Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0A09416g2.530ON38538517010.0
KLTH0D06776g2.530ON40941610631e-143
Kwal_26.80012.530ON41341410531e-141
NCAS0F009302.530ON4224269551e-126
Suva_8.582.530ON4524519541e-126
TDEL0A030502.530ON3553869381e-125
YHR004C (NEM1)2.530ON4463969371e-123
Skud_8.492.530ON4474469311e-122
CAGL0K02959g2.530ON4643929191e-120
KAFR0A018302.530ON4424459001e-118
Smik_8.532.530ON4463528981e-117
NDAI0H014202.530ON4483678851e-115
Kpol_348.82.530ON4224348731e-114
KNAG0C058502.530ON4434458731e-114
Ecym_72572.530ON3523898641e-114
TPHA0G035002.530ON3923418511e-111
AGL070W2.530ON3433918461e-111
ZYRO0B01958g2.530ON3363877781e-101
TBLA0I014602.530ON3933437601e-97
KLLA0E18613g2.530ON3743416479e-81
SAKL0G12870g5.202ON3991502578e-24
Smik_12.825.202ON3921592523e-23
YLR019W (PSR2)5.202ON3971592524e-23
NDAI0I021705.202ON3911642514e-23
Skud_12.875.202ON3921592506e-23
Kpol_2002.1005.202ON4771502501e-22
Suva_10.995.202ON3851642462e-22
Smik_12.535.202ON4141712444e-22
CAGL0D05610g5.202ON4471512411e-21
CAGL0D03234g5.202ON4101592402e-21
NDAI0D018605.202ON5141642422e-21
TBLA0C060905.202ON4841592412e-21
TPHA0E030705.202ON4941592403e-21
NCAS0D027405.202ON3981492373e-21
YLL010C (PSR1)5.202ON4271712341e-20
KNAG0M017405.202ON4811532351e-20
Skud_12.575.202ON4151592341e-20
KLTH0B03388g5.202ON4091592331e-20
Suva_10.655.202ON4151592322e-20
ZYRO0B10428g5.202ON4821592332e-20
TDEL0E042705.202ON4531642313e-20
KAFR0J009905.202ON4831642314e-20
TBLA0H019905.202ON6881532325e-20
Kwal_33.151405.202ON4101482285e-20
KLLA0F15620g5.202ON4141482286e-20
Ecym_71045.202ON4921612296e-20
AAL158W5.202ON4781592217e-19
Kpol_478.165.202ON3501502187e-19
NCAS0A068005.202ON4731532201e-18
TPHA0N006705.202ON4521482154e-18
YPL063W (TIM50)8.527ON476991693e-12
TDEL0B031908.527ON477991622e-11
Smik_16.1728.527ON477991613e-11
NCAS0C022108.527ON491991613e-11
SAKL0H10296g8.527ON478991603e-11
NDAI0E029108.527ON441991603e-11
Suva_16.2498.527ON480991594e-11
Skud_16.2188.527ON480991577e-11
Kpol_457.58.527ON489991571e-10
KLTH0E12254g8.527ON476991542e-10
ZYRO0F09130g8.527ON489991542e-10
Kwal_27.119908.527ON474991523e-10
CAGL0H05159g8.527ON485991506e-10
TBLA0A005408.527ON485991506e-10
TPHA0I020008.527ON478991497e-10
KLLA0E23101g8.527ON480991481e-09
Ecym_11778.527ON490991391e-08
KAFR0E010208.527ON448991363e-08
ADR045W8.527ON476981292e-07
KNAG0A020608.527ON450991274e-07
KAFR0B039108.839ON724103732.0
CAGL0M02959g8.839ON758103722.1
TPHA0D011708.661ON91587713.1
NCAS0C004208.839ON725158703.6
ZYRO0D09108gsingletonON410112694.3
TDEL0D046903.153ON83757694.9
TPHA0I002408.839ON73256695.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0A09416g
         (385 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {...   659   0.0  
KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {...   414   e-143
Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {O...   410   e-141
NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.5...   372   e-126
Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}...   372   e-126
TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {O...   365   e-125
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...   365   e-123
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...   363   e-122
CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa] ...   358   e-120
KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {O...   351   e-118
Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON} Y...   350   e-117
NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530    345   e-115
Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON} ...   340   e-114
KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON} Anc_2...   340   e-114
Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar t...   337   e-114
TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {O...   332   e-111
AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic ho...   330   e-111
ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {...   304   e-101
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...   297   1e-97
KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} simi...   253   9e-81
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...   103   8e-24
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...   101   3e-23
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...   101   4e-23
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202    101   4e-23
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...   100   6e-23
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...   100   1e-22
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    99   2e-22
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    99   4e-22
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    97   1e-21
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    97   2e-21
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     98   2e-21
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    97   2e-21
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    97   3e-21
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    96   3e-21
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    95   1e-20
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    95   1e-20
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    95   1e-20
KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} simila...    94   1e-20
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    94   2e-20
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    94   2e-20
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    94   3e-20
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    94   4e-20
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...    94   5e-20
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    92   5e-20
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    92   6e-20
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    93   6e-20
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    90   7e-19
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    89   7e-19
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    89   1e-18
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    87   4e-18
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    70   3e-12
TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.5...    67   2e-11
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    67   3e-11
NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527     67   3e-11
SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {...    66   3e-11
NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {O...    66   3e-11
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    66   4e-11
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    65   7e-11
Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON} ...    65   1e-10
KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]...    64   2e-10
ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {...    64   2e-10
Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]...    63   3e-10
CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {...    62   6e-10
TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {O...    62   6e-10
TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.5...    62   7e-10
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    62   1e-09
Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar t...    58   1e-08
KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.5...    57   3e-08
ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic ho...    54   2e-07
KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.5...    54   4e-07
KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.8...    33   2.0  
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...    32   2.1  
TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {O...    32   3.1  
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...    32   3.6  
ZYRO0D09108g Chr4 (782402..783634) [1233 bp, 410 aa] {ON} simila...    31   4.3  
TDEL0D04690 Chr4 (861474..863987) [2514 bp, 837 aa] {ON} Anc_3.1...    31   4.9  
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...    31   5.8  

>SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 385

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/385 (86%), Positives = 334/385 (86%)

Query: 1   MNAISYITNHVTPPKFDEANSIKKDQADAQAHGTVSKSEQNAPEDDEDKNQTKKATKLSL 60
           MNAISYITNHVTPPKFDEANSIKKDQADAQAHGTVSKSEQNAPEDDEDKNQTKKATKLSL
Sbjct: 1   MNAISYITNHVTPPKFDEANSIKKDQADAQAHGTVSKSEQNAPEDDEDKNQTKKATKLSL 60

Query: 61  LWSIILFLPNFFIIKPVLFFWYIITFPLNLIEHSPAXXXXXXXXXXXXSTGDEEKTPSIN 120
           LWSIILFLPNFFIIKPVLFFWYIITFPLNLIEHSPA            STGDEEKTPSIN
Sbjct: 61  LWSIILFLPNFFIIKPVLFFWYIITFPLNLIEHSPADDEDERNGEEGNSTGDEEKTPSIN 120

Query: 121 IIVEEDEEDLAGDEIILQTDAVKGSLSTISESQQVKTIKAXXXXXXXXXXXXXALGSRRM 180
           IIVEEDEEDLAGDEIILQTDAVKGSLSTISESQQVKTIKA             ALGSRRM
Sbjct: 121 IIVEEDEEDLAGDEIILQTDAVKGSLSTISESQQVKTIKASTRSSIRSGSTGTALGSRRM 180

Query: 181 GRFLFPKKLIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGIS 240
           GRFLFPKKLIPQSVLNNEKKKILVLDLDETLIH            QGHMVEVKFAVSGIS
Sbjct: 181 GRFLFPKKLIPQSVLNNEKKKILVLDLDETLIHSMSRGTSSSNSSQGHMVEVKFAVSGIS 240

Query: 241 SLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCI 300
           SLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCI
Sbjct: 241 SLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCI 300

Query: 301 LRDGVGYIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWISXXXXXXXXXXXXX 360
           LRDGVGYIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWIS             
Sbjct: 301 LRDGVGYIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWISDPTDTDLLNLLPL 360

Query: 361 XEALRFTTDIRNVLSLKSGEQAFNI 385
            EALRFTTDIRNVLSLKSGEQAFNI
Sbjct: 361 LEALRFTTDIRNVLSLKSGEQAFNI 385

>KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 409

 Score =  414 bits (1063), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 222/416 (53%), Positives = 266/416 (63%), Gaps = 43/416 (10%)

Query: 1   MNAISYITNHVTPPKFDEANSIKKDQADAQAHGTVSKSEQNAPEDDEDKN-QTKKATKLS 59
           MNAISY+TN++ PPK +E+         A  H      + NA  D   K  Q +K  + +
Sbjct: 1   MNAISYLTNNILPPKHEEST--------ATPHRVEDSEKANARIDVAPKEAQKRKRARWT 52

