON359632163e-18
TDEL0F011708.116ON162572053e-18
Smik_16.2538.116ON317622143e-18
KAFR0B019908.116ON410752163e-18
NDAI0B02080singletonON273612105e-18
KLTH0D06798g2.531ON111561985e-18
Suva_16.3358.116ON317572109e-18
KNAG0D022808.117ON435572139e-18
YPR013C8.116ON317572091e-17
Skud_16.2988.116ON317572091e-17
CAGL0J01595g8.117ON344622101e-17
Ecym_1383na 2ON381552092e-17
KAFR0B020008.117ON303612054e-17
KNAG0D022908.116ON435652085e-17
SAKL0H20416g8.116ON317562037e-17
TBLA0E039308.116ON462552061e-16
KLLA0F11682g3.298ON374562041e-16
KLLA0F20636gsingletonON285521992e-16
NCAS0B046608.117ON256591962e-16
KNAG0G011408.117ON519572015e-16
KLLA0A04609gsingletonON423641995e-16
TBLA0B064102.531ON449591961e-15
Kpol_541.398.116ON291571893e-15
ADR308Cna 3ON278611868e-15
Ecym_8011na 3ON276591868e-15
NCAS0F00910singletonON350531889e-15
KLTH0H08800g8.117ON168541781e-14
Kpol_1018.352.531ON517551891e-14
SAKL0D02618g3.298ON321571852e-14
Kwal_27.104673.298ON302571842e-14
NCAS0F009202.531ON354541852e-14
AGL207W3.298ON277511823e-14
Ecym_26733.298ON301531823e-14
SAKL0A10582gsingletonON288631805e-14
TBLA0I020603.298ON833631855e-14
Kwal_14.22068.117ON254541786e-14
Kpol_495.20singletonON486551846e-14
KLTH0C04884g3.298ON342611816e-14
Ecym_8377na 4ON310621807e-14
Kpol_1052.83.298ON386571791e-13
ADL040Wna 4ON330541772e-13
TPHA0A04530singletonON501521792e-13
Ecym_8387na 5ON179611684e-13
SAKL0A10648gsingletonON261571691e-12
NCAS0I014603.298ON330511711e-12
ADL051Wna 6ON173581641e-12
TPHA0A039103.298ON351561711e-12
Kpol_1065.483.298ON364541711e-12
SAKL0D15136gsingletonON271531682e-12
NDAI0A075403.298ON370581702e-12
KNAG0J022503.296ON296561682e-12
Ecym_4128na 7ON312541664e-12
KAFR0C003403.298ON394571675e-12
Ecym_8388na 6ON223591616e-12
KAFR0H012903.298ON330531656e-12
Ecym_8379na 8ON305531639e-12
AGR186Cna 7ON287551611e-11
CAGL0M01870g3.298ON315531612e-11
KNAG0H010703.298ON322531602e-11
ADL042Wna 8ON281531574e-11
ADL050Wna 5ON146511452e-10
TBLA0G032403.298ON511581517e-10
KLLA0F22319gsingletonON203481394e-09
NCAS0A129102.598ON822571402e-08
KLTH0H10538g1.326ON682631392e-08
Ecym_8389singletonON251521352e-08
TPHA0C008008.326ON680731357e-08
Kwal_14.25431.326ON711551322e-07
CAGL0L03916g2.162ON642531312e-07
NCAS0C032408.326ON620601303e-07
Kpol_1036.708.326ON674761294e-07
KNAG0I020702.162ON572541285e-07
Kpol_1072.582.162ON794541285e-07
AGR031W3.281ON140571187e-07
ZYRO0G20526g1.326ON849551269e-07
NCAS0A091601.326ON773601269e-07
Ecym_54242.162ON775481261e-06
SAKL0D06776g1.326ON767601251e-06
NCAS0B069602.162ON839541242e-06
TBLA0F013001.326ON985581242e-06
ACR264W2.162ON769481232e-06
KNAG0H005502.598ON620571232e-06
KAFR0B045802.162ON729601232e-06
ZYRO0F01012g2.598ON584571222e-06
AEL174W1.326ON661541223e-06
NDAI0G025608.326ON794561223e-06
TDEL0B069102.598ON437571213e-06
NDAI0G058001.326ON836601223e-06
CAGL0E01331g8.326ON689571213e-06
Kpol_1050.193.518ON221611174e-06
KLLA0F01463g1.326ON781551214e-06
NCAS0H030802.598ON730571214e-06
Suva_11.1642.598ON639561214e-06
KAFR0C04550singletonON467481204e-06
KLLA0F23782g2.162ON782531214e-06
TPHA0O014401.326ON778551214e-06
TDEL0B052502.162ON714541204e-06
Smik_10.1841.326ON885551214e-06
Ecym_26543.281ON257571175e-06
Kwal_47.178882.162ON786481205e-06
CAGL0M13189g2.598ON541571195e-06
KLTH0E09724g2.162ON768481205e-06
Smik_11.1862.598ON641571205e-06
KNAG0A070402.533ON352501186e-06
YKL062W (MSN4)2.598ON630571196e-06
Ecym_62951.326ON663551196e-06
SAKL0E10714g2.162ON819531196e-06
Ecym_23012.598ON767601196e-06
ABR089C2.598ON571601196e-06
KNAG0B005903.518ON439521187e-06
Skud_11.1672.598ON628571187e-06
AGL197W8.326ON844571198e-06
Kpol_344.48.326ON756731188e-06
YJL056C (ZAP1)1.326ON880551188e-06
YOR113W (AZF1)2.162ON914531188e-06
Kpol_185.32.598ON647571189e-06
KNAG0E026101.326ON746531189e-06
Skud_10.1521.326ON879551189e-06
TPHA0B029102.162ON717541189e-06
NDAI0B013402.598ON769571189e-06
Suva_6.1321.326ON878551189e-06
TBLA0B012802.162ON823541189e-06
Suva_10.2248.326ON764571189e-06
Suva_8.1662.162ON948531181e-05
CAGL0M04323g8.326ON703561171e-05
NDAI0B042902.162ON1064521181e-05
Skud_15.2762.162ON917531171e-05
TDEL0D019501.326ON755551171e-05
Smik_15.2912.162ON909531171e-05
NCAS0B036008.326ON635601161e-05
ZYRO0B16148g2.162ON930481161e-05
TPHA0A015408.326ON746731162e-05
TPHA0A058203.518ON276511132e-05
CAGL0K12078g3.281ON463541152e-05
KLTH0G12254g8.326ON746571152e-05
KAFR0A008001.326ON753521152e-05
KAFR0B057408.326ON619601152e-05
SAKL0B11330g2.598ON499571142e-05
KLLA0D16456g8.326ON854521152e-05
ZYRO0F10428g8.326ON813511142e-05
TPHA0M011803.281ON350621132e-05
TBLA0C048803.518ON339531123e-05
Kwal_47.190453.518ON266631113e-05
KNAG0A051708.326ON645581143e-05
CAGL0F05995g2.598ON597561133e-05
Kwal_26.83512.598ON698571133e-05
TBLA0G019202.598ON523571133e-05
KNAG0D037104.80ON459511123e-05
KLTH0D08734g2.598ON677571133e-05
KNAG0G024708.326ON736561134e-05
ZYRO0E08426g3.518ON171521074e-05
CAGL0A01628g4.80ON424511114e-05
SAKL0F01980g3.518ON385631114e-05
KAFR0F020702.598ON370571114e-05
KLLA0F18524g3.281ON357531114e-05
Skud_4.4058.326ON707581125e-05
Kpol_1035.221.326ON797541125e-05
TBLA0A089104.80ON390651115e-05
Suva_2.3078.326ON691601125e-05
YLR131C (ACE2)8.326ON770571125e-05
Skud_5.1373.518ON394541115e-05
Kpol_1018.332.533ON589501115e-05
CAGL0I02816gsingletonOFF291481105e-05
KLTH0G01826g3.518ON307621105e-05
TDEL0F026904.80ON350651105e-05
KLLA0F26961g2.598ON694571115e-05
CAGL0J05060g1.326ON713551116e-05
Suva_2.2003.281ON232551086e-05
Smik_12.1948.326ON769571116e-05
Kpol_1026.84.80ON412791106e-05
KNAG0E016003.518ON338521096e-05
NDAI0C005602.598ON972571117e-05
Suva_7.2404.80ON515651107e-05
YDR146C (SWI5)8.326ON709601107e-05
Klac_YGOB_Anc_3.5183.518ON239531077e-05
CAGL0C02519g3.518ON318521087e-05
TBLA0H028302.598ON746571108e-05
Skud_4.2973.281ON231551078e-05
YDR043C (NRG1)3.281ON231551069e-05
Kwal_56.239258.326ON745571109e-05
Skud_7.2494.80ON502651099e-05
TPHA0C025802.598ON365571089e-05
Kpol_505.152.162ON510541099e-05
KAFR0I023703.518ON391521081e-04
KAFR0A023202.598ON443571081e-04
KNAG0H034802.162ON796521091e-04
Skud_12.2008.326ON767571091e-04
TPHA0N014602.598ON519571081e-04
Smik_7.2514.80ON505651081e-04
SAKL0A09482g2.533ON388511071e-04
Smik_4.3908.326ON708601081e-04
TBLA0A039608.326ON850541081e-04
YGL035C (MIG1)4.80ON504651081e-04
KNAG0H011803.281ON254561051e-04
CAGL0M06831g2.303ON645591081e-04
TDEL0F045108.326ON743571081e-04
SAKL0H20988g4.80ON548511081e-04
TPHA0K017704.80ON518511071e-04
NCAS0E006103.518ON401521071e-04
YER028C (MIG3)3.518ON394541071e-04
NCAS0A106503.281ON293531062e-04
KAFR0A010903.281ON249531052e-04
ZYRO0C13508g3.281ON189541032e-04
TPHA0G035102.533ON387551062e-04
KLTH0H09196g4.80ON460511062e-04
KLLA0E11023g4.80ON474521062e-04
AFR471C4.80ON389521052e-04
Kpol_1065.153.281ON220521032e-04
NCAS0A018204.80ON455651062e-04
YGL209W (MIG2)3.518ON382521052e-04
NDAI0I029003.518ON524521053e-04
ZYRO0A02288g2.303ON619591053e-04
KNAG0J008703.281ON280571033e-04
KAFR0F036004.80ON335651043e-04
KAFR0J003402.533ON218511023e-04
Skud_7.593.518ON383521043e-04
NDAI0B060203.518ON426521043e-04
Suva_13.2062.598ON709561053e-04
Smik_5.1513.518ON388641043e-04
Smik_13.2072.598ON703561053e-04
Smik_7.543.518ON382521043e-04
Kpol_1013.212.598ON494571044e-04
TDEL0D058603.518ON330521034e-04
Suva_7.523.518ON400521034e-04
SAKL0H15488g8.326ON798571044e-04
Skud_14.3012.303ON682591044e-04
NDAI0A056503.281ON330531025e-04
Suva_14.3182.303ON681591035e-04
CAGL0K09372g3.518ON396521035e-04
Smik_14.3032.303ON673591035e-04
Kwal_23.54007.543ON429591026e-04
TPHA0G002707.543ON472601026e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0A09438g
         (441 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {...   478   e-167
NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON}       91   8e-22
KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON}               91   2e-19
NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON}                89   3e-19
ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly ...    85   4e-19
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...    86   5e-19
NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa] ...    91   5e-19
Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {O...    87   7e-19
NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON}             91   7e-19
KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {O...    90   8e-19
Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {O...    87   1e-18
Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {O...    87   1e-18
YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON} P...    87   1e-18
CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa] ...    88   2e-18
NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON}               88   2e-18
NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {O...    89   2e-18
AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; N...    87   2e-18
NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {O...    87   2e-18
SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weak...    88   3e-18
TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.11...    84   3e-18
Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {O...    87   3e-18
KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {O...    88   3e-18
NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON}                86   5e-18
KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {O...    81   5e-18
Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {O...    86   9e-18
KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON}               87   9e-18
YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON} P...    85   1e-17
Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {O...    85   1e-17
CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some ...    86   1e-17
Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}...    85   2e-17
KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON...    84   4e-17
KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {O...    85   5e-17
SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakl...    83   7e-17
TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {O...    84   1e-16
KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]...    83   1e-16
KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa] ...    81   2e-16
NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON}                80   2e-16
KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {O...    82   5e-16
KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {...    81   5e-16
TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON} Anc_2...    80   1e-15
Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON...    77   3e-15
ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON} ...    76   8e-15
Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON} si...    76   8e-15
NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON}               77   9e-15
KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some si...    73   1e-14
Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...    77   1e-14
SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {O...    76   2e-14
Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {O...    75   2e-14
NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531     76   2e-14
AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No...    75   3e-14
Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON...    75   3e-14
SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {O...    74   5e-14
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     76   5e-14
Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C ...    73   6e-14
Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON} (65876..6...    75   6e-14
KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {...    74   6e-14
Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON} ...    74   7e-14
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    74   1e-13
ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic hom...    73   2e-13
TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON}             74   2e-13
Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON} ...    69   4e-13
SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some si...    70   1e-12
NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON...    70   1e-12
ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No...    68   1e-12
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    70   1e-12
Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa] ...    70   1e-12
SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some ...    69   2e-12
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    70   2e-12
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               69   2e-12
Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to...    69   4e-12
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    69   5e-12
Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON} ...    67   6e-12
KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON...    68   6e-12
Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON} ...    67   9e-12
AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON} ...    67   1e-11
CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {...    67   2e-11
KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON...    66   2e-11
ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic hom...    65   4e-11
ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No...    60   2e-10
TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298     63   7e-10
KLLA0F22319g Chr6 complement(2086613..2087224) [612 bp, 203 aa] ...    58   4e-09
NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa] ...    59   2e-08
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    58   2e-08
Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to...    57   2e-08
TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.3...    57   7e-08
Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C...    55   2e-07
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    55   2e-07
NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326     55   3e-07
Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa] ...    54   4e-07
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    54   5e-07
Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa] ...    54   5e-07
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    50   7e-07
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    53   9e-07
NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON} Anc_1...    53   9e-07
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    53   1e-06
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    53   1e-06
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    52   2e-06
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    52   2e-06
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    52   2e-06
KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598...    52   2e-06
KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.1...    52   2e-06
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    52   2e-06
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    52   3e-06
NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326     52   3e-06
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    51   3e-06
NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa] ...    52   3e-06
CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some s...    51   3e-06
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    50   4e-06
KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some s...    51   4e-06
NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {O...    51   4e-06
Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062...    51   4e-06
KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON}               51   4e-06
KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weak...    51   4e-06
TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1....    51   4e-06
TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {O...    51   4e-06
Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {...    51   4e-06
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    50   5e-06
Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113...    51   5e-06
CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa...    50   5e-06
KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly...    51   5e-06
Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062...    51   5e-06
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...    50   6e-06
YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}  MSN4Trans...    50   6e-06
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    50   6e-06
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    50   6e-06
Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar t...    50   6e-06
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    50   6e-06
KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518...    50   7e-06
Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062...    50   7e-06
AGL197W Chr7 (325717..328251) [2535 bp, 844 aa] {ON} Syntenic ho...    50   8e-06
Kpol_344.4 s344 complement(5351..7621) [2271 bp, 756 aa] {ON} co...    50   8e-06
YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON} ...    50   8e-06
YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}  AZF1Zinc-...    50   8e-06
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    50   9e-06
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    50   9e-06
Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056...    50   9e-06
TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {O...    50   9e-06
NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598     50   9e-06
Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C ...    50   9e-06
TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {O...    50   9e-06
Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {...    50   9e-06
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    50   1e-05
CAGL0M04323g Chr13 complement(474158..476269) [2112 bp, 703 aa] ...    50   1e-05
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    50   1e-05
Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113...    50   1e-05
TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {O...    50   1e-05
Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113...    50   1e-05
NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {O...    49   1e-05
ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weak...    49   1e-05
TPHA0A01540 Chr1 (306674..308914) [2241 bp, 746 aa] {ON} Anc_8.3...    49   2e-05
TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {...    48   2e-05
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    49   2e-05
KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weak...    49   2e-05
KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {O...    49   2e-05
KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa] ...    49   2e-05
SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {...    49   2e-05
KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]...    49   2e-05
ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {...    49   2e-05
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    48   2e-05
TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa] ...    48   3e-05
Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa] ...    47   3e-05
KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.3...    49   3e-05
CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {...    48   3e-05
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    48   3e-05
TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {O...    48   3e-05
KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.8...    48   3e-05
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    48   3e-05
KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {O...    48   4e-05
ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {O...    46   4e-05
CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} simila...    47   4e-05
SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some s...    47   4e-05
KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.5...    47   4e-05
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    47   4e-05
Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON...    48   5e-05
Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON} (53205....    48   5e-05
TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa] ...    47   5e-05
Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON...    48   5e-05
YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON} ...    48   5e-05
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    47   5e-05
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...    47   5e-05
CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {O...    47   5e-05
KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some si...    47   5e-05
TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.8...    47   5e-05
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    47   5e-05
CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} simil...    47   6e-05
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    46   6e-05
Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {...    47   6e-05
Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa] ...    47   6e-05
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    47   6e-05
NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598     47   7e-05
Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 ...    47   7e-05
YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}  ...    47   7e-05
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    46   7e-05
CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some si...    46   7e-05
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    47   8e-05
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    46   8e-05
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    45   9e-05
Kwal_56.23925 s56 complement(779625..781862) [2238 bp, 745 aa] {...    47   9e-05
Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON...    47   9e-05
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    46   9e-05
Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON} (42259..4...    47   9e-05
KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.5...    46   1e-04
KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {O...    46   1e-04
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    47   1e-04
Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {...    47   1e-04
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    46   1e-04
Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON...    46   1e-04
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...    46   1e-04
Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON...    46   1e-04
TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {O...    46   1e-04
YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}  ...    46   1e-04
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    45   1e-04
CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakl...    46   1e-04
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    46   1e-04
SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]...    46   1e-04
TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4....    46   1e-04
NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518     46   1e-04
YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}  ...    46   1e-04
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    45   2e-04
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    45   2e-04
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    44   2e-04
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...    45   2e-04
KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {...    45   2e-04
KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON} unipro...    45   2e-04
AFR471C Chr6 complement(1287518..1288687) [1170 bp, 389 aa] {ON}...    45   2e-04
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    44   2e-04
NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80      45   2e-04
YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc fin...    45   2e-04
NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {O...    45   3e-04
ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} simila...    45   3e-04
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    44   3e-04
KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.8...    45   3e-04
KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}       44   3e-04
Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W (...    45   3e-04
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    45   3e-04
Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {...    45   3e-04
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    45   3e-04
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    45   3e-04
Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)    45   3e-04
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    45   4e-04
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    44   4e-04
Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)    44   4e-04
SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} simi...    45   4e-04
Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027...    45   4e-04
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    44   5e-04
Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 ...    44   5e-04
CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa] ...    44   5e-04
Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027...    44   5e-04
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    44   6e-04
TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543...    44   6e-04
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      43   6e-04
Smik_4.500 Chr4 complement(908879..909460) [582 bp, 193 aa] {ON}...    43   6e-04
Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON...    44   6e-04
KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {O...    44   6e-04
YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}  CRZ1Trans...    44   7e-04
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    44   7e-04
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    44   7e-04
CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {...    43   8e-04
Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON} (1146...    44   8e-04
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    43   9e-04
SAKL0B12672g Chr2 complement(1096894..1097751) [858 bp, 285 aa] ...    43   0.001
NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80      43   0.001
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    44   0.001
TPHA0G03750 Chr7 complement(794102..795142) [1041 bp, 346 aa] {O...    43   0.001
KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {O...    42   0.001
YDR253C Chr4 complement(963990..964565) [576 bp, 191 aa] {ON}  M...    42   0.001
KAFR0H02240 Chr8 (426388..428259) [1872 bp, 623 aa] {ON} Anc_8.3...    43   0.001
TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON} Anc_2...    43   0.001
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    42   0.001
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...    43   0.001
TBLA0H01260 Chr8 (283947..285665) [1719 bp, 572 aa] {ON} Anc_8.3...    43   0.001
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    42   0.001
KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {...    43   0.001
KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.3...    43   0.001
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    42   0.002
TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.3...    42   0.002
SAKL0F00242g Chr6 (16275..17150) [876 bp, 291 aa] {ON} similar t...    42   0.002
Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}...    42   0.002
TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.3...    42   0.002
Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar t...    42   0.002
Skud_4.515 Chr4 complement(918500..919063) [564 bp, 187 aa] {ON}...    41   0.002
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    42   0.002
KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some s...    42   0.002
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...    42   0.002
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    42   0.002
NCAS0E00170 Chr5 (20556..21539) [984 bp, 327 aa] {ON}                  42   0.003
Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {...    42   0.003
NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {O...    42   0.003
Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {O...    42   0.003
KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {...    42   0.003
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    40   0.003
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    42   0.003
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    41   0.003
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...    42   0.003
Kwal_27.10167 s27 (225940..226797) [858 bp, 285 aa] {ON} YGL254W...    41   0.003
ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic ho...    42   0.003
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    42   0.003
Suva_2.419 Chr2 complement(743569..744144) [576 bp, 191 aa] {ON}...    40   0.004
SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {...    42   0.004
CAGL0H07557g Chr8 (738086..739516) [1431 bp, 476 aa] {ON} some s...    42   0.004
ZYRO0G09438g Chr7 complement(752797..753786) [990 bp, 329 aa] {O...    41   0.004
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...    40   0.004
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    41   0.004
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...    41   0.004
ZYRO0D00902g Chr4 (68162..69379) [1218 bp, 405 aa] {ON} similar ...    41   0.004
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    42   0.004
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...    41   0.005
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...    41   0.005
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...    41   0.005
TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {O...    41   0.005
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    41   0.006
Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON} (33422..3...    41   0.006
NDAI0J02060 Chr10 (505150..506619) [1470 bp, 489 aa] {ON} Anc_4....    41   0.006
NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303     41   0.007
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    39   0.007
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...    40   0.007
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...    41   0.007
KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.3...    40   0.007
KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar ...    40   0.009
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    40   0.009
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...    40   0.009
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    40   0.009
AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic ho...    40   0.009
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...    39   0.010
KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON...    39   0.010
TDEL0F01030 Chr6 (182054..185287) [3234 bp, 1077 aa] {ON} Anc_8....    40   0.010
NDAI0J00990 Chr10 (226704..228863) [2160 bp, 719 aa] {ON} Anc_8....    40   0.010
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...    40   0.010
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    40   0.011
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...    40   0.012
KAFR0J02980 Chr10 complement(567857..568816) [960 bp, 319 aa] {O...    39   0.012
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...    40   0.013
KLTH0E03124g Chr5 complement(280411..283056) [2646 bp, 881 aa] {...    40   0.013
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...    40   0.013
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    40   0.013
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    39   0.015
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    39   0.015
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...    39   0.015
TBLA0C01990 Chr3 complement(466321..467190) [870 bp, 289 aa] {ON...    39   0.016
TDEL0H00280 Chr8 (38901..40175) [1275 bp, 424 aa] {ON} Anc_7.543...    39   0.023
NDAI0I03330 Chr9 complement(781013..782065) [1053 bp, 350 aa] {O...    39   0.024
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    39   0.024
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    39   0.025
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    39   0.026
Skud_7.13 Chr7 (26414..27304) [891 bp, 296 aa] {ON} YGL254W (REAL)     38   0.027
Smik_7.7 Chr7 (16965..17897) [933 bp, 310 aa] {ON} YGL254W (REAL)      39   0.027
KLLA0E13487g Chr5 complement(1190615..1191307) [693 bp, 230 aa] ...    38   0.028
Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W...    39   0.029
KNAG0I00130 Chr9 (10977..11972) [996 bp, 331 aa] {ON}                  38   0.029
NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa] ...    39   0.029
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    39   0.030
Smik_16.197 Chr16 (357835..358350) [516 bp, 171 aa] {ON} YPL038W...    37   0.031
TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.2...    39   0.031
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    38   0.034
Kpol_489.4 s489 (17106..18125) [1020 bp, 339 aa] {ON} (17106..18...    38   0.035
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    38   0.037
KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {...    39   0.040
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    39   0.042
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    38   0.042
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    39   0.042
NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.1...    38   0.043
TBLA0I01970 Chr9 complement(446033..446899) [867 bp, 288 aa] {ON...    37   0.049
NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144      37   0.056
SAKL0H11440g Chr8 (982180..982797) [618 bp, 205 aa] {ON} similar...    37   0.059
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...    38   0.060
NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]...    38   0.061
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    37   0.064
NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {...    38   0.067
CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {...    37   0.068
Suva_7.7 Chr7 (16721..17614) [894 bp, 297 aa] {ON} YGL254W (REAL)      37   0.068
TPHA0E02650 Chr5 (554820..555743) [924 bp, 307 aa] {ON} Anc_6.25...    37   0.069
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    38   0.072
CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {...    37   0.096
SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some s...    37   0.099
KLLA0F07073g Chr6 (675221..676897) [1677 bp, 558 aa] {ON} some s...    37   0.10 
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    37   0.11 
Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081...    37   0.11 
KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.2...    37   0.11 
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...    37   0.11 
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    37   0.11 
TBLA0B04960 Chr2 complement(1167778..1169124) [1347 bp, 448 aa] ...    37   0.11 
Kpol_1060.35 s1060 (84889..85725) [837 bp, 278 aa] {ON} (84889.....    36   0.12 
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                36   0.12 
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    37   0.12 
KAFR0A07120 Chr1 complement(1435398..1436345) [948 bp, 315 aa] {...    36   0.13 
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    37   0.13 
KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {...    37   0.14 
KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} wea...    37   0.14 
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...    37   0.14 
Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]...    36   0.14 
NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {O...    36   0.14 
Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {O...    36   0.15 
Kwal_47.16577 s47 complement(9960..12605) [2646 bp, 881 aa] {ON}...    37   0.15 
KNAG0F03980 Chr6 complement(754914..756041) [1128 bp, 375 aa] {O...    36   0.15 
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    36   0.16 
KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8....    37   0.17 
Kwal_27.11824 s27 complement(959535..960134) [600 bp, 199 aa] {O...    35   0.17 
TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4....    36   0.17 
KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some s...    36   0.18 
Kpol_472.3 s472 complement(4365..5300) [936 bp, 311 aa] {ON} com...    36   0.18 
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    36   0.19 
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    36   0.21 
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    36   0.21 
YGL254W Chr7 (22304..23203) [900 bp, 299 aa] {ON}  FZF1Transcrip...    35   0.21 
KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.25...    35   0.21 
KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some s...    36   0.23 
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    36   0.23 
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    36   0.24 
Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON} (31069..3...    36   0.24 
KLTH0E11330g Chr5 complement(1013019..1013618) [600 bp, 199 aa] ...    35   0.26 
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    35   0.28 
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    35   0.28 
KAFR0H01500 Chr8 (277542..278336) [795 bp, 264 aa] {ON} Anc_8.48...    35   0.29 
YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}  ...    35   0.29 
TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON} Anc_...    35   0.29 
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    35   0.29 
Suva_16.349 Chr16 complement(610937..612562) [1626 bp, 541 aa] {...    35   0.30 
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    35   0.31 
Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {O...    35   0.31 
CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa] ...    35   0.31 
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    35   0.31 
Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}...    35   0.32 
SAKL0H24464g Chr8 complement(2118553..2121405) [2853 bp, 950 aa]...    35   0.33 
KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {...    35   0.34 
KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.25...    35   0.35 
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      35   0.36 
Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {O...    34   0.36 
Ecym_2536 Chr2 complement(1041642..1042364) [723 bp, 240 aa] {ON...    35   0.36 
KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]...    35   0.39 
YPL038W Chr16 (480535..481068) [534 bp, 177 aa] {ON}  MET31Zinc-...    34   0.39 
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    35   0.40 
Skud_16.243 Chr16 (445581..446114) [534 bp, 177 aa] {ON} YPL038W...    34   0.42 
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    35   0.43 
NDAI0C05210 Chr3 complement(1209022..1209789) [768 bp, 255 aa] {...    34   0.45 
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    35   0.46 
NCAS0C02430 Chr3 (453975..454574) [600 bp, 199 aa] {ON} Anc_8.486      34   0.46 
AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}...    35   0.48 
ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} simila...    35   0.51 
YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}  N...    34   0.54 
Suva_16.278 Chr16 (483789..484316) [528 bp, 175 aa] {ON} YPL038W...    33   0.54 
NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256     34   0.56 
KLLA0D11902g Chr4 (1015273..1016142) [870 bp, 289 aa] {ON} some ...    34   0.56 
SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa...    35   0.58 
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    35   0.59 
TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {O...    35   0.59 
ZYRO0F08162g Chr6 complement(660746..661294) [549 bp, 182 aa] {O...    33   0.59 
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    35   0.59 
CAGL0K02343g Chr11 (209474..212962) [3489 bp, 1162 aa] {ON} simi...    35   0.60 
AGL246W Chr7 (240857..241540) [684 bp, 227 aa] {ON} Syntenic hom...    34   0.60 
TPHA0F00260 Chr6 (50020..51600) [1581 bp, 526 aa] {ON} Anc_4.21 ...    34   0.62 
NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {O...    34   0.64 
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    35   0.65 
YPR022C Chr16 complement(603911..607312) [3402 bp, 1133 aa] {ON}...    34   0.67 
NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8....    34   0.67 
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    34   0.70 
Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}...    33   0.71 
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    34   0.76 
Skud_16.307 Chr16 complement(568219..570672,570703..571623) [337...    34   0.76 
KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.2...    34   0.82 
AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic...    34   0.83 
TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {O...    34   0.85 
ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} simil...    34   0.88 
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    34   0.98 
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    34   1.0  
Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}...    33   1.1  
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    33   1.3  
CAGL0G10021g Chr7 complement(959154..960338) [1185 bp, 394 aa] {...    33   1.3  
Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON...    33   1.3  
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    33   1.4  
Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON...    33   1.5  
NCAS0J01300 Chr10 (225659..226966) [1308 bp, 435 aa] {ON} Anc_4....    33   1.5  
Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON...    33   1.5  
NCAS0D03910 Chr4 (729305..730255) [951 bp, 316 aa] {ON} Anc_6.256      33   1.5  
NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa] ...    33   1.6  
Smik_16.263 Chr16 complement(479612..482980) [3369 bp, 1122 aa] ...    33   1.7  
Skud_10.351 Chr10 complement(617553..621332,621389..621469,62146...    33   1.7  
Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa] ...    33   1.8  
YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON} P...    33   1.9  
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    33   2.0  
Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W...    33   2.1  
NCAS0A02360 Chr1 (448263..449699) [1437 bp, 478 aa] {ON} Anc_4.222     32   2.3  
Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W...    33   2.3  
YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}...    33   2.3  
Suva_1.89 Chr1 complement(157170..157334) [165 bp, 55 aa] {ON} Y...    29   2.4  
Smik_10.420 Chr10 complement(647997..651776,651798..651836,65184...    33   2.5  
NDAI0D04510 Chr4 complement(1057468..1059150) [1683 bp, 560 aa] ...    32   2.8  
Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W...    32   2.9  
Suva_8.24 Chr8 (53077..54972) [1896 bp, 631 aa] {ON} YHL027W (REAL)    32   3.2  
Skud_8.17 Chr8 (39078..40961) [1884 bp, 627 aa] {ON} YHL027W (REAL)    32   3.3  
TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}                32   3.6  
Smik_8.14 Chr8 (34679..36568) [1890 bp, 629 aa] {ON} YHL027W (REAL)    32   3.7  
TPHA0C01760 Chr3 (402424..402939) [516 bp, 171 aa] {ON} Anc_8.48...    31   4.8  
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    31   5.0  
YHL027W Chr8 (51111..52988) [1878 bp, 625 aa] {ON}  RIM101Transc...    32   5.0  
KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakl...    32   5.1  
Kwal_55.20634 s55 (498959..500218) [1260 bp, 419 aa] {ON} YHL027...    31   5.8  
TDEL0C06340 Chr3 complement(1157892..1159334) [1443 bp, 480 aa] ...    31   5.9  
TDEL0G01700 Chr7 complement(334394..335848) [1455 bp, 484 aa] {O...    31   5.9  
Smik_12.489 Chr12 (864248..866299) [2052 bp, 683 aa] {ON} YLR403...    31   7.2  
Skud_12.487 Chr12 (865822..867948) [2127 bp, 708 aa] {ON} YLR403...    31   7.5  
YLR403W Chr12 (925568..927619) [2052 bp, 683 aa] {ON}  SFP1Regul...    31   7.8  
Suva_10.519 Chr10 (891265..893340) [2076 bp, 691 aa] {ON} YLR403...    31   8.0  
NCAS0B02480 Chr2 (414819..415418) [600 bp, 199 aa] {ON} Anc_8.48...    30   8.7  

>SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {ON}
           weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 441

 Score =  478 bits (1231), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 238/272 (87%), Positives = 238/272 (87%)

Query: 170 YQYHNPHQHQTPLPIPHSVPTARNSSSSLHVNNMNSFPYTESVNVIPLSNYPMMMPPYNQ 229
           YQYHNPHQHQTPLPIPHSVPTARNSSSSLHVNNMNSFPYTESVNVIPLSNYPMMMPPYNQ
Sbjct: 170 YQYHNPHQHQTPLPIPHSVPTARNSSSSLHVNNMNSFPYTESVNVIPLSNYPMMMPPYNQ 229

Query: 230 NVPQYQHSVKPPTSSLPAPVTQHPQEISSSHQRKEPRDGVHEHTAHXXXXXXXXXXXXXX 289
           NVPQYQHSVKPPTSSLPAPVTQHPQEISSSHQRKEPRDGVHEHTAH              
Sbjct: 230 NVPQYQHSVKPPTSSLPAPVTQHPQEISSSHQRKEPRDGVHEHTAHLNLSLAPLPPPPPH 289

Query: 290 XIYSADSPTMTNSCQVLPNSAHLSTDGSYSYPTSSMNNDIDTQAIPDLQAFENNRRYXXX 349
            IYSADSPTMTNSCQVLPNSAHLSTDGSYSYPTSSMNNDIDTQAIPDLQAFENNRRY   
Sbjct: 290 LIYSADSPTMTNSCQVLPNSAHLSTDGSYSYPTSSMNNDIDTQAIPDLQAFENNRRYSSP 349

Query: 350 XXXXXXXXXXXXXXXXRGAHEIQYNSFGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPF 409
                           RGAHEIQYNSFGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPF
Sbjct: 350 SFNSPLTSHSSSSSSSRGAHEIQYNSFGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPF 409

Query: 410 KCVWPSCEKTFNVKSNMMRHYRLHEKRGGAKR 441
           KCVWPSCEKTFNVKSNMMRHYRLHEKRGGAKR
Sbjct: 410 KCVWPSCEKTFNVKSNMMRHYRLHEKRGGAKR 441

 Score =  181 bits (458), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 83/83 (100%), Positives = 83/83 (100%)

Query: 1  MFHPEQDADTTHDGNSMEQKRDPVSPFLMPSFAISDGNLHVQQKDFQRPGPHPLFLQQQE 60
          MFHPEQDADTTHDGNSMEQKRDPVSPFLMPSFAISDGNLHVQQKDFQRPGPHPLFLQQQE
Sbjct: 1  MFHPEQDADTTHDGNSMEQKRDPVSPFLMPSFAISDGNLHVQQKDFQRPGPHPLFLQQQE 60

Query: 61 YHHSQQNWPAYFPSGYNIQYDHL 83
          YHHSQQNWPAYFPSGYNIQYDHL
Sbjct: 61 YHHSQQNWPAYFPSGYNIQYDHL 83

>NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON} 
          Length = 102

 Score = 91.3 bits (225), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 41/57 (71%), Positives = 45/57 (78%)

Query: 379 PKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           P  QC  CGK+ +RSSSLQ H LVHTGDRPFKC W +C KTFNVKSNM RHY+LH K
Sbjct: 38  PSRQCPICGKIVTRSSSLQTHMLVHTGDRPFKCKWLNCGKTFNVKSNMNRHYKLHLK 94

>KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON} 
          Length = 370

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 47/62 (75%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGA 439
           + QC  CGK+ SR S+L+ H L+HTGD PFKC W  C K+FNVKSNM+RH++ HEK+  +
Sbjct: 297 RKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCPWKGCTKSFNVKSNMLRHFKSHEKKAAS 356

Query: 440 KR 441
           K+
Sbjct: 357 KK 358

>NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON} 
          Length = 266

 Score = 88.6 bits (218), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (73%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGA 439
           + QC  CGK+ SR S+L+AH L+HTGD PFKC W +C K FNVKSNM+RH + HEK+   
Sbjct: 199 RKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKVIK 258

Query: 440 K 440
           K
Sbjct: 259 K 259

>ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 133

 Score = 85.1 bits (209), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 34/57 (59%), Positives = 45/57 (78%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           + QC  CGK+ SR S+L+ H L+HTGD PFKC W +C+K+FNVKSNM+RH + HE+R
Sbjct: 65  RKQCPVCGKICSRPSTLKTHFLIHTGDTPFKCTWQNCQKSFNVKSNMLRHLKSHERR 121

>Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON}
           YPR013C - Hypothetical ORF [contig 55] FULL
          Length = 190

 Score = 86.3 bits (212), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 37/57 (64%), Positives = 45/57 (78%)

Query: 379 PKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           PK QC  C K+FSRSS+LQAH L HTG RPF+C + SC KTFNVKSNM+RH + H++
Sbjct: 126 PKYQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLKTHKQ 182

>NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa]
           {ON} 
          Length = 505

 Score = 90.9 bits (224), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 37/54 (68%), Positives = 42/54 (77%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           K QC  CGKV +R+SSLQ H L+HTG RPF C WP C+KTFNVKSNM RH +LH
Sbjct: 446 KKQCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKLH 499

>Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {ON}
           YPR015C (REAL)
          Length = 247

 Score = 87.4 bits (215), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 45/62 (72%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGA 439
           + QC  CGKV SR S+L+ H L+HTGD PFKC W  C K+FNVKSNM+RH R H+K+   
Sbjct: 184 RKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCSKSFNVKSNMLRHLRTHQKKIAK 243

Query: 440 KR 441
           K+
Sbjct: 244 KK 245

>NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 90.9 bits (224), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 43/55 (78%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           QC  CGK  +R+S+LQ H LVHTGDRPF+CVW  C K FNVKSNM RHY+LH K+
Sbjct: 492 QCHICGKSVTRTSTLQTHMLVHTGDRPFECVWSGCHKRFNVKSNMNRHYKLHLKK 546

>KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {ON}
           Anc_2.531
          Length = 414

 Score = 89.7 bits (221), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 39/62 (62%), Positives = 44/62 (70%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGA 439
           KNQC  CGK  +RSSSL  H  VHTGDRP+ C WP C K FNVKSNM RHY+LH K+   
Sbjct: 334 KNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKE 393

Query: 440 KR 441
           +R
Sbjct: 394 QR 395

>Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {ON}
           YPR015C (REAL)
          Length = 249

 Score = 87.0 bits (214), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 45/62 (72%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGA 439
           + QC  CGKV SR S+L+ H L+HTGD PFKC W  C K+FNVKSNM+RH R H+K+   
Sbjct: 186 RKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKVAK 245

Query: 440 KR 441
           K+
Sbjct: 246 KK 247

>Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {ON}
           YPR015C (REAL)
          Length = 247