Query: 60  LLWSIILFLPNFFIIKPVLFFWYIITFPLNLIEHSPAXXXXXXXXXXXXSTGDEEKTPSI 119
           LLWS++ FLPN  ++KPVLF W++ITFPL+LIE   A            + GD +   S 
Sbjct: 53  LLWSMLAFLPNLIVVKPVLFVWFVITFPLSLIER--ASSSENQGMGFDNAEGDSKSEASA 110

Query: 120 NII----------VEEDEEDLAGDEIILQTDAVKGSLSTISESQQV-------------- 155
             I          + E+E+DLAG+E+ILQ D VKGSL+  S +++               
Sbjct: 111 GTISPKNSSRISTITEEEDDLAGEEMILQADTVKGSLTVTSGAKERPQDKGRRQPLQPQQ 170

Query: 156 -------KTIKAXXXXXXXXXXXXXALGSRRMGRFLFPKKLIPQSVLNNEKKKILVLDLD 208
                  +++K              ALGSRRMGRFLFPKKLIPQSVLN  K++ LVLDLD
Sbjct: 171 QQPKTSRQSLKTSSVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKRRTLVLDLD 230

Query: 209 ETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKRPYCDLFLSKVAKWYTLVVFT 268
           ETLIH            QGHMVEVKFA SGIS+LY VHKRPYCDLFL+K+AKWY LVVFT
Sbjct: 231 ETLIHSMSRGTSSSNSSQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWYELVVFT 290

Query: 269 ASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYIKDLS-LISKKSLNEIIIVDN 327
           ASMKEYADPVIDWLESSF G FS+RLYRQDCILRDGVGYIKDLS ++   SL++I I+DN
Sbjct: 291 ASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVVVPNASLSDIFIIDN 350

Query: 328 SPISYAMNVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDIRNVLSLKSGEQAF 383
           SP+SYAM+VDNAIQVEGWIS              EALRFTTDIRNVL+LKSGE AF
Sbjct: 351 SPVSYAMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDIRNVLALKSGEHAF 406

>Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {ON}
           YHR004C (NEM1) - Nuclear Envelope Morphology [contig 55]
           FULL
          Length = 413

 Score =  410 bits (1053), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 222/414 (53%), Positives = 266/414 (64%), Gaps = 33/414 (7%)

Query: 1   MNAISYITNHVTPPKFDEANSIKKDQADAQAHGTVSKSEQNAPEDDEDKNQTKKATKLSL 60
           MNAISY+TN+   PK  E  S   +  +  A   VS + +N P+    K +  +  + + 
Sbjct: 1   MNAISYLTNNALTPK-PEGPSSSPENIEGSADVNVSGNGKN-PQLKVKKTRKSRGIRWAF 58

Query: 61  LWSIILFLPNFFIIKPVLFFWYIITFPLNLIEHSPAXXXXXXXXXXXXSTG----DEEKT 116
           LWSI++FLPN  ++KP+LF W++ITFPL+LIE S               TG    DE+ +
Sbjct: 59  LWSILVFLPNLLVVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVS 118

Query: 117 ---------PSINIIVEEDEEDLAGDEIILQTDAVKGSLST-----------ISESQQ-- 154
                    P IN I EED+ DL GDEI LQ D VKGSL+            +S  QQ  
Sbjct: 119 TTSDSVGSKPRINTIQEEDD-DLGGDEIFLQPDTVKGSLTATNCVPPEHSQDLSRRQQHS 177

Query: 155 ---VKTIKAXXXXXXXXXXXXXALGSRRMGRFLFPKKLIPQSVLNNEKKKILVLDLDETL 211
               ++ KA             ALGSRRMGRFLFPKKLIPQSVLN  K + LVLDLDETL
Sbjct: 178 KGSRQSPKAASVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKPRTLVLDLDETL 237

Query: 212 IHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKRPYCDLFLSKVAKWYTLVVFTASM 271
           IH            QGHMVEVKFA+SGIS+LY VHKRPYCDLFL+ +A WY LVVFTASM
Sbjct: 238 IHSMSRGTSSSNSSQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVVFTASM 297

Query: 272 KEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYIKDLSLISKKS-LNEIIIVDNSPI 330
           KEYADPVIDWLESSF G FS+RLYRQDCILRDGVGYIKDLS ++  + L++I I+DNSP+
Sbjct: 298 KEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPNTLLSDIFIIDNSPV 357

Query: 331 SYAMNVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDIRNVLSLKSGEQAFN 384
           SYAM+VDNAIQVEGWIS              EALRFTTD+RN+L+LKSGE AF+
Sbjct: 358 SYAMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDVRNILALKSGEHAFS 411

>NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.530
           YHR004C
          Length = 422

 Score =  372 bits (955), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 203/426 (47%), Positives = 262/426 (61%), Gaps = 50/426 (11%)

Query: 1   MNAISYITNHVTPP----KFDEANSIKKDQADAQAHGTVSKSEQNAPEDDEDKNQ----- 51
           MNA+SYI++H+  P    K  E   +  +Q     +  +    +    +DED +      
Sbjct: 1   MNALSYISSHLASPIHYLKKKEPTIVPVEQEPTNNNEKIKSHSKATTNNDEDYSTPMADS 60

Query: 52  --------------TKKATKLSLL-WSIILFLPNFFIIKPVLFFWYIITFPLNLIEHSPA 96
                         + +A + S+L W+ +LF P F I+KP+LF W+I+TFPL L+E    
Sbjct: 61  SSSNTIEKSIAVYGSDRALRFSVLFWTFVLFFPKFLIVKPLLFLWFIVTFPLYLLERGMK 120

Query: 97  XXXXXXXXXXXXSTGDEEKTPS----INIIVEEDEEDLAG-DEIILQTDAVKGSLSTISE 151
                       S  + E+ P+    + +I E  E+DLAG DEI LQ D +KGSL   + 
Sbjct: 121 HRTLLKNKLDENSQKNAERVPTTSPELTVIDETTEDDLAGGDEIYLQRDTIKGSLLKATS 180

Query: 152 SQQV---KTIKAXXXXXXXXXXXXXALGSRRMGRFLFPKKLIPQSVLNNEKKKILVLDLD 208
           ++Q+   KT+K+             +  S+RMG+FLFPKKLIP+S++   ++K LVLDLD
Sbjct: 181 AKQLSSSKTVKSISSNNT-------SFSSKRMGKFLFPKKLIPRSIVQTNRRKKLVLDLD 233

Query: 209 ETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKRPYCDLFLSKVAKWYTLVVFT 268
           ETLIH            QGH+VEVKF+VSG+S+LY+VHKRPYCD FLSKV+KWY L++FT
Sbjct: 234 ETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKRPYCDFFLSKVSKWYDLIIFT 293

Query: 269 ASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYIKDLSLISKK----------- 317
           ASMKEYADPVIDWLE S    FSQRLYR DCILRDGVGYIKDLS+IS+            
Sbjct: 294 ASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEASGMKNISALPP 353

Query: 318 SLNEIIIVDNSPISYAMNVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDIRNVLSLK 377
           SL EIII+DNSPISYAMNV+NAIQVEGWIS              EALRFTTD+RNVL+LK
Sbjct: 354 SLGEIIIIDNSPISYAMNVENAIQVEGWISDPTDNALLNLLPLLEALRFTTDVRNVLALK 413

Query: 378 SGEQAF 383
           +GE+AF
Sbjct: 414 NGEKAF 419

>Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}
           YHR004C (REAL)
          Length = 452

 Score =  372 bits (954), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 206/451 (45%), Positives = 268/451 (59%), Gaps = 66/451 (14%)

Query: 1   MNAISYITNHV---TPPK--------------------FDE-ANSIKKDQADAQAHGTVS 36
           MNA+ Y +NH+     PK                    FD  A++ +KD    + H   S
Sbjct: 1   MNALKYFSNHLITTNKPKKTINVEVTKSQDSLSASNETFDTGASNTEKDPTVKENHQHNS 60

Query: 37  KSEQ-NAPEDDEDKNQT----KKATK-------LSLLWSIILFLPNFFIIKPVLFFWYII 84
            +E  N P+ DE+   +    +KA         +S+LW+I+LFLP + IIKP++  W++ 
Sbjct: 61  STEGPNEPKQDEECTYSVSTKRKALHSILKEKIVSILWAILLFLPYYLIIKPLMSLWFVF 120

Query: 85  TFPLNLIE---------HSPAXXXXXXXXXXXXSTGD-----EEKTPSINIIVEEDEEDL 130
           TFPLN+IE         H  +             +GD     + K  ++N I E  E+DL
Sbjct: 121 TFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSHSGDFNEKQDAKNRNLNTIHEIVEDDL 180

Query: 131 -AGDEIILQTDAVKGSL-----STISESQQVKTIKAXXXXXXXXXXXXXALGSRRMGRFL 184
            A DEIILQ D VKGSL        S   + +                   G++RMGRFL
Sbjct: 181 NASDEIILQRDNVKGSLLQAADGVHSAKSKSRRYSKSEASLTNHSTANTVFGTKRMGRFL 240