 Score = 87.0 bits (214), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 45/62 (72%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGA 439
           + QC  CGKV SR S+L+ H L+HTGD PFKC W  C K+FNVKSNM+RH R H+K+   
Sbjct: 184 RKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKIAK 243

Query: 440 KR 441
           K+
Sbjct: 244 KK 245

>YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON}
           Putative protein of unknown function; overexpression
           causes a cell cycle delay or arrest
          Length = 247

 Score = 86.7 bits (213), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 45/62 (72%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGA 439
           + QC  CGKV SR S+L+ H L+HTGD PFKC W  C K+FNVKSNM+RH R H+K+   
Sbjct: 184 RKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKIAK 243

Query: 440 KR 441
           K+
Sbjct: 244 KK 245

>CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa]
           {ON} some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 348

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (73%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGA 439
           + QC  CGKV SR S+L+ H L+HTGD PFKC W  C+K FNVKSNM+RH + HE++  A
Sbjct: 284 RKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQA 343

Query: 440 K 440
           K
Sbjct: 344 K 344

>NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON} 
          Length = 338

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 37/73 (50%), Positives = 49/73 (67%)

Query: 366 RGAHEIQYNSFGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSN 425
           R A +   N     + QC  CGK+ SR S+L+ H L+HTGD PF+C W SC K+FNVKSN
Sbjct: 255 RSAIQKNLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSN 314

Query: 426 MMRHYRLHEKRGG 438
           M+RH + H+K+G 
Sbjct: 315 MLRHLKSHQKKGA 327

>NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {ON}
           Anc_8.116
          Length = 460

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 47/64 (73%)

Query: 378 VPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           + + QC  CGK+ +R +SLQ H L+H+G RP+KC WP+CEK FNVKSNM RHY++H K+ 
Sbjct: 385 IRRRQCPICGKIVTRVNSLQTHMLIHSGYRPYKCKWPACEKMFNVKSNMNRHYKIHLKKN 444

Query: 438 GAKR 441
              +
Sbjct: 445 WGNK 448

>AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; No
           homolog in Saccharomyces cerevisiae'
          Length = 336

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 45/61 (73%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGA 439
           +NQC  CGKV  R SSL+ H  +HTG RPF C WP CEK FNVKSNM+RHYRLH+ + G 
Sbjct: 273 RNQCPVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRLHQLQRGK 332

Query: 440 K 440
           +
Sbjct: 333 E 333

>NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {ON} 
          Length = 336

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 34/58 (58%), Positives = 43/58 (74%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           K QC  CGK+ SR S+L+ H L+H+GD PFKC W  C K FNVKSNM+RH++ HEK+ 
Sbjct: 254 KKQCDICGKICSRPSTLKTHYLIHSGDTPFKCAWKGCTKAFNVKSNMLRHFKCHEKKA 311

>SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 359

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 47/63 (74%)

Query: 374 NSFGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           N   + +NQC  CGKV SR S+L+ H LVHTG +P+ C WP C ++FNVKSNM+RHY+ H
Sbjct: 278 NEKNLARNQCHICGKVCSRPSTLRTHVLVHTGVKPYPCEWPGCNRSFNVKSNMIRHYKNH 337

Query: 434 EKR 436
           EK+
Sbjct: 338 EKK 340

>TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.117
           YPR015C
          Length = 162

 Score = 83.6 bits (205), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 34/57 (59%), Positives = 44/57 (77%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           + QC  CGKV SR S+L+ H L+HTGD PFKC W +C K+FNVKSNM+RH + HE++
Sbjct: 100 RKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCSWGNCTKSFNVKSNMLRHLKSHERK 156

>Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 87.0 bits (214), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (72%)

Query: 375 SFGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHE 434
           SF   + QC  CGK+ SR S+L+ H L+HTGD PFKC W  C K+FNVKSNM+RH + HE
Sbjct: 248 SFTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLKSHE 307

Query: 435 KR 436
           ++
Sbjct: 308 RK 309

>KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {ON}
           Anc_8.116 YPR013C
          Length = 410

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 49/75 (65%)

Query: 366 RGAHEIQYNSFGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSN 425
           +  + + + S    + QC  CGK+ SR S+L+ H L+HTGD PFKC W  C K+FNVKSN
Sbjct: 325 KKNYTVNFTSAVKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEDCSKSFNVKSN 384

Query: 426 MMRHYRLHEKRGGAK 440
           M+RH + HE+R   K
Sbjct: 385 MLRHLKSHERRLIKK 399

>NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON} 
          Length = 273

 Score = 85.5 bits (210), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGA 439
           + QC  CGKV SR S+L+ H L+HTGD PFKC W  C K FNVKSNM+RH + HE+R   
Sbjct: 208 RKQCSVCGKVCSRPSTLKTHFLIHTGDTPFKCSWEGCHKAFNVKSNMLRHMKSHERRRNK 267

Query: 440 K 440
           K
Sbjct: 268 K 268

>KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {ON}
           some similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 111

 Score = 80.9 bits (198), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 45/56 (80%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           QC +C KVF+RSS+LQ+H LVHTGDRPF C   SC K+FNVKSNM RH++ H++ G
Sbjct: 50  QCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105

>Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 85.5 bits (210), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 33/57 (57%), Positives = 43/57 (75%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           + QC  CGK+ SR S+L+ H L+HTGD PFKC W  C K+FNVKSNM+RH + HE++
Sbjct: 253 RKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLKSHERK 309

>KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON} 
          Length = 435

 Score = 86.7 bits (213), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 33/57 (57%), Positives = 42/57 (73%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGG 438
           QC  CGK+ SR S+L+ H  +HTGD PFKC WP+C ++FNVKSNMMRH + H K+  
Sbjct: 353 QCPVCGKICSRPSTLKTHYFIHTGDTPFKCTWPNCGRSFNVKSNMMRHMKAHAKKAA 409

>YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON}
           Putative zinc finger protein; YPR013C is not an
           essential gene
          Length = 317

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 33/57 (57%), Positives = 43/57 (75%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           + QC  CGK+ SR S+L+ H L+HTGD PFKC W  C K+FNVKSNM+RH + HE++
Sbjct: 253 RKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309

>Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 33/57 (57%), Positives = 43/57 (75%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           + QC  CGK+ SR S+L+ H L+HTGD PFKC W  C K+FNVKSNM+RH + HE++
Sbjct: 253 RKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLKSHERK 309

>CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some
           similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c or uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q03825 Saccharomyces
           cerevisiae YMR164c MSS11
          Length = 344

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 34/62 (54%), Positives = 43/62 (69%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGA 439
           + QC  CGK+ SR S+L+ H L+HTGD PFKC W  C K FNVKSN++RH + HEK    
Sbjct: 283 RKQCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLKSHEKNSLN 342

Query: 440 KR 441
           K+
Sbjct: 343 KK 344

>Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}
           similar to Ashbya gossypii AEL077W
          Length = 381

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 41/55 (74%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHE 434
           +NQC  C KV  R SSL+ H  +HTG RPF C WP CEK FNVKSNM+RHYRLH+
Sbjct: 295 RNQCPVCAKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRLHQ 349

>KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON}
           Anc_8.117 YPR015C
          Length = 303

 Score = 83.6 bits (205), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 34/61 (55%), Positives = 43/61 (70%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGA 439
           + +C  CGK+ SR S+L+ H L+HTGD PFKC W  C K FNVKSNM+RH + HEK+   
Sbjct: 230 RKKCPVCGKMCSRPSTLKTHYLIHTGDTPFKCTWSGCPKAFNVKSNMLRHVKSHEKKLSK 289

Query: 440 K 440
           K
Sbjct: 290 K 290

>KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {ON} 
          Length = 435

 Score = 84.7 bits (208), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 45/65 (69%)

Query: 371 IQYNSFGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHY 430
           I + S    + QC  CGKV SR S+L+ H L+HTGD PFKC W  C K+FNVKSN+MRH 
Sbjct: 360 INFTSAVKMRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCTWGDCTKSFNVKSNLMRHL 419

Query: 431 RLHEK 435
           + HE+
Sbjct: 420 KSHER 424

>SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 317

 Score = 82.8 bits (203), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 34/56 (60%), Positives = 43/56 (76%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           K QC  CGK+ SR S+L+ H L+HTG  PFKC W +C K+FNVKSNM+RHY+ HE+
Sbjct: 257 KRQCPICGKLCSRPSTLKTHFLIHTGATPFKCPWLNCNKSFNVKSNMLRHYKSHER 312

>TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {ON} 
          Length = 462

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 34/55 (61%), Positives = 43/55 (78%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           QC  CGKV SR S+L+ H L+HTGD P+KC W +C K+FNVKSNM+RH + HEK+
Sbjct: 356 QCPVCGKVCSRPSTLKTHYLIHTGDTPYKCKWLNCTKSFNVKSNMLRHLKNHEKK 410

>KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]
           {ON} weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 374

 Score = 83.2 bits (204), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 33/56 (58%), Positives = 44/56 (78%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           K +C +CGK F+R SSL  H  +HTGD+P+KC++P+C K FN KSNM+RHY+LH K
Sbjct: 303 KYRCAECGKAFARPSSLSTHMNIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLHLK 358

>KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa]
           {ON} some similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 285

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 30/52 (57%), Positives = 41/52 (78%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHE 434
           C +CGK F+R S+L+ H LVH+GD+PF+C W  C K FNVKSN++RH +LH+
Sbjct: 234 CAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKLHK 285

>NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON} 
          Length = 256

 Score = 80.1 bits (196), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 43/59 (72%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGAK 440
           +C  CGK+ SR S+L+ H L+HTGD PFKC +  C+K+FNVKSNM RH + HE++   K
Sbjct: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKNKK 254

>KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {ON} 
          Length = 519

 Score = 82.0 bits (201), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 42/57 (73%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           + QC  CGK+ SR S+L+ H ++HTGD PFKC W  C K+FNVKSNM RH + H+++
Sbjct: 454 RKQCPVCGKICSRPSTLKTHYMIHTGDTPFKCPWEGCNKSFNVKSNMFRHLKSHKRK 510

>KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {ON}
           weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C
          Length = 423

 Score = 81.3 bits (199), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 35/64 (54%), Positives = 46/64 (71%)

Query: 371 IQYNSFGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHY 430
           I  +S  + KNQC  CG++ SR S+LQ H  +HTGD+P+KC   +C K FNVKSNM+RHY
Sbjct: 331 INDSSLPLKKNQCHICGRICSRPSTLQTHLSIHTGDKPYKCPKRNCHKRFNVKSNMLRHY 390

Query: 431 RLHE 434
           + HE
Sbjct: 391 KRHE 394

>TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON}
           Anc_2.531
          Length = 449

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 44/59 (74%)

Query: 378 VPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           V ++QC  CGK+ +RSSSLQ H  VHT  RPFKC W +C KTFNVKSN+ RH +LH +R
Sbjct: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436

>Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON}
           complement(124703..125578) [876 nt, 292 aa]
          Length = 291

 Score = 77.4 bits (189), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 43/57 (75%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           + QC  C K+ SR ++L+ H L+HTGD PFKC W +C K+FNVKSNM+RH + H+++
Sbjct: 148 RKQCHICKKICSRPATLKTHLLIHTGDTPFKCPWENCPKSFNVKSNMLRHLKSHQRK 204

>ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON}
           NOHBY437; No homolog in Saccharomyces cerevisiae
          Length = 278

 Score = 76.3 bits (186), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 39/61 (63%)

Query: 375 SFGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHE 434
           S    KN C  CG+   R S+L+ H L HTG RPF C  P C K+FNV+SNM+RH RLH 
Sbjct: 198 SVSTKKNVCKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERLHS 257

Query: 435 K 435
           +
Sbjct: 258 R 258

>Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON}
           similar to Ashbya gossypii ADR308C
          Length = 276

 Score = 76.3 bits (186), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 40/59 (67%)

Query: 377 GVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           G+ KN C  CG+   R S+L+ H L HTG RPF C  P C K+FNV+SNM+RH RLH +
Sbjct: 209 GIRKNVCKVCGRECRRPSTLKTHMLTHTGQRPFCCRHPGCNKSFNVRSNMLRHERLHGR 267

>NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON} 
          Length = 350

 Score = 77.0 bits (188), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 41/53 (77%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C+ CGK  +RS+SL+ H L+HTG RPFKC WP+C+ + +VKSN+ RH++ H K
Sbjct: 287 CVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFKSHLK 339

>KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 168

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           +C  CGK FSR S L  HAL+HTG +PF C  P C K FNVKSN++RH ++H+K
Sbjct: 112 ECHVCGKTFSRPSGLNTHALIHTGHQPFVCDVPHCGKRFNVKSNLIRHKKIHDK 165

>Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON}
           (118605..120158) [1554 nt, 518 aa]
          Length = 517

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (70%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           QC  CGK  SR+SSL +H  +HT  RP+KC W  C KTFNVKSN+ RH +LH K+
Sbjct: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKK 513

>SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {ON}
           some similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 321

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/57 (57%), Positives = 42/57 (73%)

Query: 379 PKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           PK +C +CGK F R SSL  H  +HTGD+PF C + +C KTFN KSNM+RH++LH K
Sbjct: 233 PKYECPQCGKGFVRPSSLNTHMNIHTGDKPFVCPFKNCGKTFNAKSNMLRHHKLHFK 289

>Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {ON}
           YDR043C (NRG1) - transcriptional repressor which can
           bind to UAS-1 in the STA1 promoter and which can
           interact with Ssn6p [contig 36] FULL
          Length = 302

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (71%)

Query: 379 PKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           P+  C KCGKVF+R SSL  H   HTGD+P+ C + +C+K FN +SNM RHY+LH K
Sbjct: 196 PRYTCTKCGKVFNRPSSLATHNNTHTGDKPYCCPFDNCDKQFNARSNMTRHYKLHFK 252

>NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531
          Length = 354

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 43/54 (79%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           +C  C K+ +RS+SL++H L+HTG++P+KC WP+C+ + +VKSN+ RHY+ H K
Sbjct: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350

>AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No
           homolog in Saccharomyces cerevisiae
          Length = 277

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 41/51 (80%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C +CGK F+R+SSL+ H  +HTGDRPF C + +C K+FN +SNM+RH++LH
Sbjct: 185 CTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKLH 235

>Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON}
           similar to Ashbya gossypii AGL207W
          Length = 301

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 30/53 (56%), Positives = 41/53 (77%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C  CGK F+R+SSL+ H  +HTGDRPF C + +C K+FN +SNM+RH++LH K
Sbjct: 209 CSDCGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKLHFK 261

>SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {ON}
           conserved hypothetical protein
          Length = 288

 Score = 73.9 bits (180), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (66%), Gaps = 2/63 (3%)

Query: 379 PKNQ--CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           PK Q  C +CGK F R S+L+ H+++H G  P+ C W  C K FNVK N++RHYR+H K+
Sbjct: 214 PKLQHLCPECGKSFRRPSALKTHSIIHVGRSPYACTWNGCSKRFNVKGNLLRHYRIHTKK 273

Query: 437 GGA 439
             A
Sbjct: 274 KEA 276

>TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298
          Length = 833

 Score = 75.9 bits (185), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 32/63 (50%), Positives = 43/63 (68%)

Query: 378 VPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           + KN+C  C K F R SSL+ H  +HTG +PFKC    C+K+FN +SNM+RHY+LH K G
Sbjct: 711 LTKNKCEYCLKKFRRPSSLKTHLNIHTGIQPFKCPSKRCDKSFNARSNMLRHYKLHFKIG 770

Query: 438 GAK 440
             +
Sbjct: 771 NNR 773

>Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C -
           Hypothetical ORF [contig 227] FULL
          Length = 254

 Score = 73.2 bits (178), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           +C  CGK FSR S L  HAL+HTG +P+ C  P+C K FNVKSN+MRH ++H K
Sbjct: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248

>Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON}
           (65876..67336) [1461 nt, 487 aa]
          Length = 486

 Score = 75.5 bits (184), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 30/55 (54%), Positives = 40/55 (72%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           +C  CGK  +R+ SL AH L+HT  RP+KC W +C KTFNVKSN+ RH ++H K+
Sbjct: 425 ECSVCGKRVTRAYSLHAHMLIHTKVRPYKCDWENCGKTFNVKSNLNRHVKIHLKK 479

>KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {ON}
           conserved hypothetical protein
          Length = 342

 Score = 74.3 bits (181), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (65%)

Query: 379 PKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGG 438
           P+  C  CGK F+R SSL  H   HTGD+PF C + +C+K FN +SNM RHY+LH K  G
Sbjct: 236 PRYVCASCGKCFNRPSSLATHNNTHTGDKPFTCPFENCDKQFNARSNMTRHYKLHFKTEG 295

Query: 439 A 439
            
Sbjct: 296 G 296

>Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON}
           similar to Ashbya gossypii ADL040W
          Length = 310

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%)

Query: 379 PKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGG 438
           PK  C  CG+  +R S+L+ H L+HTG+ PF+C WP C K FNV+SNM RH   H+++  
Sbjct: 226 PKKTCTVCGRHCTRPSTLKTHMLIHTGELPFECNWPGCRKRFNVRSNMKRHLNSHKRKLI 285

Query: 439 AK 440
            K
Sbjct: 286 KK 287

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 38/57 (66%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGA 439
           C  CGK F R SSL  H  +HTG++PF C + +C K+FN KSNM+RHY+LH K    
Sbjct: 307 CSICGKKFKRPSSLSTHMNIHTGNKPFTCPFTNCTKSFNAKSNMLRHYKLHFKLSSG 363

>ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR013C
          Length = 330

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 39/54 (72%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           CL CG+  +R S+L+ H L+HTG+ PF+C WP C K FNV+SNM RH   H++R
Sbjct: 260 CLVCGRRCTRPSTLKTHMLIHTGELPFQCSWPGCSKRFNVRSNMNRHVNSHKRR 313

>TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON} 
          Length = 501

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 29/52 (55%), Positives = 37/52 (71%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           QC  C +V +RS SL AH LVHT D+PFKC W  C K F++KSN+ RH ++H
Sbjct: 427 QCPICNRVTTRSYSLHAHMLVHTKDKPFKCEWQDCGKAFSIKSNLSRHMKIH 478

>Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON}
           similar to Ashbya gossypii ADL050W
          Length = 179

 Score = 69.3 bits (168), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (68%), Gaps = 3/61 (4%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK---RGGA 439
           C  C K F+R +SL  H L+H   RP++C +P C+KTFNVKSN+ RH ++H+K   +GG 
Sbjct: 111 CPVCLKEFTRKTSLNTHLLIHADIRPYRCKYPDCKKTFNVKSNLNRHLKIHKKQELKGGE 170

Query: 440 K 440
           K
Sbjct: 171 K 171

>SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 261

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 39/57 (68%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGA 439
           C +C KVF R S+L+ H+++H G  P+ C  P C K FNVKSN++RH + H  RGGA
Sbjct: 201 CPECEKVFGRPSALRTHSIIHIGKSPYICQLPGCAKRFNVKSNLLRHVKSHYGRGGA 257

>NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 28/51 (54%), Positives = 39/51 (76%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C  CGK F R SSL+ H+ + +G+RP+KC + +C K+FN KSNM+RHY+LH
Sbjct: 241 CDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYKLH 291

>ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No
           homolog in Saccharomyces cerevisiae
          Length = 173

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (68%)

Query: 378 VPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           V    C  C K F+R +SLQ H L+HT  +P++C + +C KTFNVKSN+ RH R+H++
Sbjct: 113 VSGKTCAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRHERIHKR 170

>TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 37/56 (66%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           K  C  CGK F R SSL  H  +HTG +P++C   SC K FN KSNM+RHY+LH K
Sbjct: 269 KYDCNICGKKFKRPSSLNTHMNIHTGQKPYRCPHISCSKAFNAKSNMLRHYKLHFK 324

>Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa]
           {ON} complement(127243..128337) [1095 nt, 365 aa]
          Length = 364

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 36/54 (66%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           K  C  CGK F R SSL  H  +HTG++P+ C    C+K FN KSNM+RHY+LH
Sbjct: 275 KYSCDVCGKKFKRPSSLNTHTNIHTGNKPYSCPAAKCKKAFNAKSNMLRHYKLH 328

>SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 271

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 36/53 (67%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C KC K F R S L+ H ++H G  PF C WP+C K FNVKSN++RHYR H +
Sbjct: 218 CPKCKKEFKRPSGLRTHMVIHYGRNPFFCKWPNCSKKFNVKSNLLRHYRSHNR 270

>NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON}
           Anc_3.298
          Length = 370

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (65%)

Query: 378 VPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           + K  C  C K F R SSL  H  +HTG++P+ C +  C K+FN KSNM+RHY+LH K
Sbjct: 255 IAKYGCKHCNKRFKRPSSLNTHMNIHTGNKPYVCPYEECRKSFNAKSNMLRHYKLHFK 312

>KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 39/56 (69%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           K +C  CGK F R SSL  H+ +HTG +P+ C + +C K+FN KSNM RHY+LH K
Sbjct: 207 KFKCCVCGKGFRRPSSLATHSNIHTGFKPYVCPYENCHKSFNAKSNMFRHYKLHFK 262

>Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to
           Ashbya gossypii AGR186C
          Length = 312

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 39/54 (72%), Gaps = 2/54 (3%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           C  CGK F+R S+LQ H L+HT  +PFKC +  CEK FNVKSN+ RH R+H ++
Sbjct: 173 CPLCGKSFTRRSTLQIHLLIHTNLKPFKCSF--CEKEFNVKSNLNRHERIHRQK 224

>KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}
           Anc_3.298
          Length = 394

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (66%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGA 439
           C  C K F R SSL  H  +HTG +P++C + +C+K+FN KSNM+RHY+LH K    
Sbjct: 280 CKVCSKRFKRPSSLSTHMNIHTGYKPYQCPFSNCQKSFNAKSNMLRHYKLHFKLSSG 336

>Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON}
           similar to Ashbya gossypii ADL051W
          Length = 223

 Score = 66.6 bits (161), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 41/59 (69%), Gaps = 1/59 (1%)

Query: 377 GVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           GV K  C  C K F+R +SLQ H L+HT  +P++C +  C KTFNVKSN+ RH R+H++
Sbjct: 156 GVGKT-CHICLKSFTRKTSLQTHMLIHTKVKPYRCSYQRCNKTFNVKSNLYRHERIHKR 213

>KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 34/53 (64%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C  CGK F R SSL  H  +HTG +PF C    C KTFN +SNM+RHY+ H K
Sbjct: 235 CNVCGKRFKRPSSLSTHTNIHTGKKPFHCPLAKCTKTFNARSNMLRHYKAHFK 287

>Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii ADL042W
          Length = 305

 Score = 67.4 bits (163), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 37/53 (69%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C  CGK F R S+L+ H +VH  D+P+KC    C+K FNVKSNM+RH R H++
Sbjct: 251 CEICGKDFKRPSALRTHMVVHNNDKPYKCEHIDCQKRFNVKSNMLRHMRKHKE 303

>AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON}
           NOHBY743; No homolog in Saccharomyces cerevisiae
          Length = 287

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 39/55 (70%), Gaps = 2/55 (3%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           C  CGK F+R S+LQ H L+HT  +PFKC +  C+K FNVKSN+ RH R+H ++ 
Sbjct: 169 CPLCGKSFTRRSTLQIHLLIHTNLKPFKCSF--CDKEFNVKSNLNRHERIHRQKA 221

>CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {ON}
           some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 315

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 37/53 (69%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C  C K F R SSL  H  +HTG++P+ C + +C K+FN KSNM+RHY+LH K
Sbjct: 175 CKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKLHFK 227

>KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON}
           Anc_3.298
          Length = 322

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 34/53 (64%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C  CGK F+R SSL  H   HTGD+P+ C   SC K FN +SNM RHY+ H K
Sbjct: 239 CSICGKRFARPSSLNTHLNTHTGDKPYTCPHGSCSKVFNARSNMTRHYKTHFK 291

>ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR015C
          Length = 281

 Score = 65.1 bits (157), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 36/53 (67%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C  CGK F R S+L+ H +VH  D+P+ C    C+K FNVKSNM+RH R H++
Sbjct: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRKHKE 279

>ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No
           homolog in Saccharomyces cerevisiae
          Length = 146

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (66%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C  C K F+R +SL  H L+H   RP+ C + +C K+FNVKSN+ RH R+H
Sbjct: 78  CPVCLKEFTRKTSLNTHLLIHADIRPYLCDYANCNKSFNVKSNLNRHLRIH 128

>TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298
          Length = 511

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 379 PKN---QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           PKN    C  C K F R SSL+ H  +HTG +P+ C + +C K FN KSNM+RH++LH
Sbjct: 410 PKNFKYHCDICHKFFRRPSSLKTHMNIHTGVKPYLCPYNNCYKPFNAKSNMLRHFKLH 467

>KLLA0F22319g Chr6 complement(2086613..2087224) [612 bp, 203 aa]
           {ON} some similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 203

 Score = 58.2 bits (139), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 35/48 (72%)

Query: 387 GKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHE 434
           GK FSR S+L+ H +VH+  +PFKC +  C K++NVKSN+ RH + H+
Sbjct: 152 GKEFSRPSTLKTHIVVHSQAKPFKCTYLDCNKSYNVKSNLRRHEKKHK 199

>NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa]
           {ON} Anc_2.598
          Length = 822

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 382 QCLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           +C  CGK F RS  L+ H   VH+ +RPF C  P+C+K F+   N+ +H + H+KRG
Sbjct: 766 KCETCGKAFRRSEHLKRHIRSVHSSERPFAC--PTCDKKFSRSDNLAQHIKTHKKRG 820

>KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 682

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (61%), Gaps = 5/63 (7%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR---GG 438
           +C+ CGK F+ SSSL+ H   HTG++P +C    C K FN  SN+ +H R HE++   G 
Sbjct: 606 KCVHCGKGFATSSSLRIHIRTHTGEKPLEC--KVCGKRFNESSNLSKHMRTHERKYKCGK 663

Query: 439 AKR 441
            KR
Sbjct: 664 CKR 666

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 386 CGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           CGKV ++   L  H  VHT  +P KC  P C KTF+ +  + +H R H
Sbjct: 554 CGKVITQRQKLLRHLRVHTRYKPCKC--PHCAKTFSTQDILQQHIRTH 599

 Score = 34.7 bits (78), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 3/53 (5%)

Query: 386 CGKVFSRSSSLQAHA-LVHT--GDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C +VF+    L  H   VH   G   + C W +C K    +  ++RH R+H +
Sbjct: 521 CMQVFNSCEELNGHIEKVHIPRGKSSYVCGWENCGKVITQRQKLLRHLRVHTR 573

>Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to
           Ashbya gossypii ADL050W
          Length = 251

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 33/52 (63%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHE 434
           C  C K F+R  S+  H +VHT  +P+ C +P C+K FNVK N+ RH + H+
Sbjct: 157 CPICYKTFTRKISVNIHMVVHTNLKPYACDYPGCKKKFNVKGNLQRHSKCHK 208

>TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.326
           YLR131C
          Length = 680

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 2/73 (2%)

Query: 366 RGAHEIQYNSFGVPKNQCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVK 423
           RG+ +I          +CL   CGK F R  ++++H   H  DRP+KC  P C+K F   
Sbjct: 477 RGSIDIYVKELEGKMFECLYPDCGKTFKRRYNVRSHIQTHLQDRPYKCDMPGCDKGFVRN 536

Query: 424 SNMMRHYRLHEKR 436
            +++RH + HE++
Sbjct: 537 HDLLRHKKCHEEK 549

>Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C
           (ZAP1) - Metalloregulatory protein involved in
           zinc-responsive transcriptional regulation [contig 224]
           FULL
          Length = 711

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           +C  CGK F+ SSSL+ H   HTG++P +C    C K FN  SN+ +H R HE++
Sbjct: 635 KCSHCGKGFATSSSLRIHIRTHTGEKPLEC--KVCGKRFNESSNLSKHMRTHERK 687

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C+ C K FS    LQ H   H+G++P+KC    C K F   S++  H R H
Sbjct: 607 KCVHCLKTFSTQDILQQHMRTHSGEKPYKC--SHCGKGFATSSSLRIHIRTH 656

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 386 CGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           CG+V ++   L  H  VHT  +P KCV   C KTF+ +  + +H R H
Sbjct: 583 CGRVITQRQKLLRHLRVHTRYKPCKCV--HCLKTFSTQDILQQHMRTH 628

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 13/53 (24%), Positives = 23/53 (43%), Gaps = 3/53 (5%)

Query: 386 CGKVFSRSSSLQAHAL---VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C + FS    L  H     +  G   + C W +C +    +  ++RH R+H +
Sbjct: 550 CMQEFSSCEELNTHIEKEHIPRGKSSYVCGWENCGRVITQRQKLLRHLRVHTR 602

>CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa]
           {ON} weakly similar to uniprot|P41696 Saccharomyces
           cerevisiae YOR113w AZF1 asparagine-rich zinc finger
           protein
          Length = 642

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHE 434
           +C  CGK F+++ +L+ H  +HTG+RPFKC    C+KTF  + N+  H   HE
Sbjct: 509 ECEFCGKRFTQAGNLRTHRRLHTGERPFKC--DKCDKTFARRGNLTAHEFTHE 559

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           QC  C K+FS+S+ L  H   H G +PF+C +  C K F    N+  H RLH
Sbjct: 481 QCAYCSKMFSQSTHLDVHIKAHMGYKPFECEF--CGKRFTQAGNLRTHRRLH 530

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRH 429
           +C KC K F+R  +L AH   H   +P+ C   +C K F+   NM  H
Sbjct: 537 KCDKCDKTFARRGNLTAHEFTHESIKPYICRLDNCFKRFSQLGNMKSH 584

>NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326
          Length = 620

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 2/60 (3%)

Query: 382 QCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGA 439
           +CL   CGK+F R  ++++H   H  D+P+ C +P CEK F    +++RH + H  R  +
Sbjct: 481 ECLYEDCGKIFKRRYNVRSHIQTHLEDKPYACDFPGCEKAFVRNHDLVRHKKSHANRTSS 540

>Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa]
           {ON} complement(192400..194424) [2025 nt, 675 aa]
          Length = 674

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 41/76 (53%), Gaps = 2/76 (2%)

Query: 366 RGAHEIQYNSFGVPKNQCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVK 423
           RG+ +I        K QCL  KC K F R  ++++H   H  DRP+KC +  C+K F   
Sbjct: 471 RGSIDIYVKEMPDKKFQCLYPKCDKTFKRRYNIRSHIQTHLEDRPYKCDFEGCDKAFVRN 530

Query: 424 SNMMRHYRLHEKRGGA 439
            +++RH + H ++  A
Sbjct: 531 HDLIRHKKSHAEKSYA 546

>KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.162
           YOR113W
          Length = 572

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           +C  CGK F++  +L+ H  +HTG++PF C +  C K F+ K N+  H   HEK
Sbjct: 417 KCTWCGKGFTQGGNLKTHVRLHTGEKPFSCEF--CSKRFSRKGNLTAHLVTHEK 468

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 36/67 (53%), Gaps = 2/67 (2%)

Query: 367 GAHEIQYNSFGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNM 426
           G  E    + G+ +++C  C K+F + + L+ H   H GD+P+KC W  C K F    N+
Sbjct: 374 GGVEKPIGANGIKQHECNICHKLFIQLTHLEVHLRSHLGDKPYKCTW--CGKGFTQGGNL 431

Query: 427 MRHYRLH 433
             H RLH
Sbjct: 432 KTHVRLH 438

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 26/53 (49%), Gaps = 1/53 (1%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHY-RLHE 434
           C  C K FSR  +L AH + H   RPF C    C KTF    NM  H  R H+
Sbjct: 446 CEFCSKRFSRKGNLTAHLVTHEKVRPFVCKLNGCMKTFTQLGNMKSHQNRFHQ 498

>Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa]
           {ON} complement(131384..133768) [2385 nt, 795 aa]
          Length = 794

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           QC  CGK F++  +L+ H  +HTG+RP+ C    C K F+ K N+  H+  H+K
Sbjct: 537 QCEYCGKRFTQGGNLRTHQRLHTGERPYSCEL--CGKKFSRKGNLAAHFLTHQK 588

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 2/67 (2%)

Query: 367 GAHEIQYNSFGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNM 426
           G  E   ++ G+ +++C  C + F++S+ L+ H   H G +PF+C +  C K F    N+
Sbjct: 494 GGVEKPKSAHGIKQHECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNL 551

Query: 427 MRHYRLH 433
             H RLH
Sbjct: 552 RTHQRLH 558

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHY-RLH 433
           C  CGK FSR  +L AH L H   +P+ C    C K+F    NM  H  R H
Sbjct: 566 CELCGKKFSRKGNLAAHFLTHQKLKPYVCKLDECNKSFTQLGNMKAHQNRFH 617

>AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR043C (NRG1) and
           YBR066C (NRG2)
          Length = 140

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (57%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           K+ C  CGK F+ S  L  H  +HTG++   C +P C + F+   N ++HYR H KR
Sbjct: 79  KHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKR 135

>ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 849

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           +C  CGK FS SSSL+ H   HTG++P +C    C K FN  SN+ +H + H K+
Sbjct: 764 KCHLCGKSFSVSSSLKIHIRTHTGEKPLQC--KICGKRFNESSNLNKHLKTHRKK 816

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C K FS   +L  H   H+G++PFKC    C K+F+V S++  H R H
Sbjct: 736 KCQVCLKSFSSEDTLNQHMRTHSGEKPFKCHL--CGKSFSVSSSLKIHIRTH 785

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 386 CGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C + F++   +  H  VH+G +PFKC    C K+F+ +  + +H R H
Sbjct: 712 CCRKFTQRQKMVRHLKVHSGYKPFKC--QVCLKSFSSEDTLNQHMRTH 757

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 3/51 (5%)

Query: 386 CGKVFSRSSSLQAHAL---VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C + FS +  L  H     +  G   + C W  C + F  +  M+RH ++H
Sbjct: 679 CDQCFSGAEDLSNHLEKFHLPRGKSEYHCHWKGCCRKFTQRQKMVRHLKVH 729

>NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON}
           Anc_1.326
          Length = 773

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 35/60 (58%), Gaps = 2/60 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGAKR 441
           +C  CGK F+ SSSL+ H   HTG++P  C    C K FN  SN+ +H + H KR   ++
Sbjct: 696 KCDICGKRFAISSSLKIHIRTHTGEKPLHC--KICGKAFNESSNLSKHMKTHLKRFKCEK 753

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           QC  C K FS   +L+ H   H+G++PFKC    C K F + S++  H R H
Sbjct: 668 QCSICKKHFSNEETLKQHERTHSGEKPFKC--DICGKRFAISSSLKIHIRTH 717

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 386 CGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C K+FS+   L  H  VH+G +PF+C    C+K F+ +  + +H R H
Sbjct: 644 CHKIFSQRQRLVRHMRVHSGYKPFQC--SICKKHFSNEETLKQHERTH 689

 Score = 34.3 bits (77), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 3/51 (5%)

Query: 386 CGKVFSRSSSLQAHAL---VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C   FS +  L  H     +  G   ++C W +C K F+ +  ++RH R+H
Sbjct: 611 CSGSFSSAQELNIHMENMHLLKGQSQYECHWANCHKIFSQRQRLVRHMRVH 661

>Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii ACR264W
          Length = 775

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 27/48 (56%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRH 429
           +C KCGK FSR  +L AH L H   +PF+C    C K+F    NM  H
Sbjct: 548 ECDKCGKRFSRKGNLAAHMLTHENHKPFQCKLDDCNKSFTQLGNMKAH 595

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHE 434
           QC  CGK F++  +L+ H  +HTG+RP++C    C K F+ K N+  H   HE
Sbjct: 520 QCEYCGKRFTQGGNLRTHVRLHTGERPYEC--DKCGKRFSRKGNLAAHMLTHE 570

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 375 SFGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           S GV +++C  C K F++S+ L+ H   H G +PF+C +  C K F    N+  H RLH
Sbjct: 485 SRGVKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 541

>SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 767

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGAKR 441
           +C  C K F+ SSSL+ H   HTG++P KC    C K FN  SN+ +H + HE++   ++
Sbjct: 687 KCTYCTKQFATSSSLRIHIRTHTGEKPLKC--KICGKRFNESSNLSKHMKTHERKYKCEK 744

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C K FS    LQ H   H+G+RPFKC +  C K F   S++  H R H
Sbjct: 659 KCPHCTKKFSTEDILQQHIRTHSGERPFKCTY--CTKQFATSSSLRIHIRTH 708

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 386 CGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C K F++   L  H  VH+G +PFKC  P C K F+ +  + +H R H
Sbjct: 635 CSKSFTQRQKLLRHLKVHSGYKPFKC--PHCTKKFSTEDILQQHIRTH 680

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 386 CGKVFSRSSSLQAHAL---VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C +VF    +L  H     +  G   ++C W +C K+F  +  ++RH ++H
Sbjct: 602 CSQVFPNPEALNNHIESQHIPRGQSSYQCSWDTCSKSFTQRQKLLRHLKVH 652

>NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON}
           Anc_2.162
          Length = 839

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 34/54 (62%), Gaps = 2/54 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           QC  CGK F++  +L+ H  +HTG++P++C    C+K F+ K N+  H   H+K
Sbjct: 544 QCGYCGKRFTQGGNLRTHQRLHTGEKPYECEL--CDKKFSRKGNLAAHLLTHQK 595

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 25/48 (52%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRH 429
           +C  C K FSR  +L AH L H   +PF C   +C ++F    NM  H
Sbjct: 572 ECELCDKKFSRKGNLAAHLLTHQKVKPFICKLDNCNRSFTQLGNMKAH 619

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 377 GVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           G  +++C  C ++F++S+ L+ H   H G +P++C +  C K F    N+  H RLH
Sbjct: 511 GSKQHKCPYCHRLFAQSTHLEVHIRSHLGYKPYQCGY--CGKRFTQGGNLRTHQRLH 565

>TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.326
           YJL056C
          Length = 985

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 35/58 (60%), Gaps = 4/58 (6%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRL--HEKRG 437
           +C  CGK FS SSSL+ H   HTG++PF+C    C K F   SN  +H ++  HEK G
Sbjct: 929 KCEICGKSFSISSSLKIHVRTHTGEKPFEC--KVCGKRFVESSNYSKHMKVHQHEKMG 984

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C + FS   +L  H   H+G++P+KC    C K+F++ S++  H R H
Sbjct: 901 KCDVCSRCFSSKETLIQHYRTHSGEKPYKC--EICGKSFSISSSLKIHVRTH 950

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 386 CGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C KVF +   +  H   H+G +PFKC    C + F+ K  +++HYR H
Sbjct: 877 CHKVFKQRQKILRHLKTHSGFKPFKC--DVCSRCFSSKETLIQHYRTH 922

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 5/62 (8%)

Query: 377 GVPKNQC--LKCGKVFSRSSSLQAHAL---VHTGDRPFKCVWPSCEKTFNVKSNMMRHYR 431
           G  K QC    C  VF+    L  H     +  G   ++C W +C K F  +  ++RH +
Sbjct: 833 GNVKLQCHWEDCTDVFATPEELSNHLENFHLPRGKNSYECKWHNCHKVFKQRQKILRHLK 892

Query: 432 LH 433
            H
Sbjct: 893 TH 894

>ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR113W (AZF1)
          Length = 769

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 27/48 (56%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRH 429
           +C KCGK FSR  +L AH L H   +PF+C    C K+F    NM  H
Sbjct: 544 ECDKCGKRFSRKGNLAAHMLTHENYKPFQCKLDDCNKSFTQLGNMKAH 591