Query: 185 FPKKLIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYF 244
           FPKKLIP+S+LN +KKK LV+DLDETLIH            QGH+VEVKF +SGIS+LYF
Sbjct: 241 FPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYF 300

Query: 245 VHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDG 304
           +HKRPYCDLFL+K +KWY L++FTASMKEYADPVIDWLE SF+ SFS+R YR DC+LRDG
Sbjct: 301 IHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDG 360

Query: 305 VGYIKDLSLI----------SKKSLNEIIIVDNSPISYAMNVDNAIQVEGWISXXXXXXX 354
           VGYIKDLS++          S  SL+++II+DNSP+SYAMNVDNAIQVEGWIS       
Sbjct: 361 VGYIKDLSILKSSEENGKGSSLSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDL 420

Query: 355 XXXXXXXEALRFTTDIRNVLSLKSGEQAFNI 385
                  EA+R++TD+RN+L+LK GE+AFN+
Sbjct: 421 LNLLPFLEAMRYSTDVRNILALKHGEKAFNM 451

>TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {ON}
           Anc_2.530 YHR004C
          Length = 355

 Score =  365 bits (938), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 193/386 (50%), Positives = 248/386 (64%), Gaps = 36/386 (9%)

Query: 1   MNAISYITNHVTPPKFDEANSIKKDQADAQAHGTVSKSEQNAPEDDEDKNQTKKATKLSL 60
           MNA+SYI++ ++          K+D+     +G     E        +K   +++   S 
Sbjct: 1   MNAVSYISDQLS----------KRDK-----NGKTEDVEDKVAVQKREKIVRRRSKFTSY 45

Query: 61  LWSIILFLPNFFIIKPVLFFWYIITFPLNLIEHSPAXXXXXXXXXXXXSTGDEEKTPSIN 120
            W++ILF P + IIKP    W+II+ PL LIE+                   +  T ++ 
Sbjct: 46  AWAVILFFPQWLIIKPTQLIWWIISLPLLLIEYG--------LKSRLQRKSTKRSTGTLQ 97

Query: 121 IIVEEDEEDLAG-DEIILQTDAVKGSLSTISESQQVKTIKAXXXXXXXXXXXXXALGSRR 179
            I E +E+DLAG DEI LQ DAVKGSL+     +     ++              LG++R
Sbjct: 98  SISELEEDDLAGGDEIFLQRDAVKGSLAPAKYRRSRSGSRSSTVM----------LGTKR 147

Query: 180 MGRFLFPKKLIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGI 239
           MGRFLFPKKLIP+SVL+ EK+K LV+DLDETLIH            QGHMVE++FA+SG+
Sbjct: 148 MGRFLFPKKLIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGV 207

Query: 240 SSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDC 299
           S+LY+VHKRP+CDLFLSKV+KWY LVVFTASM+EYADPVIDWLE SFSG FS+RLYR +C
Sbjct: 208 STLYYVHKRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNC 267

Query: 300 ILRDGVGYIKDLSLISKK--SLNEIIIVDNSPISYAMNVDNAIQVEGWISXXXXXXXXXX 357
           ILRDGVGYIKDLS++     +L E+I+VDNSPISYAMNVDNAIQVEGWIS          
Sbjct: 268 ILRDGVGYIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWISDPSDTDLLTL 327

Query: 358 XXXXEALRFTTDIRNVLSLKSGEQAF 383
               EALR+TTD+R++L+LK+ EQAF
Sbjct: 328 LPFLEALRYTTDVRDILALKNSEQAF 353

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score =  365 bits (937), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 195/396 (49%), Positives = 247/396 (62%), Gaps = 39/396 (9%)

Query: 25  DQADAQAHGTVSKSEQNAPEDDEDKNQTKKATKL----------SLLWSIILFLPNFFII 74
           DQ    +   + +S+QN     E KN   K  K           S+LW+++LFLP + II
Sbjct: 54  DQQYDHSSSHLKESDQNQ----ERKNSVPKKPKALRSILIEKIASILWALLLFLPYYLII 109

Query: 75  KPVLFFWYIITFPLNLIEH-----------SPAXXXXXXXXXXXXSTGDEEKTP---SIN 120
           KP++  W++ TFPL++IE            S A            +   E+  P   ++N
Sbjct: 110 KPLMSLWFVFTFPLSVIERRVKHTDKRNRGSNASENELPVSSSNINDSSEKTNPKNCNLN 169