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHE 434
           QC  CGK F++  +L+ H  +HTG+RP++C    C K F+ K N+  H   HE
Sbjct: 516 QCEYCGKRFTQGGNLRTHVRLHTGERPYEC--DKCGKRFSRKGNLAAHMLTHE 566

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 375 SFGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           S GV +++C  C K F++S+ L+ H   H G +PF+C +  C K F    N+  H RLH
Sbjct: 481 SRGVKQHKCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 537

>KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598
           YMR037C
          Length = 620

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 382 QCLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           +C +C K F RS  L+ H   VH+ DRPF C    CEK F+   N+ +H + H+K G
Sbjct: 564 KCGQCVKAFKRSEHLKRHVRSVHSNDRPFACTL--CEKKFSRSDNLSQHLKTHKKHG 618

>KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.162
           YOR113W
          Length = 729

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 2/60 (3%)

Query: 376 FGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
            G+   QC  CGK F++  +L+ H  +HTG++P++C    C K F+ K N+  H   H+K
Sbjct: 516 IGIKPYQCQYCGKKFTQGGNLRTHERLHTGEKPYQCEL--CGKRFSRKGNLAAHVLTHKK 573

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 26/48 (54%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRH 429
           QC  CGK FSR  +L AH L H   +PF C   +C K+F    NM  H
Sbjct: 550 QCELCGKRFSRKGNLAAHVLTHKKIKPFICKLDNCNKSFTQLGNMKGH 597

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 2/67 (2%)

Query: 367 GAHEIQYNSFGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNM 426
           G  E  + S GV +++C  C + F++ + L+ H   H G +P++C +  C K F    N+
Sbjct: 479 GGVEKPFGSHGVKQHECRYCHRFFTQLTHLEVHIRSHIGIKPYQCQY--CGKKFTQGGNL 536

Query: 427 MRHYRLH 433
             H RLH
Sbjct: 537 RTHERLH 543

>ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar to
           uniprot|P33749 Saccharomyces cerevisiae YKL062W MSN4
           Transcriptional activator related to Msn2p activated in
           stress conditions which results in translocation from
           the cytoplasm to the nucleus binds DNA at stress
           response elements of responsive genes inducing gene
           expression
          Length = 584

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 382 QCLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           +C +C K F RS  L+ H   VH+ +RPF C++  CEK F+   N+ +H + H+K G
Sbjct: 528 KCKECSKAFRRSEHLKRHIRSVHSSERPFACMF--CEKKFSRSDNLSQHLKTHKKHG 582

>AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL056C (ZAP1)
          Length = 661

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           C  C K FS SSSL+ H   HTG++P  C    C K FN  SN+ +H ++HE++
Sbjct: 574 CHYCRKQFSTSSSLRVHIRTHTGEKPLSCT--VCGKRFNESSNLSKHMKIHERK 625

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C  C K FS    L  H   H+G+RPF C +  C K F+  S++  H R H
Sbjct: 546 CPHCPKTFSTDDILAQHIRTHSGERPFHCHY--CRKQFSTSSSLRVHIRTH 594

>NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326
          Length = 794

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 383 CL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           CL   C K+F R  +++ H   H  DRP++C +  CEK F    +++RH +LH ++
Sbjct: 663 CLYPNCDKIFKRRYNVRTHIQTHLEDRPYRCEFRGCEKAFVRNHDLVRHKKLHAEK 718

>TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa]
           {ON} Anc_2.598 YMR037C
          Length = 437

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 382 QCLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           +C +C K F RS  L+ H   VH+ +RPF C++  CEK F+   N+ +H + H+K G
Sbjct: 381 KCKECAKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLKTHKKHG 435

>NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa]
           {ON} Anc_1.326
          Length = 836

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGAKR 441
           QC  C K F+ +SSL+ H   HTG++P KC    C K FN  SN+ +H + H K    K+
Sbjct: 767 QCHLCDKRFTIASSLKIHIRTHTGEKPLKC--KICGKAFNESSNLSKHIKTHFKLISTKQ 824

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C K FS   +L+ H   HTG++PF+C    C+K F + S++  H R H
Sbjct: 739 KCPVCNKCFSNLETLKQHQRTHTGEKPFQCHL--CDKRFTIASSLKIHIRTH 788

 Score = 37.7 bits (86), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 3/63 (4%)

Query: 374 NSFGVPKNQCLKCGKVFSRSSSLQAHAL---VHTGDRPFKCVWPSCEKTFNVKSNMMRHY 430
           N  G  K +   C +VF+    L  H     +  G   ++C W  C K F  +  M+RH 
Sbjct: 670 NKLGTIKCEWGLCDQVFNSKEDLNTHLENDHLLKGQSQYQCHWHGCSKKFTQRQKMVRHL 729

Query: 431 RLH 433
           ++H
Sbjct: 730 KVH 732

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 386 CGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C K F++   +  H  VH+G +P KC  P C K F+    + +H R H
Sbjct: 715 CSKKFTQRQKMVRHLKVHSGYKPCKC--PVCNKCFSNLETLKQHQRTH 760

>CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some
           similarities with uniprot|P08153 Saccharomyces
           cerevisiae YDR146c SWI5 or uniprot|P21192 Saccharomyces
           cerevisiae YLR131c ACE2
          Length = 689

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 382 QCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           +CL  +CGK F R  ++++H   H  DRP++C +  C+K F    +++RH + H+++
Sbjct: 557 ECLYPQCGKTFKRRYNIRSHIQTHLEDRPYRCDYDGCDKAFVRNHDLVRHKKTHQEK 613

>Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON}
           complement(48007..48672) [666 nt, 222 aa]
          Length = 221

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR--GGAK 440
           C  C + F R    + H  +HTG++P+KC++ +C K F+    + RH ++H  R  G  K
Sbjct: 21  CEVCNRGFYRLEHKKRHLKIHTGEKPYKCLYLNCSKKFSRSDELNRHSKVHHSRANGSIK 80

Query: 441 R 441
           R
Sbjct: 81  R 81

>KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some
           similarities with uniprot|P47043 Saccharomyces
           cerevisiae YJL056C ZAP1 Zinc-regulated transcription
           factor binds to zinc-responsive promoter elements to
           induce transcription of certain genes in the presence of
           zinc regulates its own transcription contains seven
           zinc- finger domains
          Length = 781

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           +C  C K +S SSSL+ H   HTG++P  C  P C K FN  SN+ +H R H++ 
Sbjct: 721 KCHLCPKSYSTSSSLRIHIRTHTGEKPLSC--PICNKRFNESSNLAKHIRTHKRE 773

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 386 CGKVFSRSSSLQAHAL---VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C K F  + SL  H     V +G   +KC W  C K F  K  ++RH ++H K
Sbjct: 636 CNKEFDSAKSLNEHIENFHVPSGLSSYKCEWEGCNKVFVQKQKLIRHLKVHSK 688

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 386 CGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C KVF +   L  H  VH+  +PF+C    C K FN +  + +H R+H
Sbjct: 669 CNKVFVQKQKLIRHLKVHSKYKPFRCA--ECGKCFNTQDILTQHLRVH 714

>NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {ON}
           Anc_2.598
          Length = 730

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 382 QCLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           +C +C K F RS  L+ H   VH+ +RPF C++  CEK F+   N+ +H + H+K G
Sbjct: 674 KCSECIKAFRRSEHLKRHIRSVHSSERPFACMF--CEKKFSRSDNLSQHLKTHKKHG 728

>Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062W
           (REAL)
          Length = 639

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 383 CLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           C  C K F RS  L+ H   VH+ +RPF C++  CEK F+   N+ +H + H+K G
Sbjct: 584 CKDCDKAFRRSEHLKRHIRSVHSAERPFACMF--CEKKFSRSDNLSQHLKTHKKHG 637

>KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON} 
          Length = 467

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 27/48 (56%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRH 429
           QC  CG+ FSR  +L AH L H   +PF C   +C+K+F    NM  H
Sbjct: 359 QCESCGRRFSRKGNLAAHILTHKNLKPFVCKLDNCDKSFTQLGNMKAH 406

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 33/53 (62%), Gaps = 2/53 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHE 434
           QC  CGK F++  +L+ H  +HTG++P++C   SC + F+ K N+  H   H+
Sbjct: 331 QCQFCGKKFTQGGNLRTHQRLHTGEKPYQC--ESCGRRFSRKGNLAAHILTHK 381

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           K++C  C ++FS+S+ L+ H   H G +PF+C +  C K F    N+  H RLH
Sbjct: 301 KHECPYCHRLFSQSTHLEVHIRSHIGYKPFQCQF--CGKKFTQGGNLRTHQRLH 352

>KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 782

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHY-RLH 433
           +C +CG+ FSR  +L AH L H   +PF+C    C K F    NM  H  R H
Sbjct: 580 ECERCGRKFSRKGNLAAHKLTHDNLKPFECKLDDCNKNFTQLGNMKAHQNRFH 632

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 375 SFGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           S GV + QC  C K F++S+ L+ H   H G +PF C +  C K F    N+  H RLH
Sbjct: 517 SKGVKQFQCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEF--CGKRFTQGGNLRTHIRLH 573

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHE 434
           C  CGK F++  +L+ H  +HTG++P++C    C + F+ K N+  H   H+
Sbjct: 553 CEFCGKRFTQGGNLRTHIRLHTGEKPYEC--ERCGRKFSRKGNLAAHKLTHD 602

>TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1.326
           YJL056C
          Length = 778

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           +C  CG  FS +SSL+ H   HTG++P  C    C K FN  SN+ +H + H+K+
Sbjct: 702 KCDMCGNSFSSASSLKVHKRTHTGEKPLSC--NVCGKRFNSSSNLSKHVKTHKKQ 754

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C  CGK FS    L  H  VH+G++P+KC    C  +F+  S++  H R H
Sbjct: 675 CKTCGKNFSNQEILIQHQRVHSGEKPYKC--DMCGNSFSSASSLKVHKRTH 723

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 385 KCGKVFSRSSSLQAHA-LVHTGDR--PFKCVWPSCEKTFNVKSNMMRHYRLH 433
           KCGK+F     L  H    H   R   + C W +C++ F  K  ++RH R+H
Sbjct: 616 KCGKLFENEEMLNNHVEKTHLLSRQSEYYCKWENCDRRFTQKQKLVRHLRVH 667

 Score = 33.9 bits (76), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 386 CGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C + F++   L  H  VHT  +PF C   +C K F+ +  +++H R+H
Sbjct: 650 CDRRFTQKQKLVRHLRVHTHYKPFTC--KTCGKNFSNQEILIQHQRVH 695

>TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {ON}
           Anc_2.162 YOR113W
          Length = 714

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           QC  CGK F++  +L+ H  +HTG++P++C    C K F+ K N+  H   H+K
Sbjct: 453 QCQYCGKRFTQGGNLRTHQRLHTGEKPYECEL--CGKRFSRKGNLAAHVVTHQK 504

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHY-RLH 433
           +C  CGK FSR  +L AH + H   +PF C    C KTF    NM  H  R H
Sbjct: 481 ECELCGKRFSRKGNLAAHVVTHQKLKPFICKLDGCNKTFTQLGNMKAHQNRFH 533

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 36/67 (53%), Gaps = 2/67 (2%)

Query: 367 GAHEIQYNSFGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNM 426
           G  E    S GV +++C  C + F++S+ L+ H   H G +PF+C +  C K F    N+
Sbjct: 410 GGVEKPKGSHGVKQHECPYCHRFFTQSTHLEVHVRSHIGYKPFQCQY--CGKRFTQGGNL 467

Query: 427 MRHYRLH 433
             H RLH
Sbjct: 468 RTHQRLH 474

>Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {ON}
           YJL056C (REAL)
          Length = 885

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           +C  C K FS SSSL+ H   HTG++P +C    C K FN  SN+ +H + H+K+
Sbjct: 800 KCDICNKKFSISSSLKIHIRTHTGEKPLQC--KICGKRFNESSNLSKHIKTHKKK 852

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C + FS   +L  H   H+G++P+KC    C K F++ S++  H R H
Sbjct: 772 KCKTCKRCFSSEETLVQHTRTHSGEKPYKC--DICNKKFSISSSLKIHIRTH 821

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 386 CGKVFSRSSSLQAH-ALVHT--GDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C   FS +  L  H   VH   G   ++C+W  C +TF  +  ++RH ++H K
Sbjct: 715 CNTSFSNAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSK 767

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 377 GVPKNQCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           G  + QCL   C + F +   L  H  VH+  +P+KC   +C++ F+ +  +++H R H
Sbjct: 737 GKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKC--KTCKRCFSSEETLVQHTRTH 793

>Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar to
           Ashbya gossypii AGR031W
          Length = 257

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 34/57 (59%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           K++C  C K F+ S  L  H  +HTG++  +C +P C + F+   N ++HYR H K+
Sbjct: 192 KHRCQTCDKGFTTSGHLARHNRIHTGEKNHRCHFPGCGQRFSRHDNCLQHYRTHLKK 248

>Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113W
           (AZF1) - similar to Zn-finger transcription factors
           [contig 204] FULL
          Length = 786

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 26/48 (54%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRH 429
           +C KCG+ FSR  +L AH L H   +PF C    C K+F    NM  H
Sbjct: 560 ECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAH 607

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHE 434
           QC  CGK F++  +L+ H  +HTG++P++C    C + F+ K N+  H   HE
Sbjct: 532 QCEYCGKRFTQGGNLRTHVRLHTGEKPYECE--KCGRRFSRKGNLAAHRLTHE 582

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 377 GVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           G  +++C  C K F++S+ L+ H   H G +PF+C +  C K F    N+  H RLH
Sbjct: 499 GAKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 553

>CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa]
           {ON} weakly similar to uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 541

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 382 QCLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           QC  C K F RS  L+ H   VH+ +RPF C++  CEK F+   N+ +H + H++ G
Sbjct: 485 QCADCDKAFRRSEHLKRHVRSVHSTERPFPCMF--CEKKFSRSDNLSQHLKTHKRHG 539

>KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 768

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 26/48 (54%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRH 429
           +C KCG+ FSR  +L AH L H   +PF C    C K+F    NM  H
Sbjct: 543 ECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAH 590

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHE 434
           QC  CGK F++  +L+ H  +HTG++P++C    C + F+ K N+  H   HE
Sbjct: 515 QCEYCGKRFTQGGNLRTHVRLHTGEKPYEC--EKCGRRFSRKGNLAAHRLTHE 565

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 377 GVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           G  +++C  C K F++S+ L+ H   H G +PF+C +  C K F    N+  H RLH
Sbjct: 482 GAKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 536

>Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062W
           (REAL)
          Length = 641

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 382 QCLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           +C  C K F RS  L+ H   VH+ +RPF C++  CEK F+   N+ +H + H+K G
Sbjct: 585 KCKDCEKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLKTHKKHG 639

>KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON}
           Anc_2.533 YMR070W
          Length = 352

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRL 432
           C +C K F RS+ L+ H++ HT   PFKCVW  C+     + NM +H +L
Sbjct: 252 CPQCPKSFQRSAWLKRHSITHTNSHPFKCVW--CKSEHKRRDNMFKHMKL 299

>YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}
           MSN4Transcriptional activator related to Msn2p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 630

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 382 QCLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           +C  C K F RS  L+ H   VH+ +RPF C++  CEK F+   N+ +H + H+K G
Sbjct: 574 KCKDCEKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLKTHKKHG 628

>Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}
           similar to Ashbya gossypii AEL174W
          Length = 663

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           +C  C K F+ SSSL+ H   HTG++P  C    C K FN  SN+ +H ++HE++
Sbjct: 575 KCQFCDKRFTTSSSLRIHIRTHTGEKPLAC--NVCGKRFNESSNLSKHMKIHERK 627

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C K FS    L  H   H+G+RPFKC +  C+K F   S++  H R H
Sbjct: 547 KCPHCSKTFSTEDILSQHIRTHSGERPFKCQF--CDKRFTTSSSLRIHIRTH 596

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 386 CGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C K F++   L  H  VHTG +PFKC  P C KTF+ +  + +H R H
Sbjct: 523 CTKHFAQRQKLLRHIKVHTGYKPFKC--PHCSKTFSTEDILSQHIRTH 568

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 17/30 (56%)

Query: 404 TGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           TG   ++C W  C K F  +  ++RH ++H
Sbjct: 511 TGQSSYQCRWDGCTKHFAQRQKLLRHIKVH 540

>SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 819

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHE 434
           QC  CGK F++  +L+ H  +HTG++P+ C    C K F+ K N+  H   HE
Sbjct: 569 QCEYCGKRFTQGGNLRTHTRLHTGEKPYSC--EKCGKRFSRKGNLAAHMLTHE 619

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHY-RLH 433
           C KCGK FSR  +L AH L H   +P+ C    C K+F    N+  H  R H
Sbjct: 598 CEKCGKRFSRKGNLAAHMLTHENLKPYHCKLDGCSKSFTQLGNLKAHQNRFH 649

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 377 GVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           GV +++C  C K F++S+ L+ H   H G +PF+C +  C K F    N+  H RLH
Sbjct: 536 GVKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHTRLH 590

>Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii ABR089C
          Length = 767

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 382 QCLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGAK 440
           +C +C K F RS  L+ H   VH+ DRPF C +  C+K F+   N+ +H + H K G  K
Sbjct: 699 KCQECTKAFRRSEHLKRHIRSVHSTDRPFPCTY--CDKKFSRSDNLSQHLKTHRKHGDIK 756

>ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL062W
           (MSN4) and YMR037C (MSN2)
          Length = 571

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 382 QCLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGAK 440
           +C +C K F RS  L+ H   VH+ DRPF C +  C+K F+   N+ +H + H K G  K
Sbjct: 505 KCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTY--CDKKFSRSDNLSQHLKTHRKHGDIK 562

>KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518
           YGL209W
          Length = 439

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C + F R    + H   HTG++P KCV+P C K F+    + RH R H
Sbjct: 21  KCGICSRGFHRLEHKKRHLRTHTGEKPHKCVFPGCTKGFSRGDELKRHLRTH 72

>Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062W
           (REAL)
          Length = 628

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 382 QCLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           +C  C K F RS  L+ H   VH+ +RPF C++  CEK F+   N+ +H + H+K G
Sbjct: 572 KCKDCEKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLKTHKKHG 626

>AGL197W Chr7 (325717..328251) [2535 bp, 844 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR146C (SWI5) and
           YLR131C (ACE2)
          Length = 844

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 382 QCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           QCL  +CGK+F+R  ++++H   H  DRPF+C    C K F    +++RH + H ++
Sbjct: 675 QCLYPECGKLFNRRYNIRSHIQTHLEDRPFRCDHEGCTKAFVRNHDLIRHKKTHAEK 731

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 406 DRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           D+ F+C++P C K FN + N+  H + H
Sbjct: 671 DKTFQCLYPECGKLFNRRYNIRSHIQTH 698

>Kpol_344.4 s344 complement(5351..7621) [2271 bp, 756 aa] {ON}
           complement(5351..7621) [2271 nt, 757 aa]
          Length = 756

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 2/73 (2%)

Query: 366 RGAHEIQYNSFGVPKNQCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVK 423
           RG  +I          +CL   C K+F R  ++++H   H  DRP+ C +  C K+F   
Sbjct: 565 RGTIDIYVKELSERAYECLYPNCHKIFKRRYNIRSHIQTHLKDRPYICDFQECNKSFVRN 624

Query: 424 SNMMRHYRLHEKR 436
            +++RH + H KR
Sbjct: 625 HDLVRHKKSHSKR 637

>YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON}
           ZAP1Zinc-regulated transcription factor; binds to
           zinc-responsive promoters to induce transcription of
           certain genes in presence of zinc, represses other genes
           in low zinc; regulates its own transcription; contains
           seven zinc-finger domains
          Length = 880

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           +C  C K F+ SSSL+ H   HTG++P +C    C K FN  SN+ +H + H+K+
Sbjct: 797 KCHICNKKFAISSSLKIHIRTHTGEKPLQC--KICGKRFNESSNLSKHIKTHQKK 849

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C + FS   +L  H   H+G++P+KC    C K F + S++  H R H
Sbjct: 769 KCKTCKRCFSSEETLVQHTRTHSGEKPYKCHI--CNKKFAISSSLKIHIRTH 818

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 386 CGKVFSRSSSLQAH-ALVHT--GDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C K FS +  L  H   VH   G   ++C+W  C +TF  +  ++RH ++H K
Sbjct: 712 CNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSK 764

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 377 GVPKNQCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           G  + QCL   C + F +   L  H  VH+  +P+KC   +C++ F+ +  +++H R H
Sbjct: 734 GKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKC--KTCKRCFSSEETLVQHTRTH 790

>YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}
           AZF1Zinc-finger transcription factor, involved in
           induction of CLN3 transcription in response to glucose;
           genetic and physical interactions indicate a possible
           role in mitochondrial transcription or genome
           maintenance
          Length = 914

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C  CGK F++  +L+ H  +HTG++P+ C    C+K F+ K N+  H   H+K
Sbjct: 623 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK 673

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 374 NSFGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           N+  V K++C  C ++FS+++ L+ H   H G +PF C +  C K F    N+  H RLH
Sbjct: 586 NTRAVKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLH 643

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHY-RLHEK 435
           C  C K FSR  +L AH + H   +PF C   +C KTF    NM  H  R H++
Sbjct: 651 CDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKE 704

>Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON}
           complement(4290..6233) [1944 nt, 648 aa]
          Length = 647

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 382 QCLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           +C  C K F RS  L+ H   VH+ +RPF C +  CEK F+   N+ +H + H+K G
Sbjct: 591 KCTDCEKAFRRSEHLKRHIRSVHSSERPFACNY--CEKKFSRSDNLSQHLKTHKKHG 645

>KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {ON}
           Anc_1.326 YJL056C
          Length = 746

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C  CGK F+ SSSL+ H   HTG++P +C    C K F   SN+ +H + HEK
Sbjct: 671 CDICGKRFAISSSLKIHVRTHTGEKPLQCA--VCGKRFIESSNLNKHMKTHEK 721

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 386 CGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           CGK F++   +  H  VHT  +P+KC  P C+K F+    + +H R+H
Sbjct: 618 CGKTFTQRQKIARHLKVHTRYKPYKC--PQCQKCFSSDETLKQHLRIH 663

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C +C K FS   +L+ H  +H+G++P+ C    C K F + S++  H R H
Sbjct: 642 KCPQCQKCFSSDETLKQHLRIHSGEKPYHC--DICGKRFAISSSLKIHVRTH 691

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 10/31 (32%), Positives = 16/31 (51%)

Query: 405 GDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           G   + C W  C KTF  +  + RH ++H +
Sbjct: 607 GQSQYTCSWAGCGKTFTQRQKIARHLKVHTR 637

 Score = 31.2 bits (69), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 4/48 (8%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRH 429
           QC  CGK F  SS+L  H   H  ++ F+C    C K F  K  M  H
Sbjct: 698 QCAVCGKRFIESSNLNKHMKTH--EKGFQC--SKCHKKFPNKGKMELH 741

>Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056C
           (REAL)
          Length = 879

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           +C  C K F+ SSSL+ H   HTG++P +C    C K FN  SN+ +H + H+K+
Sbjct: 796 KCHICNKKFAISSSLKIHIRTHTGEKPLQC--KICGKRFNESSNLSKHIKTHKKK 848

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C + FS   +L  H   H+G++P+KC    C K F + S++  H R H
Sbjct: 768 KCKTCKRCFSSEETLVQHTRTHSGEKPYKC--HICNKKFAISSSLKIHIRTH 817

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 386 CGKVFSRSSSLQAH-ALVHT--GDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C + F+ +  L  H   +H   G   ++C+W  C +TF  +  ++RH ++H K
Sbjct: 711 CNRSFANAQELNDHLEAIHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSK 763

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 377 GVPKNQCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           G  + QCL   C + F +   L  H  VH+  +P+KC   +C++ F+ +  +++H R H
Sbjct: 733 GKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKC--KTCKRCFSSEETLVQHTRTH 789

>TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {ON}
           Anc_2.162 YOR113W
          Length = 717

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHY-RLHEK 435
           C  CGK FSR  +L AHAL H   +P+ C   +C K+F    NM  H  R H K
Sbjct: 467 CEMCGKRFSRKGNLAAHALTHQKLKPYICKLENCNKSFTQLGNMKAHQNRFHLK 520

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           QC  CGK F++  +L+ H  +HTG++P+ C    C K F+ K N+  H   H+K
Sbjct: 438 QCEFCGKRFTQGGNLRTHQRLHTGEKPYNCEM--CGKRFSRKGNLAAHALTHQK 489

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 2/67 (2%)

Query: 367 GAHEIQYNSFGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNM 426
           G  E   +S G+ +++C  C + F++S+ L+ H   H G +PF+C +  C K F    N+
Sbjct: 395 GGVEKPKSSHGMKQHECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEF--CGKRFTQGGNL 452

Query: 427 MRHYRLH 433
             H RLH
Sbjct: 453 RTHQRLH 459

>NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598
          Length = 769

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 382 QCLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           QC +C K F RS  L+ H   VH+ +RPF C    CEK F+   N+ +H + H+K G
Sbjct: 713 QCDQCTKSFRRSEHLKRHVRSVHSKERPFACNL--CEKKFSRSDNLSQHLKTHKKHG 767

>Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C
           (REAL)
          Length = 878

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           +C  C K F+ SSSL+ H   HTG++P +C    C K FN  SN+ +H + H+K+
Sbjct: 795 KCHICDKKFAISSSLKIHIRTHTGEKPLQC--KICGKRFNESSNLSKHIKTHKKK 847

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C + FS   +L  H   H+G++P+KC    C+K F + S++  H R H
Sbjct: 767 KCKTCKRCFSSEETLVQHTRTHSGEKPYKC--HICDKKFAISSSLKIHIRTH 816

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 386 CGKVFSRSSSLQAH-ALVHT--GDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C K F+ +  L  H   VH   G   ++C+W  C +TF  +  ++RH ++H K
Sbjct: 710 CNKQFTNAQELNNHLESVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSK 762

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 377 GVPKNQCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           G  + QCL   C + F +   L  H  VH+  +P+KC   +C++ F+ +  +++H R H
Sbjct: 732 GKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKC--KTCKRCFSSEETLVQHTRTH 788

>TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {ON}
           Anc_2.162 YOR113W
          Length = 823

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           QC  CGK F++  +L+ H  +HTG++P+ C    C K F+ K N+  H   H+K
Sbjct: 546 QCNFCGKKFTQGGNLKTHQRLHTGEKPYSCKI--CNKRFSRKGNLTAHVLTHKK 597

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 24/47 (51%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRH 429
           C  C K FSR  +L AH L H   +P+ C   +C KTF    NM  H
Sbjct: 575 CKICNKRFSRKGNLTAHVLTHKKLKPYFCKLDNCNKTFTQLGNMKAH 621

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           QC  C + FS+S+ L+ H   H G +P++C +  C K F    N+  H RLH
Sbjct: 518 QCPYCHRFFSQSTHLEVHIRSHIGYKPYQCNF--CGKKFTQGGNLKTHQRLH 567

>Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {ON}
           YLR131C (REAL)
          Length = 764

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 382 QCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           +CL   C KVF R  ++++H   H  DRP+ C +PSC+K F    +++RH   H  +
Sbjct: 598 ECLYPNCSKVFKRRYNIRSHIQTHLQDRPYSCDFPSCDKAFVRNHDLIRHKISHNAK 654

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 18/28 (64%)

Query: 406 DRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           D+ F+C++P+C K F  + N+  H + H
Sbjct: 594 DKLFECLYPNCSKVFKRRYNIRSHIQTH 621

>Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W
           (REAL)
          Length = 948

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C  CGK F++  +L+ H  +HTG++P+ C    C+K F+ K N+  H   H+K
Sbjct: 654 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK 704

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHY-RLHEK 435
           C  C K FSR  +L AH + H   +PF C   +C+KTF    NM  H  R H++
Sbjct: 682 CDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCDKTFTQLGNMKAHQNRFHKE 735

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 6/68 (8%)

Query: 366 RGAHEIQYNSFGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSN 425
           +G H    N+  + K++C  C ++FS+++ L+ H   H G +PF C +  C K F    N
Sbjct: 613 KGVH----NTRTIKKHECPYCHRLFSQATHLEVHVRSHIGYKPFACDY--CGKRFTQGGN 666

Query: 426 MMRHYRLH 433
           +  H RLH
Sbjct: 667 LRTHERLH 674

>CAGL0M04323g Chr13 complement(474158..476269) [2112 bp, 703 aa]
           {ON} similar to uniprot|P21192 Saccharomyces cerevisiae
           YLR131c ACE2 or uniprot|P08153 Saccharomyces cerevisiae
           YDR146c SWI5
          Length = 703

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 382 QCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           +CL   CGK F R  ++++H   H  D+P+KC +  C K F    ++ RH + H+K
Sbjct: 524 ECLFPNCGKFFRRRYNIKSHIQTHLEDKPYKCDFEGCTKAFVRNHDLARHKKTHDK 579

>NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON}
           Anc_2.162
          Length = 1064

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           QC  CGK F++  +L+ H  +HTG++P++C    C+K F+ K N+  H   H
Sbjct: 629 QCNFCGKRFTQGGNLRTHQRLHTGEKPYRCEI--CDKRFSRKGNLAAHKLTH 678

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 25/48 (52%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRH 429
           +C  C K FSR  +L AH L H   +PF C   +C KTF    NM  H
Sbjct: 657 RCEICDKRFSRKGNLAAHKLTHRDVKPFVCKLDNCNKTFTQLGNMKAH 704

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 377 GVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           G  +++C  C ++FS+S+ L+ H   H G +PF+C +  C K F    N+  H RLH
Sbjct: 596 GSKQHECPYCHRLFSQSTHLEVHIRSHLGYKPFQCNF--CGKRFTQGGNLRTHQRLH 650

>Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113W
           (REAL)
          Length = 917

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C  CGK F++  +L+ H  +HTG++P+ C    C+K F+ K N+  H   H+K
Sbjct: 624 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK 674

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 6/68 (8%)

Query: 366 RGAHEIQYNSFGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSN 425
           +G H    N+  V K++C  C ++FS+++ L+ H   H G +PF C +  C K F    N
Sbjct: 583 KGTH----NTRTVKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGN 636

Query: 426 MMRHYRLH 433
           +  H RLH
Sbjct: 637 LRTHERLH 644

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHY-RLHEK 435
           C  C K FSR  +L AH + H   +PF C   +C KTF    NM  H  R H++
Sbjct: 652 CDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKE 705

>TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {ON}
           Anc_1.326 YJL056C
          Length = 755

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           +C  CGK F+ SSSL+ H   HTG++P +C    C + F+  SN+ +H + H+K+
Sbjct: 676 ECRICGKRFAVSSSLKIHIRTHTGEKPLQC--KICGRRFSESSNLNKHMKSHQKK 728

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  CGK FS   +L  H   H+G++PF+C    C K F V S++  H R H
Sbjct: 648 KCQDCGKCFSSEDTLTQHKRTHSGEKPFECRI--CGKRFAVSSSLKIHIRTH 697

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 386 CGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C K F++   L  H  VH+G +P+KC    C K F+ +  + +H R H
Sbjct: 624 CDKRFAQRQKLVRHLKVHSGYKPYKC--QDCGKCFSSEDTLTQHKRTH 669

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 386 CGKVFSRSSSLQAH--AL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C +VF  +++L  H  AL +  G   + C W  C+K F  +  ++RH ++H
Sbjct: 591 CTEVFDSAAALTTHLEALHLEKGKSEYHCHWHGCDKRFAQRQKLVRHLKVH 641

>Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113W
           (REAL)
          Length = 909

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C  CGK F++  +L+ H  +HTG++P+ C    C+K F+ K N+  H   H+K
Sbjct: 613 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK 663

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 6/68 (8%)

Query: 366 RGAHEIQYNSFGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSN 425
           +G H    N+  V K++C  C ++FS+++ L+ H   H G +PF C +  C K F    N
Sbjct: 572 KGTH----NTRAVKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGN 625

Query: 426 MMRHYRLH 433
           +  H RLH
Sbjct: 626 LRTHERLH 633

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHY-RLHEK 435
           C  C K FSR  +L AH + H   +PF C   +C KTF    NM  H  R H++
Sbjct: 641 CDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKE 694

>NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {ON}
           Anc_8.326
          Length = 635

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query: 382 QCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGA 439
           +CL   CGK F R  + ++H   H  DRP+ C +P+C+K F    +++RH ++H ++  A
Sbjct: 490 ECLYPNCGKHFKRRYNTRSHIQTHLEDRPYACDFPNCDKAFVRNHDLVRHKKVHSEKSYA 549

>ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 930

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 25/48 (52%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRH 429
           +C  CGK FSR  +L AH + H   +PF C    C KTF    NM  H
Sbjct: 619 ECELCGKRFSRKGNLAAHIVTHQKLKPFVCKLDGCNKTFTQLGNMKAH 666

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C  CGK F++  +L+ H  +HTG++P++C    C K F+ K N+  H   H+K
Sbjct: 592 CECCGKRFTQGGNLRTHQRLHTGEKPYECEL--CGKRFSRKGNLAAHIVTHQK 642

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 2/67 (2%)

Query: 367 GAHEIQYNSFGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNM 426
           G  E    S GV +++C  C + F++S+ L+ H   H G +PF C    C K F    N+
Sbjct: 548 GGVEKPKGSHGVKQHECPYCHRFFTQSTHLEVHVRSHIGYKPFLCEC--CGKRFTQGGNL 605

Query: 427 MRHYRLH 433
             H RLH
Sbjct: 606 RTHQRLH 612

>TPHA0A01540 Chr1 (306674..308914) [2241 bp, 746 aa] {ON} Anc_8.326
           YLR131C
          Length = 746

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 2/73 (2%)

Query: 366 RGAHEIQYNSFGVPKNQCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVK 423
           RG+ +I           CL   C K F R  ++++H   H  DRP+ C +  CEK+F   
Sbjct: 535 RGSIDIYVKELPDKTFVCLYQGCQKSFKRRYNVRSHIQTHLEDRPYTCDYEGCEKSFVRN 594

Query: 424 SNMMRHYRLHEKR 436
            +++RH + H++R
Sbjct: 595 HDLIRHRKRHDER 607

>TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {ON}
           Anc_3.518 YGL209W
          Length = 276

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C  CG+ F R    + H  +HTG++P+KC +  C K+F+    + RH ++H
Sbjct: 39  CESCGRGFYRLEHKKRHLKIHTGEKPYKCKFEQCIKSFSRSDELRRHSKIH 89

>CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa]
           {ON} weakly similar to uniprot|Q03125 Saccharomyces
           cerevisiae YDR043c NRG1
          Length = 463

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 30/54 (55%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           C  CGK F+ S  L  H  +HTG++   C +  C + FN   N ++HY+ H KR
Sbjct: 404 CKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQHYKTHLKR 457

>KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weakly
           similar to uniprot|P21192 Saccharomyces cerevisiae
           YLR131C ACE2 Transcription factor that activates
           expression of early G1-specific genes localizes to
           daughter cell nuclei after cytokinesis and delays G1
           progression in daughters localization is regulated by
           phosphorylation potential Cdc28p substrate
          Length = 746

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 382 QCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           +CL   CGK F R  ++++H   H  DRP+ C +P C K F    +++RH + H ++
Sbjct: 584 ECLHPDCGKNFRRRYNIRSHIQTHLEDRPYICDFPDCNKAFVRNHDLIRHKKTHAEK 640

>KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {ON}
           Anc_1.326 YJL056C
          Length = 753

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 2/52 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C K FS   +L+ H+ VH+G++PFKC    C+K+F+V +++  H R H
Sbjct: 641 KCEVCSKCFSSDETLKQHSRVHSGEKPFKC--HLCDKSFSVSTSLKIHIRTH 690

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHE 434
           +C  C K FS S+SL+ H   HTG++P +C    C + FN  SN+ +H + HE
Sbjct: 669 KCHLCDKSFSVSTSLKIHIRTHTGEKPLEC--KVCGRRFNESSNLSKHMKTHE 719

 Score = 37.4 bits (85), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 4/51 (7%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRL 432
           +C  CG+ F+ SS+L  H   H  +  FKC  P C K FN +  M  H R 
Sbjct: 697 ECKVCGRRFNESSNLSKHMKTH--EHNFKC--PICSKGFNTQKRMETHMRF 743

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 386 CGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C K FS+   +  H  VH+G +P+KC    C K F+    + +H R+H
Sbjct: 617 CNKEFSQRQKIVRHLKVHSGFKPYKC--EVCSKCFSSDETLKQHSRVH 662

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 3/51 (5%)

Query: 386 CGKVFSRSSSLQAHAL---VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C   F+ S  L AH     +  G   + C W  C K F+ +  ++RH ++H
Sbjct: 584 CNLTFNSSEELNAHLESFHLTKGKSKYTCFWHGCNKEFSQRQKIVRHLKVH 634

>KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa]
           {ON} Anc_8.326 YLR131C
          Length = 619

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 2/60 (3%)

Query: 382 QCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGA 439
           +CL   CGK F R  ++++H   H  DRP+ C +P C+K F    +++RH + H ++  A
Sbjct: 469 ECLFENCGKTFKRRYNIRSHIQTHLEDRPYPCDFPGCDKAFVRNHDLVRHKKSHFEKNYA 528

>SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 499

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 382 QCLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           +C +C K F RS  L+ H   VH+ +RPF C +  C+K F+   N+ +H + H+K G
Sbjct: 443 KCQECTKAFRRSEHLKRHIRSVHSSERPFHCSY--CDKKFSRSDNLSQHLKTHKKHG 497

>KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]
           {ON} weakly similar to uniprot|P21192 Saccharomyces
           cerevisiae YLR131C ACE2 Transcription factor that
           activates expression of early G1-specific genes
           localizes to daughter cell nuclei after cytokinesis and
           delays G1 progression in daughters localization is
           regulated by phosphorylation potential Cdc28p substrate
          Length = 854

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 31/52 (59%)

Query: 386 CGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           C K F+R  + + H   H  DRP+KC +P C+K F    +++RH + H ++G
Sbjct: 700 CQKRFNRRYNARTHIQTHLCDRPYKCDFPGCQKAFVRNHDLLRHKKSHLEKG 751

>ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {ON}
           similar to uniprot|P21192 Saccharomyces cerevisiae
           YLR131C ACE2 Transcription factor that activates
           expression of early G1-specific genes localizes to
           daughter cell nuclei after cytokinesis and delays G1
           progression in daughters localization is regulated by
           phosphorylation potential Cdc28p substrate
          Length = 813

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 31/51 (60%)

Query: 386 CGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           CGK+F R  ++++H   H  DRP+ C +  C+K F    +++RH + H ++
Sbjct: 634 CGKIFKRRYNIRSHIQTHLEDRPYMCDFEGCDKAFVRNHDLVRHKKSHAEK 684

>TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {ON}
           Anc_3.281 YBR066C
          Length = 350

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 33/62 (53%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGA 439
           K+QC  C K F+ +  L  H  +HTG++  KC    C   F+   N ++HY+ H KR   
Sbjct: 267 KHQCKICMKKFTTAGHLTRHHKIHTGEKNHKCPHRGCNLWFSRNDNSLQHYQTHLKRKTK 326

Query: 440 KR 441
           KR
Sbjct: 327 KR 328

>TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa]
           {ON} Anc_3.518 YGL209W
          Length = 339