Query: 121 IIVEEDEEDL-AGDEIILQTDAVKGSL-STISESQQVKTIKAXXXXXXXXXXXXXALGSR 178
            I E  E+DL A DEIILQ D VKGSL    S   + ++                  G++
Sbjct: 170 TIPEAVEDDLNASDEIILQRDNVKGSLLRAQSVKSRPRSYSKSELSLSNHSSSNTVFGTK 229

Query: 179 RMGRFLFPKKLIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSG 238
           RMGRFLFPKKLIP+SVLN +KKK LV+DLDETLIH            QGH+VEVKF +SG
Sbjct: 230 RMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGLSG 289

Query: 239 ISSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQD 298
           I +LYF+HKRPYCDLFL+KV+KWY L++FTASMKEYADPVIDWLESSF  SFS+R YR D
Sbjct: 290 IRTLYFIHKRPYCDLFLTKVSKWYDLIIFTASMKEYADPVIDWLESSFPSSFSKRYYRSD 349

Query: 299 CILRDGVGYIKDLSLI---------SKKSLNEIIIVDNSPISYAMNVDNAIQVEGWISXX 349
           C+LRDGVGYIKDLS++         S  SL+++II+DNSP+SYAMNVDNAIQVEGWIS  
Sbjct: 350 CVLRDGVGYIKDLSIVKDSEENGKGSSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDP 409

Query: 350 XXXXXXXXXXXXEALRFTTDIRNVLSLKSGEQAFNI 385
                       EA+R++TD+RN+L+LK GE+AFNI
Sbjct: 410 TDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAFNI 445

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score =  363 bits (931), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 203/446 (45%), Positives = 258/446 (57%), Gaps = 61/446 (13%)

Query: 1   MNAISYITNHV---TPPKFDEANSIKKDQADAQAHGTVSKSEQNAPEDD----------- 46
           MNA+ Y +NH+     PK      + K Q    A    SK+     E+D           
Sbjct: 1   MNALKYFSNHLITTKKPKKTINVELTKSQDLVNASNETSKTGARHTENDIIGGNHQHNHS 60

Query: 47  ----------EDKNQT----KKATK-------LSLLWSIILFLPNFFIIKPVLFFWYIIT 85
                     ED NQ+     KA +        S+LW+I+LFLP + IIKP++  W++ T
Sbjct: 61  TDNLEGSKQNEDNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMSLWFVFT 120

Query: 86  FPLNLIEH----------SPAXXXXXXXXXXXXSTGDEEKTPS----INIIVEEDEEDL- 130
           FPL++IE            P                  EK  S    +N I E  ++DL 
Sbjct: 121 FPLSVIERRVKHTDKRHKEPGNSGNVSSTSSGNGNDSNEKAGSKNGNLNTIPETVDDDLN 180

Query: 131 AGDEIILQTDAVKGSL-STISESQQVKTIKAXXXXXXXXXXXXXALGSRRMGRFLFPKKL 189
           A DEIILQ D VKGSL    S   + ++                  G++RMGRFLFPKKL
Sbjct: 181 ASDEIILQRDNVKGSLLKAQSVKSRSRSYSKSDVSLTNHSNTNTVFGTKRMGRFLFPKKL 240

Query: 190 IPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKRP 249
           IP+S+LN +KKK LV+DLDETLIH            QGH+VEVKF +SGI +LYF+HKRP
Sbjct: 241 IPKSILNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGISGIPTLYFIHKRP 300

Query: 250 YCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYIK 309
           YCD FL+KV++WY L++FTASMKEYADPVIDWLESSF  +FS+R YR DC+LRDGVGYIK
Sbjct: 301 YCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYIK 360

Query: 310 DLSLI----------SKKSLNEIIIVDNSPISYAMNVDNAIQVEGWISXXXXXXXXXXXX 359
           DLS+I          S  SL+++II+DNSP+SYAMNVDNAIQVEGWIS            
Sbjct: 361 DLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLP 420

Query: 360 XXEALRFTTDIRNVLSLKSGEQAFNI 385
             EA+R++TD+RN+L+LK GE+AFNI
Sbjct: 421 FLEAMRYSTDVRNILALKHGEKAFNI 446

>CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004c
          Length = 464

 Score =  358 bits (919), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 191/392 (48%), Positives = 250/392 (63%), Gaps = 21/392 (5%)

Query: 14  PKFDEANSIKKDQADAQAHGTVSKSEQNAPEDDEDK-----NQTKKATKLSLL-WSIILF 67
           P   + +  +KD+ D++     +   +  P  DED+      Q  +  K  ++ WSII F
Sbjct: 73  PLIQDKDGAQKDR-DSKTRNVSNNKIEIKPVSDEDEEKDIDGQMSRGLKFFIVVWSIITF 131