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C  C + F R    + H   HTG++P KCV+P C K+F+    + RH R H +
Sbjct: 22  CEICHRGFHRLEHKKRHIRTHTGEKPHKCVFPGCIKSFSRSDELKRHLRTHTR 74

>Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa]
           {ON} YGL209W (MIG2) - 1:1 [contig 188] FULL
          Length = 266

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 32/63 (50%), Gaps = 3/63 (4%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH--EKRG-G 438
           +C  CGK F R    + H   HTG++P  C +P C K F+    + RH R H    RG G
Sbjct: 15  KCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVRTHMSTSRGKG 74

Query: 439 AKR 441
            KR
Sbjct: 75  RKR 77

>KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.326
           YLR131C
          Length = 645

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 382 QCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           +CL  +C K+F R  ++++H   H  DRP+ C +P C K F    +++RH + H ++ 
Sbjct: 513 ECLYPECKKLFKRRYNIRSHIQTHLEDRPYTCDFPGCTKAFVRNHDLVRHKKSHSEKA 570

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 18/28 (64%)

Query: 406 DRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           D+ F+C++P C+K F  + N+  H + H
Sbjct: 509 DKSFECLYPECKKLFKRRYNIRSHIQTH 536

>CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {ON}
           some similarities with uniprot|P33748 Saccharomyces
           cerevisiae YMR037c MSN2
          Length = 597

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 383 CLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           C  C K F RS  L+ H   VH+ DRPF C    CEK F+   N+ +H + H+K G
Sbjct: 537 CHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHL--CEKKFSRSDNLSQHIKTHKKSG 590

>Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {ON}
           YKL062W (MSN4) - zinc finger protein [contig 59] FULL
          Length = 698

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 382 QCLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           +C +C K F RS  L+ H   VH+ +RPF C +  C+K F+   N+ +H + H+K G
Sbjct: 642 KCQECTKAFRRSEHLKRHIRSVHSSERPFHCSY--CDKKFSRSDNLSQHLKTHKKHG 696

>TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {ON}
           Anc_2.598 YMR037C
          Length = 523

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 382 QCLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           +C +C K F RS  L+ H   VH+ +RPF C +  C+K F+   N+ +H + H+K G
Sbjct: 467 KCGQCEKAFRRSEHLKRHVRSVHSSERPFPCTF--CDKRFSRSDNLSQHLKTHKKHG 521

>KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.80
           YGL035C
          Length = 459

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C  CG+ F R      H   HTG++P  C +P C K F+    + RH R+H
Sbjct: 45  CPVCGRAFHRLEHQTRHMRTHTGEKPHACDFPGCTKRFSRSDELTRHKRIH 95

>KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 677

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 382 QCLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           +C +C K F RS  L+ H   VH+ +RPF C +  C+K F+   N+ +H + H+K G
Sbjct: 621 KCQECTKAFRRSEHLKRHIRSVHSTERPFHCSY--CDKKFSRSDNLSQHLKTHKKHG 675

>KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {ON}
           Anc_8.326 YLR131C
          Length = 736

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 383 CL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           CL   C K F R  ++++H   H  DRP+ C +P CEK F    +++RH + H  +
Sbjct: 561 CLYPNCDKTFKRRYNVRSHIQTHLQDRPYTCDYPGCEKAFVRNHDLVRHKKGHTGK 616

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 406 DRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           DR F C++P+C+KTF  + N+  H + H
Sbjct: 556 DRMFACLYPNCDKTFKRRYNVRSHIQTH 583

 Score = 30.4 bits (67), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 4/54 (7%)

Query: 386 CGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGA 439
           C K F R+  L  H   HTG + F C  PSC K + V  + +  +R     GG+
Sbjct: 596 CEKAFVRNHDLVRHKKGHTG-KTFTC--PSCNKRY-VDQDRLERHRSKATCGGS 645

>ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {ON}
           some similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 171

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C + F R    + H   HTG++P KC +P C K+F+    + RH R H
Sbjct: 15  RCEICNRGFHRLEHKKRHIRTHTGEKPHKCSFPGCGKSFSRSDELKRHLRTH 66

>CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} similar
           to uniprot|P27705 Saccharomyces cerevisiae YGL035c MIG1
           transcriptional repressor
          Length = 424

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C  CG+ F R      H   HTG++P  C +P C K F+    + RH R+H
Sbjct: 45  CPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 95

>SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 385

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 31/63 (49%), Gaps = 3/63 (4%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH---EKRGG 438
           +C  C K F R    + H   HTG++P  C +P C K F+    + RH R+H    KR  
Sbjct: 26  KCELCNKGFHRLEHKRRHIRTHTGEKPHACTFPGCMKRFSRSDELKRHLRIHTNTSKRKT 85

Query: 439 AKR 441
            KR
Sbjct: 86  RKR 88

>KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.598
           YMR037C
          Length = 370

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 382 QCLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           +C +C K F RS  L+ H   VH+ +RPF C+   CEK F+   N+ +H + H+K G
Sbjct: 314 KCSECEKGFKRSEHLKRHFRSVHSNERPFPCML--CEKKFSRSDNLSQHLKTHKKHG 368

>KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]
           {ON} some similarities with uniprot|Q03125 Saccharomyces
           cerevisiae YDR043C NRG1 Transcriptional repressor that
           recruits the Cyc8p-Tup1p complex to promoters
          Length = 357

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C  C + F+ S  L  H  +HTG++  +C +P C + F+   N ++HYR H K
Sbjct: 286 CKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFK 338

>Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON}
           YDR146C (REAL)
          Length = 707

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 382 QCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           +CL   C K F R  ++++H   H  DRP+ C  P C+K F    +++RH + H+++ 
Sbjct: 549 ECLYPGCAKTFKRRYNIRSHIQTHLEDRPYSCDCPGCDKAFVRNHDLIRHKKSHQEKA 606

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 406 DRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           D+ F+C++P C KTF  + N+  H + H
Sbjct: 545 DKTFECLYPGCAKTFKRRYNIRSHIQTH 572

>Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON}
           (53205..55598) [2394 nt, 798 aa]
          Length = 797

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           C  CG  FS  S L+ H  +HTG++P  C    C K F+  SN+ +HY+ H K+
Sbjct: 707 CQICGSKFSSPSYLKVHIRIHTGEKPLSC--KVCGKKFSSSSNLNKHYKTHYKK 758

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 34/59 (57%), Gaps = 4/59 (6%)

Query: 377 GVPKNQCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           G  + +CL   CG  F++   +  H  VH+G +PFKC   SC KTF  + N+++H R H
Sbjct: 643 GQSEYRCLWKDCGHKFTQRQKILRHIRVHSGFKPFKC--ESCNKTFASEENLIQHKRTH 699

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 3/51 (5%)

Query: 386 CGKVFSRSSSLQAHAL---VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C +VF     L AH     + +G   ++C+W  C   F  +  ++RH R+H
Sbjct: 621 CNEVFLSCKELNAHIEEKHLESGQSEYRCLWKDCGHKFTQRQKILRHIRVH 671

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C K F+   +L  H   H+G++PF C    C   F+  S +  H R+H
Sbjct: 678 KCESCNKTFASEENLIQHKRTHSGEKPFVC--QICGSKFSSPSYLKVHIRIH 727

>TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa]
           {ON} Anc_4.80 YGL035C
          Length = 390

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 6/65 (9%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHE------KR 436
           C  C + F R      H   HTG++P  C +P C K F+    + RH R+H       KR
Sbjct: 74  CPVCNRAFHRLEHQTRHIRTHTGEKPHSCDFPGCTKKFSRSDELTRHKRIHTNPNPRGKR 133

Query: 437 GGAKR 441
           G  K+
Sbjct: 134 GRKKK 138

>Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON}
           YDR146C (REAL)
          Length = 691

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 382 QCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGA 439
           +CL   C K F R  ++++H   H  DRP+ C  P C+K F    +++RH + H+++  A
Sbjct: 533 ECLYPGCAKTFKRRYNIRSHIQTHLEDRPYSCDNPGCDKAFVRNHDLIRHKKSHQEKAYA 592

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 406 DRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           D+ F+C++P C KTF  + N+  H + H
Sbjct: 529 DKSFECLYPGCAKTFKRRYNIRSHIQTH 556

>YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON}
           ACE2Transcription factor required for septum destruction
           after cytokinesis; phosphorylation by Cbk1p blocks
           nuclear exit of Ace2p during the M-to-G1 transition,
           causing its specific localization to daughter cell
           nuclei, and also increases Ace2p activity;
           phosphorylation by Cdc28p and Pho85p prevents nuclear
           import during cell cycle phases other than cytokinesis;
           part of the RAM network that regulates cellular polarity
           and morphogenesis
          Length = 770

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 382 QCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           +CL   C KVF R  ++++H   H  DRP+ C +P C K F    +++RH   H  +
Sbjct: 604 ECLYPNCNKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRHKISHNAK 660

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 18/28 (64%)

Query: 406 DRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           D+ F+C++P+C K F  + N+  H + H
Sbjct: 600 DKLFECLYPNCNKVFKRRYNIRSHIQTH 627

>Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON}
           YER028C (REAL)
          Length = 394

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           +C  C + F R    + H   HTG++P+KC   +C K+F+    + RH+R H +
Sbjct: 18  RCEICSRGFHRLEHKKRHVRTHTGEKPYKCSSKNCTKSFSRSDELKRHFRTHTR 71

>Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {ON}
           complement(96025..97794) [1770 nt, 590 aa]
          Length = 589

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRL 432
           C  CGK F R S LQ H L H+ +R F C W  C      K N+++H +L
Sbjct: 479 CHICGKQFKRKSWLQRHLLSHSSERNFDCPW--CLSKHKRKDNLLQHMKL 526

>CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {OFF}
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113w AZF1 asparagine-rich zinc finger protein
          Length = 291

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRH 429
           +C  C K FSR  +L AH + H   RPF C   +C K+F+   NM  H
Sbjct: 12  ECDICKKRFSRKGNLAAHKMTHGKIRPFICKLDNCNKSFSQLGNMKSH 59

>KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 307

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH--EKRGGA 439
           +C  CGK F R    + H   HTG++P  C +P C K F+    + RH R H    RG +
Sbjct: 14  KCDMCGKGFHRLEHKRRHIRTHTGEKPHACNFPGCVKRFSRSDELKRHVRTHMSTSRGKS 73

Query: 440 KR 441
           ++
Sbjct: 74  RK 75

>TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.80
           YGL035C
          Length = 350

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 6/65 (9%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH------EKR 436
           C  C + F R      H   HTG++P  C +P C K F+    + RH R+H       KR
Sbjct: 31  CPICQRAFRRLEHQTRHLRTHTGEKPHACDFPGCAKRFSRSDELTRHRRIHTNPHPRAKR 90

Query: 437 GGAKR 441
           G  K+
Sbjct: 91  GRKKK 95

>KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weakly
           similar to uniprot|P33748 Saccharomyces cerevisiae
           YMR037C MSN2 Transcriptional activator related to Msn4p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 694

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 382 QCLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           +C +C K F RS  L+ H   VH+ +RPF C +  C+K F+   N+ +H + H+K G
Sbjct: 622 KCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQF--CDKKFSRSDNLSQHLKTHKKHG 676

>CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} similar
           to uniprot|P47043 Saccharomyces cerevisiae YJL056c ZAP1
           metalloregulatory protein
          Length = 713

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           +C  C K F+ S+SL+ H   HTG++P KC    C + FN  SN+ +H + H K+
Sbjct: 626 ECHICHKRFAISNSLKIHIRTHTGEKPLKC--KVCGRCFNESSNLSKHMKTHMKK 678

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           QC +C K FS   +L  H  VH+G++P++C    C K F + +++  H R H
Sbjct: 598 QCPQCQKCFSTEDTLNQHKRVHSGEKPYEC--HICHKRFAISNSLKIHIRTH 647

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 386 CGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C K FS+   L  H  VH+  +P++C  P C+K F+ +  + +H R+H
Sbjct: 574 CNKTFSQRQKLVRHLKVHSKYKPYQC--PQCQKCFSTEDTLNQHKRVH 619

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 3/53 (5%)

Query: 386 CGKVFSRSSSLQAHAL---VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C + F  +  L  H     +  G   + C W  C KTF+ +  ++RH ++H K
Sbjct: 541 CNERFKSAGDLNDHLEEMHLTKGKSQYTCEWEGCNKTFSQRQKLVRHLKVHSK 593

>Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}
           YDR043C (REAL)
          Length = 232

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           C  C + F+ S  L  H  +HTG++   C +  C + F+   N ++HYR H K+G
Sbjct: 177 CKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLKKG 231

>Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {ON}
           YLR131C (REAL)
          Length = 769

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 382 QCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           +CL   C KVF R  ++++H   H  DRP+ C +P C K F    +++RH   H  +
Sbjct: 603 ECLYPNCSKVFKRRYNIRSHIQTHLQDRPYACDFPGCAKAFVRNHDLIRHKISHNAK 659

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 18/28 (64%)

Query: 406 DRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           D+ F+C++P+C K F  + N+  H + H
Sbjct: 599 DKLFECLYPNCSKVFKRRYNIRSHIQTH 626

>Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa]
           {ON} (16151..16525,16527..17390) [1239 nt, 413 aa]
          Length = 412

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 36/79 (45%), Gaps = 11/79 (13%)

Query: 374 NSFGVPKNQ-----CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMR 428
           N+   PK +     C  C + F R      H   HTG++P +C +P C K F+    + R
Sbjct: 27  NTVAKPKEKPRPHVCPICNRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTR 86

Query: 429 HYRLHE------KRGGAKR 441
           H R+H       KRG  K+
Sbjct: 87  HRRIHTNPNPRGKRGRKKK 105

>KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C + F R    + H   HTG++P+KC +P C K+F+    + RH ++H
Sbjct: 18  KCPLCQRGFHRLEHKKRHVRTHTGEKPYKCSFPDCPKSFSRTDELKRHSKIH 69

>NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598
          Length = 972

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 382 QCLKCGKVFSRSSSLQAH-ALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           +C  C K F RS  L+ H   VH+ +RPF C++  C K F+   N+ +H + H+K G
Sbjct: 916 KCSDCEKAFRRSEHLKRHFRSVHSAERPFGCMF--CTKRFSRSDNLSQHLKTHKKHG 970

>Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 bp,
           515 aa] {ON} YGL035C (REAL)
          Length = 515

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 6/65 (9%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHE------KR 436
           C  C + F R      H  +HTG++P  C +P C K F+    + RH R+H       KR
Sbjct: 40  CPICQRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKR 99

Query: 437 GGAKR 441
           G  K+
Sbjct: 100 GRKKK 104

>YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}
           SWI5Transcription factor that recruits the Mediator and
           Swi/Snf complexes; activates transcription of genes
           expressed at the M/G1 phase boundary and in G1 phase;
           required for expression of the HO gene controlling
           mating type switching; localization to the nucleus
           occurs during G1 and appears to be regulated by
           phosphorylation by Cdc28p kinase
          Length = 709

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 382 QCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGA 439
           +CL   C K F R  ++++H   H  DRP+ C  P C+K F    +++RH + H+++  A
Sbjct: 551 ECLFPGCTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRHKKSHQEKAYA 610

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 406 DRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           D+ F+C++P C KTF  + N+  H + H
Sbjct: 547 DKTFECLFPGCTKTFKRRYNIRSHIQTH 574

>Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 239

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 25/53 (47%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C  CG  F R      H   HTG++PF C  P C K F+    + RH + H K
Sbjct: 14  CEICGNRFHRLEHKTRHIRTHTGEKPFACTVPGCPKRFSRNDELKRHIKTHFK 66

>CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some
           similarities with uniprot|P39943 Saccharomyces
           cerevisiae YER028c or uniprot|P53035 Saccharomyces
           cerevisiae YGL209w MIG2
          Length = 318

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C + F R    + H   HTG++P KC +PSC K+F+    + RH R H
Sbjct: 21  RCEICSRGFHRLEHKKRHFRTHTGEKPHKCKFPSCPKSFSRADELKRHSRTH 72

>TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {ON}
           Anc_2.598 YMR037C
          Length = 746

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 382 QCLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           +C  CGK F RS  L+ H   VH+ +RPF C    C K F+   N+ +H + H+K G
Sbjct: 690 KCDTCGKNFRRSEHLKRHIRSVHSMERPFSCDI--CLKKFSRSDNLSQHLKTHKKHG 744

>Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}
           YDR043C (REAL)
          Length = 231

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           C  C + F+ S  L  H  +HTG++   C +  C + F+   N ++HYR H K+G
Sbjct: 176 CKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLKKG 230

>YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}
           NRG1Transcriptional repressor that recruits the
           Cyc8p-Tup1p complex to promoters; mediates glucose
           repression and negatively regulates a variety of
           processes including filamentous growth and alkaline pH
           response
          Length = 231

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           C  C + F+ S  L  H  +HTG++   C +  C + F+   N ++HYR H K+G
Sbjct: 176 CKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLKKG 230

>Kwal_56.23925 s56 complement(779625..781862) [2238 bp, 745 aa] {ON}
           YLR131C (ACE2) - zinc finger transcription factor
           [contig 171] FULL
          Length = 745

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 382 QCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           +CL   CGK F R  ++++H   H  DRP+ C +  C K F    +++RH + H ++
Sbjct: 586 ECLHPDCGKTFRRRYNIRSHIQTHLEDRPYFCDFEGCHKAFVRNHDLIRHKKTHAEK 642

 Score = 30.8 bits (68), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 17/28 (60%)

Query: 406 DRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           D+ F+C+ P C KTF  + N+  H + H
Sbjct: 582 DKTFECLHPDCGKTFRRRYNIRSHIQTH 609

>Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON}
           YGL035C (REAL)
          Length = 502

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 6/65 (9%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHE------KR 436
           C  C + F R      H  +HTG++P  C +P C K F+    + RH R+H       KR
Sbjct: 40  CPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKR 99

Query: 437 GGAKR 441
           G  K+
Sbjct: 100 GRKKK 104

>TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.598
           YMR037C
          Length = 365

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 382 QCLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           +C KC K F RS  L+ H   VH+ +RP+ C +  CEK F+   N+ +H + H++ G
Sbjct: 309 KCNKCEKKFKRSEHLKRHIRSVHSTERPYHCQF--CEKNFSRSDNLSQHLKTHKRHG 363

>Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON}
           (42259..43791) [1533 nt, 511 aa]
          Length = 510

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           +C  C K FS++ +L  H  +HTG+RP++C    C K F+ K N+  H   H+K
Sbjct: 378 KCAYCDKRFSQTGNLNTHQRLHTGERPYEC--HICNKRFSRKGNLTAHVITHKK 429

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 23/48 (47%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRH 429
           +C  C K FSR  +L AH + H   +P+ C    C K F    NM  H
Sbjct: 406 ECHICNKRFSRKGNLTAHVITHKKLKPYICKVDGCNKKFTQLGNMKVH 453

>KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.518
           YGL209W
          Length = 391

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C + F R    + H   HTG++P  C +P CEK F+    + RH R H
Sbjct: 18  RCELCQRGFHRLEHKKRHVRTHTGEKPHACTFPGCEKHFSRSDELKRHSRTH 69

>KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {ON}
           Anc_2.598 YMR037C
          Length = 443

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 382 QCLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           +C  C K F RS  L+ H   VH+ +RPF C    C+K F+   N+ +H + H+K G
Sbjct: 387 KCDTCYKAFRRSEHLKRHIRSVHSTERPFACTI--CDKKFSRSDNLSQHLKTHKKHG 441

>KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.162
           YOR113W
          Length = 796

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHY-RLH 433
           C  C K FSR  +L AH L H   +PF C   +C KTF    NM  H  R H
Sbjct: 530 CQHCSKRFSRKGNLAAHQLTHREVKPFLCKLDNCGKTFAQLGNMKNHQNRFH 581

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           +C  CGK F++  +L+ H  +HTG++P+ C    C K F+ K N+  H   H +
Sbjct: 501 ECQFCGKRFTQGGNLRTHQRLHTGEKPYACQH--CSKRFSRKGNLAAHQLTHRE 552

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           K++C  C   F++++ L+ H   H G +PF+C +  C K F    N+  H RLH
Sbjct: 471 KHECPYCHHKFAQTTHLEVHVRSHLGYKPFECQF--CGKRFTQGGNLRTHQRLH 522

>Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {ON}
           YLR131C (REAL)
          Length = 767

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 382 QCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           +CL   C KVF R  ++++H   H  DRP+ C +P C K F    +++RH   H  +
Sbjct: 601 ECLYPNCRKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRHKISHNAK 657

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 18/28 (64%)

Query: 406 DRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           D+ F+C++P+C K F  + N+  H + H
Sbjct: 597 DKLFECLYPNCRKVFKRRYNIRSHIQTH 624

>TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {ON}
           Anc_2.598 YMR037C
          Length = 519

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 382 QCLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           +C  C K F RS  L+ H   VH+ +RPF C +  CEK F+   N+ +H + H+K G
Sbjct: 463 KCNNCEKAFRRSEHLKRHIRSVHSSERPFPCNY--CEKKFSRSDNLSQHLKTHKKHG 517

>Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON}
           YGL035C (REAL)
          Length = 505

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 6/65 (9%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHE------KR 436
           C  C + F R      H  +HTG++P  C +P C K F+    + RH R+H       KR
Sbjct: 40  CPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKR 99

Query: 437 GGAKR 441
           G  K+
Sbjct: 100 GRKKK 104

>SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 388

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRL 432
           QC  C K F R S L+ H L H+  +PF C W  C+     K N+++H +L
Sbjct: 259 QCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKL 307

>Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON}
           YDR146C (REAL)
          Length = 708

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 382 QCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGA 439
           +CL  +C K F R  ++++H   H  DRP+ C  P C K F    +++RH + H+++  A
Sbjct: 550 ECLYPECTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCNKAFVRNHDLIRHKKSHQEKAYA 609

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 406 DRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           D+ F+C++P C KTF  + N+  H + H
Sbjct: 546 DKTFECLYPECTKTFKRRYNIRSHIQTH 573

>TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {ON}
           Anc_8.326 YLR131C
          Length = 850

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 382 QCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +CL  KC K+F R  ++++H   H  DRP+ C +  C K F    +++RH + H
Sbjct: 671 ECLYPKCHKIFKRRYNIRSHIQTHLEDRPYICDFDGCNKAFVRNHDLVRHKKSH 724

>YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}
           MIG1Transcription factor involved in glucose repression;
           sequence specific DNA binding protein containing two
           Cys2His2 zinc finger motifs; regulated by the SNF1
           kinase and the GLC7 phosphatase
          Length = 504

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 6/65 (9%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHE------KR 436
           C  C + F R      H  +HTG++P  C +P C K F+    + RH R+H       KR
Sbjct: 40  CPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKR 99

Query: 437 GGAKR 441
           G  K+
Sbjct: 100 GRKKK 104

>KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.281
           YBR066C
          Length = 254

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           K  C  C K F+ S  L  H  +HTG++   C +  C++ F+ + N ++HYR H K
Sbjct: 184 KYLCTTCTKGFTTSGHLARHKRIHTGEKNHLCPFEGCKQRFSRQDNCLQHYRTHFK 239

>CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakly
           similar to uniprot|P53968 Saccharomyces cerevisiae
           YNL027w CRZ1
          Length = 645

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 33/59 (55%), Gaps = 5/59 (8%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGAKR 441
           C  CGKVFSR  +L++H   HT ++P++C    C K F  + +  RH  LH    G KR
Sbjct: 523 CEVCGKVFSRPYNLKSHLRTHTDEKPYQCSI--CGKAFARQHDKKRHEDLHT---GKKR 576

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 27/63 (42%), Gaps = 9/63 (14%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKC--------VWPSCEKTFNVKSNMMRHYRLH 433
           QC  CGK F+R    + H  +HTG + + C         W  C K F     + RH++  
Sbjct: 550 QCSICGKAFARQHDKKRHEDLHTGKKRYVCGGKLKDGTFW-GCGKKFARSDALGRHFKTS 608

Query: 434 EKR 436
             R
Sbjct: 609 SGR 611

>TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {ON}
           Anc_8.326 YLR131C
          Length = 743

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 382 QCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           +C+   C KVF R  ++++H   H  DRP+ C +  C+K F    +++RH + H ++
Sbjct: 572 ECMYPNCNKVFKRRYNIRSHIQTHLEDRPYVCDFEGCDKAFVRNHDLVRHKKSHAEK 628

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 406 DRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           DR F+C++P+C K F  + N+  H + H
Sbjct: 568 DRIFECMYPNCNKVFKRRYNIRSHIQTH 595

>SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P27705 Saccharomyces
           cerevisiae YGL035C MIG1 Transcription factor involved in
           glucose repression; C2H2 zinc finger protein similar to
           mammalian Egr and Wilms tumor proteins
          Length = 548

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C  C + F R      H   HTG++P  C +P C K F+    + RH R+H
Sbjct: 36  CPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRHTRIH 86

>TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4.80
           YGL035C
          Length = 518

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C  CG+ F R      H   HTG++P  C +  C K F+    + RH R+H
Sbjct: 71  CGTCGRAFHRLEHQTRHMRTHTGEKPHACDFQGCTKRFSRSDELTRHKRIH 121

>NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518
          Length = 401

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C + F R    + H   HTG++P  C +P C K F+    + RH R H
Sbjct: 19  RCETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLRTH 70

>YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}
           MIG3Probable transcriptional repressor involved in
           response to toxic agents such as hydroxyurea that
           inhibit ribonucleotide reductase; phosphorylation by
           Snf1p or the Mec1p pathway inactivates Mig3p, allowing
           induction of damage response genes
          Length = 394

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           +C  C + F R    + H   HTG++P KC    C K+F+    + RH R H K
Sbjct: 18  RCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHTK 71

>NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {ON}
           Anc_3.281
          Length = 293

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C  C K F+ S  L  H  +HTG++   C +P C   F+   N ++HYR H K
Sbjct: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282

>KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON}
           Anc_3.281 YBR066C
          Length = 249

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C  C K F+ S  L  H  +HTG++  +C +  C++ F+ + N ++HYR H K
Sbjct: 174 CKTCSKGFTTSGHLARHNRIHTGEKNHECPFEGCQQRFSRQDNCLQHYRTHFK 226

>ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa]
           {ON} weakly similar to uniprot|P38082 Saccharomyces
           cerevisiae YBR066C
          Length = 189

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           C  C K F+ S  L  H  +HTG++  +C +  C++ F+   N ++HYR H KR
Sbjct: 112 CRICYKGFTTSGHLARHNRIHTGEKNHECPYEGCDQKFSRHDNCIQHYRAHVKR 165

>TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.533
           YMR070W
          Length = 387

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           +C  CGK F R S L+ H L H+ +R + C W  C      K N+++H +L  K+
Sbjct: 255 RCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPW--CLSKHKRKDNLLQHMKLKHKQ 307

>KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {ON}
           some similarities with uniprot|P27705 Saccharomyces
           cerevisiae YGL035C
          Length = 460

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           C  C + F R      H   HTG++P  C +P C K F+    + RH R+H
Sbjct: 28  CPICSRAFHRLEHQTRHIRTHTGEKPHACDFPGCTKKFSRSDELTRHKRIH 78

>KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON}
           uniprot|P50898 Kluyveromyces lactis MIG1 Regulatory
           protein MIG1
          Length = 474

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHE 434
           C  C + F R      H   HTG+RP  C +P C K F+    + RH R+H+
Sbjct: 28  CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD 79

>AFR471C Chr6 complement(1287518..1288687) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL035C
           (MIG1)
          Length = 389

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHE 434
           C  C + F R      H   HTG++P  C +  C K F+ +  + RH R+HE
Sbjct: 24  CPICARAFHRLEHQTRHIRTHTGEKPHACDFAGCGKRFSRQDELTRHRRIHE 75

>Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON}
           (43237..43899) [663 nt, 221 aa]
          Length = 220

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  CG+ F+ S  L  H  +HTG++   C +  C   F+   N ++HY+ H
Sbjct: 162 ECKTCGRKFTTSGHLTRHNRIHTGEKNHVCPFEGCNLRFSRNDNSLQHYKTH 213

>NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80
          Length = 455

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 6/65 (9%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHE------KR 436
           C  C + F R      H   HTG++P +C +P C K F+    + RH R+H       KR
Sbjct: 70  CPICQRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTRHKRIHTNPQPRGKR 129

Query: 437 GGAKR 441
           G  K+
Sbjct: 130 GRKKK 134

>YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc finger
           transcriptional repressor; cooperates with Mig1p in
           glucose-induced repression of many genes including SUC2
           (invertase); binds to Mig1p-binding sites in SUC2
           promoter; under low glucose conditions Mig2p relocalizes
           to mitochondrion, where it regulates morphology,
           interacts with Ups1p and antagonizes mitochondrial
           fission factor, Dnm1p, indicative of a role in promoting
           mitochondrial fusion or regulating morphology
          Length = 382

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C + F R    + H   HTG++P  C +P C K+F+    + RH R H
Sbjct: 18  RCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTH 69

>NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {ON}
           Anc_3.518
          Length = 524

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C + F R    + H   HTG++P  C +P C K+F+    + RH R H
Sbjct: 19  KCDVCSRGFHRLEHKKRHMRTHTGEKPHHCNFPGCGKSFSRSDELKRHLRTH 70

>ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} similar
           to uniprot|Q288C3 Torulaspora delbrueckii CRZ1
           Calcineurin-responsive zinc finger transcription factor
           and some similarites with YNL027W uniprot|P53968
           Saccharomyces cerevisiae YNL027W CRZ1 Transcription
           factor that activates transcription of genes involved in
           stress response nuclear localization is positively
           regulated by calcineurin-mediated dephosphorylation
          Length = 619

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 32/59 (54%), Gaps = 5/59 (8%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGAKR 441
           C  CGK F+R  +L++H   HT +RPF+C    C K F  + +  RH  LH    G KR
Sbjct: 510 CELCGKRFTRPYNLKSHLRTHTNERPFECSI--CGKAFARQHDRKRHEDLHT---GKKR 563

 Score = 37.0 bits (84), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 27/63 (42%), Gaps = 9/63 (14%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKC--------VWPSCEKTFNVKSNMMRHYRLH 433
           +C  CGK F+R    + H  +HTG + + C         W  C K F     + RH++  
Sbjct: 537 ECSICGKAFARQHDRKRHEDLHTGKKRYVCGGTLKNGSSW-GCGKKFARSDALGRHFKTE 595

Query: 434 EKR 436
             R
Sbjct: 596 SGR 598

>KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {ON}
           Anc_3.281 YBR066C
          Length = 280

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%)

Query: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           K QC  C   F+ S  L  H  +HTG++ + C   SC + F+   N ++HYR H K+
Sbjct: 211 KFQCKTCSMAFTTSGHLSRHNKIHTGEKNYVCPHESCGQRFSRHDNCIQHYRTHLKK 267

>KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.80
           YGL035C
          Length = 335

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 6/65 (9%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHE------KR 436
           C  C + F R      H   HTG++P  C +P C K F+    + RH R+H       KR
Sbjct: 23  CPICQRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNTQPRGKR 82

Query: 437 GGAKR 441
           G  K+
Sbjct: 83  GRKKK 87

>KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON} 
          Length = 218

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRL 432
           +C  C K+F R + L+ H L HT DR F C W  C+     + N+ +H +L
Sbjct: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKL 168

>Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W
           (REAL)
          Length = 383

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C + F R    + H   HTG++P  C +P C K+F+    + RH R H
Sbjct: 18  RCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTH 69

>NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa]
           {ON} Anc_3.518
          Length = 426

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C + F R    + H   HTG++P  C +P C+K F+ +  + RH R H
Sbjct: 22  RCQFCSRGFHRLEHKKRHVRTHTGEKPHVCNFPHCKKGFSRRDELKRHIRTH 73

>Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {ON}
           YMR037C (REAL)
          Length = 709

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 383 CLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           C  C K F RS  L+ H   VH+ +RPF C    C+K F+   N+ +H + H+K G
Sbjct: 654 CHICSKSFKRSEHLKRHVRSVHSNERPFACHI--CDKKFSRSDNLSQHIKTHKKHG 707

>Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON}
           YER028C (REAL)
          Length = 388

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 4/64 (6%)

Query: 374 NSFGVPKNQ----CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRH 429
           NSF    +Q    C  C + F R    + H   HTG++P KC + SC K+F+    + RH
Sbjct: 6   NSFPADNDQRPFRCEICSRGFHRLEHKKRHVRTHTGEKPHKCSFQSCPKSFSRGDELKRH 65

Query: 430 YRLH 433
            R H
Sbjct: 66  LRTH 69

>Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {ON}
           YMR037C (REAL)
          Length = 703

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 383 CLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           C  C K F RS  L+ H   VH+ +RPF C    CEK F+   N+ +H + H+K G
Sbjct: 648 CHICPKSFKRSEHLKRHVRSVHSNERPFACHI--CEKKFSRSDNLSQHIKTHKKHG 701

>Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)
          Length = 382

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C + F R    + H   HTG++P  C +P C K+F+    + RH R H
Sbjct: 18  RCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTH 69

>Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {ON}
           complement(39687..41171) [1485 nt, 495 aa]
          Length = 494

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 382 QCLKCGKVFSRSSSLQAHAL-VHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437
           +C  C K F RS  L+ H   VH+ +RPF C +  C+K F+   N+ +H + H+K G
Sbjct: 438 KCGDCTKQFRRSEHLKRHIRSVHSKERPFPCKY--CDKKFSRSDNLSQHLKTHKKHG 492

>TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C + F R    + H   HTG++P +C + SC K+F+    + RH R H
Sbjct: 18  KCELCSRGFHRLEHKKRHIRTHTGEKPHRCTFGSCGKSFSRSDELKRHLRTH 69

>Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)
          Length = 400

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C + F R    + H   HTG++P  C +P C K+F+    + RH R H
Sbjct: 18  RCDTCNRGFHRLEHKKRHLRTHTGEKPHHCGFPGCGKSFSRSDELKRHMRTH 69

>SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} similar
           to uniprot|P21192 Saccharomyces cerevisiae YLR131C ACE2
           Transcription factor that activates expression of early
           G1-specific genes localizes to daughter cell nuclei
           after cytokinesis and delays G1 progression in daughters
           localization is regulated by phosphorylation potential
           Cdc28p substrate
          Length = 798

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 382 QCL--KCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436
           QC+   C K F R  ++++H   H  DRP+ C +  C K F    +++RH + H  +
Sbjct: 618 QCMYPDCNKTFRRRYNIRSHIQTHLEDRPYVCDYEGCTKAFVRNHDLIRHKKTHADK 674

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 406 DRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           D+ F+C++P C KTF  + N+  H + H
Sbjct: 614 DKTFQCMYPDCNKTFRRRYNIRSHIQTH 641

>Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027W
           (REAL)
          Length = 682

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 31/59 (52%), Gaps = 5/59 (8%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGAKR 441
           C  CGK F+R  +L++H   HT +RPF C    C K F  + +  RH  LH    G KR
Sbjct: 575 CDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLHT---GKKR 628

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 26/62 (41%), Gaps = 9/62 (14%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCV--------WPSCEKTFNVKSNMMRHYRLHE 434
           C  CGK F+R    + H  +HTG + + C         W  C K F     + RH++   
Sbjct: 603 CSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPW-GCGKKFARSDALGRHFKTES 661

Query: 435 KR 436
            R
Sbjct: 662 GR 663

>NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3.281
          Length = 330

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           C  C K F+ S  L  H  +HTG++   C +  C + F+   N ++HYR H K
Sbjct: 272 CKVCSKGFTTSGHLARHNRIHTGEKSHACHFAGCTQKFSRHDNCLQHYRTHFK 324

>Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 aa]
           {ON} YNL027W (REAL)
          Length = 681

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 31/59 (52%), Gaps = 5/59 (8%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGAKR 441
           C  CGK F+R  +L++H   HT +RPF C    C K F  + +  RH  LH    G KR
Sbjct: 574 CDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLHT---GKKR 627

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 26/62 (41%), Gaps = 9/62 (14%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCV--------WPSCEKTFNVKSNMMRHYRLHE 434
           C  CGK F+R    + H  +HTG + + C         W  C K F     + RH++   
Sbjct: 602 CSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPW-GCSKKFARSDALGRHFKTES 660

Query: 435 KR 436
            R
Sbjct: 661 GR 662

>CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa]
           {ON} similar to uniprot|P53035 Saccharomyces cerevisiae
           YGL209w MIG2 C2H2 zinc-finger protein
          Length = 396

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%)

Query: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLH 433
           +C  C + F R    + H   HTG++P  C +P C K+F+    + RH R H
Sbjct: 18  KCEHCSRGFHRLEHKKRHMRTHTGEKPHGCSFPGCGKSFSRSDELKRHNRTH 69

>Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027W
           (REAL)
          Length = 673

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 31/59 (52%), Gaps = 5/59 (8%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGAKR 441
           C  CGK F+R  +L++H   HT +RPF C    C K F  + +  RH  LH    G KR
Sbjct: 566 CDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLHT---GKKR 619

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 26/62 (41%), Gaps = 9/62 (14%)

Query: 383 CLKCGKVFSRSSSLQAHALVHTGDRPFKCV--------WPSCEKTFNVKSNMMRHYRLHE 434
           C  CGK F+R    + H  +HTG + + C         W  C K F     + RH++   
Sbjct: 594 CSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPW-GCGKKFARSDALGRHFKTES 652

Query: 435 KR 436
            R
Sbjct: 653 GR 654

>Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa]
           {ON} YPR186C (PZF1) - Transcription factor IIIA (TFIIIA)
           with putative Zn-fingers [contig 8] FULL
          Length = 429

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 377 GVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
           G+   QC  C + FSR + L+ H   H+ D+PFKC +  C K    K  + RH   H +
Sbjct: 77  GIKPFQCTVCARQFSRKTHLERHMFSHSEDKPFKCSY--CGKGVTTKQQLRRHEITHTR 133

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 3/45 (6%)

Query: 386 CGKVFSRSSSLQAH-ALVHTGDRPFKCVWPSCEKTFNVKSNMMRH 429
           C K FSR S L  H  +VH G +PF+C    C + F+ K+++ RH
Sbjct: 57  CSKAFSRPSQLTEHQEVVHQGIKPFQCT--VCARQFSRKTHLERH 99

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 5/60 (8%)

Query: 379 PKNQCLKCGKVFSRSSSLQAHALVHTGD--RPFKCVWPSCEKT-FNVKSNMMRHYRLHEK 435
           PK QC +CGK       LQ H  +H+    + +KC   +C    F  K ++M HY  H K
Sbjct: 221 PKLQCPECGKACVGEQGLQMHMKIHSNAVIKNWKC--ETCNDLYFAKKIDLMAHYMEHHK 278

>TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543
           YPR186C
          Length = 472

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 376 FGVPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEK 435
            G+  + C  CG  FSR S L+ H + H+ ++PF C +  C+K    +  + RH   H K
Sbjct: 103 LGIKNHSCDVCGSKFSRKSHLERHLISHSAEKPFHCSF--CDKGLTTRQQLKRHEITHSK 160

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.129    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,690,660
Number of extensions: 1626368
Number of successful extensions: 8234
Number of sequences better than 10.0: 597
Number of HSP's gapped: 8215
Number of HSP's successfully gapped: 786
Length of query: 441
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 328
Effective length of database: 40,524,141
Effective search space: 13291918248
Effective search space used: 13291918248
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)