Query: 68  LPNFFIIKPVLFFWYIITFPLNLIEHSPAXXXXXXXXXXXXST--GDEEKTPS--INIIV 123
            PN+ +IKP LF W+I+TFPL+LIEHS               +   +++ +PS  +N+I 
Sbjct: 132 FPNYILIKPTLFVWFILTFPLSLIEHSVRRRGKATENEHLSQSPATNKDNSPSKRLNVIE 191

Query: 124 EEDEEDLAGDEII-LQTDAVKGSL--STISESQQVKTIKAXXXXXXXXXXXXXALGSRRM 180
           E  E+DL   E++ LQ DA+KGSL  +    SQ                     LG++ M
Sbjct: 192 EAIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDRGKKTTSTPSHTSNILGTKSM 251

Query: 181 GRFLFPKKLIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGIS 240
           GRF FPKKLIP+S+L +EKKK LV+DLDETLIH            Q H++EV+FA+SG+S
Sbjct: 252 GRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVS 311

Query: 241 SLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCI 300
           +LY+VHKRPYCDLFLSKV KWY L++FTASMKEYADPVIDWLESSFSGSF+QR+YR  CI
Sbjct: 312 TLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCI 371

Query: 301 LRDGVGYIKDLSLI----SKKS---LNEIIIVDNSPISYAMNVDNAIQVEGWISXXXXXX 353
            RDGVGYIKDL  I    SK +   L +++I+DNSP+SYAM+VDNAIQVEGWIS      
Sbjct: 372 ARDGVGYIKDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431

Query: 354 XXXXXXXXEALRFTTDIRNVLSLKSGEQAFNI 385
                   EALR+TTD+RNVL+LK+ E+AF +
Sbjct: 432 LLNLLPFLEALRYTTDVRNVLALKNSEKAFQL 463

>KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {ON}
           Anc_2.530 YHR004C
          Length = 442

 Score =  351 bits (900), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 199/445 (44%), Positives = 262/445 (58%), Gaps = 68/445 (15%)

Query: 1   MNAISYITNHVTPP--KFDEANSIKKD-------------QADAQAHGTVSKSEQNAPE- 44
           MNA+SYITNHV  P  K  + N +K +                    GT+++ E  +PE 
Sbjct: 1   MNALSYITNHVQLPFSKLRDNNKVKANIVPENIVGKKDWSSISNDQKGTITR-ENASPEK 59

Query: 45  ------DDEDKN-----------QTKKATKLS---------LLWSIILFLPNFFIIKPVL 78
                 D  ++N             K+ T LS         LL +IILF+P +  + P++
Sbjct: 60  GLSSVKDAHNQNVEGAIHIKQQIPRKRITILSVFEKFNLFSLLANIILFVPRYLFLNPLI 119

Query: 79  FFWYIITFPLNLIEHSPAXXXXXXXXXXXXSTGDEEKTPSINIIVEEDEEDLA-GDEIIL 137
           + W+I+T PL L+E                + G+  +   +  I E  EEDL+  DE  L
Sbjct: 120 YVWFILTLPLTLVERGIKLRDRKKKAELRGNFGESSELSPLRSISEVGEEDLSTSDEFFL 179

Query: 138 QTDAVKGSLSTISES-----QQVK-TIKAXXXXXXXXXXXXXALGSRRMGRFLFPKKLIP 191
           Q D +KGSL   S       Q+ K TIK                G+++MGRFLFPKKLIP
Sbjct: 180 QRDTIKGSLLRASSDKPPVFQRYKSTIKQDHEAMNTNI-----FGTKKMGRFLFPKKLIP 234

Query: 192 QSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKRPYC 251
           +S+L NE+KK LV+DLDETLIH            QGH+VEVKF+++GIS+LY+VHKRP+C
Sbjct: 235 RSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFC 294

Query: 252 DLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYIKDL 311
           DLFLSKV+KWY +V+FTASMKEYADPVIDWLE SF G+F++RLYR +C+LRDGVGYIKDL
Sbjct: 295 DLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDL 354

Query: 312 SLISK-------------KSLNEIIIVDNSPISYAMNVDNAIQVEGWISXXXXXXXXXXX 358
           S++               + L+E+II+DNSP+SYA+NVDNAIQVEGWIS           
Sbjct: 355 SVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWISDPTDTDLLNLL 414

Query: 359 XXXEALRFTTDIRNVLSLKSGEQAF 383
              EALR+TTD+RNVL+LK+GE+ F
Sbjct: 415 PILEALRYTTDVRNVLALKNGEKMF 439

>Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON}
           YHR004C (REAL)
          Length = 446

 Score =  350 bits (898), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 184/352 (52%), Positives = 229/352 (65%), Gaps = 25/352 (7%)

Query: 59  SLLWSIILFLPNFFIIKPVLFFWYIITFPLNLIEHSPAXXXXXXXXXXXXSTGD------ 112
           S+LW+++LFLP + +IKP++  WY+ TFPL++IE                  G       
Sbjct: 94  SILWALLLFLPYYLVIKPLMSLWYVFTFPLSVIERRVKHTDKRNKESSDNENGSPTSSSS 153

Query: 113 --------EEKTPSINIIVEEDEEDL-AGDEIILQTDAVKGSL-STISESQQVKTIKAXX 162
                     K  ++N I E  E+DL A DEIILQ D VKGSL    S   + ++     
Sbjct: 154 AGDSSEKINSKNCNLNTISETVEDDLNASDEIILQRDNVKGSLLRAQSVKLRSRSYSKSE 213

Query: 163 XXXXXXXXXXXALGSRRMGRFLFPKKLIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXX 222
                        G++RMGRFLFPKKLIP+SVLN +KKK LV+DLDETLIH         
Sbjct: 214 VSLTNHSSTNTVFGTKRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHS 273

Query: 223 XXXQGHMVEVKFAVSGISSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWL 282
              QGH+VEVKF +SGI +LYF+HKRPYCDLFL+KV+KWY L++FTASMKEYADPVIDWL
Sbjct: 274 NSSQGHLVEVKFGISGIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWL 333

Query: 283 ESSFSGSFSQRLYRQDCILRDGVGYIKDLSLI---------SKKSLNEIIIVDNSPISYA 333
           ESSF  SFS+R YR DC+LRDGVGYIKDLS+I         S  SL+++II+DNSP+SYA
Sbjct: 334 ESSFPSSFSRRYYRSDCVLRDGVGYIKDLSIIKNSEENEKGSSSSLDDVIIIDNSPVSYA 393

Query: 334 MNVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDIRNVLSLKSGEQAFNI 385
           MNVDNAIQVEGWIS              EA+R++TD+RN+L+LK GE+AFNI
Sbjct: 394 MNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAFNI 445

>NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530
          Length = 448

 Score =  345 bits (885), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 186/367 (50%), Positives = 230/367 (62%), Gaps = 30/367 (8%)

Query: 38  SEQNAPEDDEDKNQTKKATKLSLLWSIILFLPNFFIIKPVLFFWYIITFPLNLIEHSPAX 97
           S  N  +D + KN        S+LWS +LF P   IIKP+LF WYI+TFPL+LIE     
Sbjct: 87  SSLNVTDDRKTKNNVT-----SILWSFLLFFPKILIIKPILFLWYILTFPLSLIERGTKY 141

Query: 98  XXXXXXXXXXXSTGDEE----------KTPS-INIIVEEDEEDL-AGDEIILQTDAVKGS 145
                      S   +E          + PS ++ I E  E+DL +GD I LQ D VKGS
Sbjct: 142 RMRPFSQSKDSSPEKDETLVHNNSFLPEEPSKLDAINELTEDDLVSGDGIYLQRDNVKGS 201

Query: 146 LSTISESQQVKTIKAXXXXXXXXXXXXXALGSRRMGRFLFPKKLIPQSVLNNEKKKILVL 205
           L   S  +Q     +             +  S+RMG+FLFPKKLIP+S+   E++K LVL
Sbjct: 202 LLKASSVRQ----PSLSRSMKTMVSNNTSFSSKRMGKFLFPKKLIPKSITQTERRKKLVL 257

Query: 206 DLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKRPYCDLFLSKVAKWYTLV 265
           DLDETLIH            QGH+VEVKF+ SG+S LY+VHKRPYCD FLSKV KWY L+
Sbjct: 258 DLDETLIHSISRGTTHTNVSQGHIVEVKFSSSGVSMLYYVHKRPYCDFFLSKVCKWYDLI 317

Query: 266 VFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYIKDLSLISKKS------- 318
           +FTASMKEYADPVIDWLE+SF G+F++R YR DCI RDGVGYIKDL++I   S       
Sbjct: 318 IFTASMKEYADPVIDWLEASFQGTFTERYYRTDCIRRDGVGYIKDLTIIKDDSNVSVPQT 377

Query: 319 --LNEIIIVDNSPISYAMNVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDIRNVLSL 376
             L+E+II+DNSPISYAMN DNAIQVEGWIS              EALR+TTD+R++L+L
Sbjct: 378 STLSEVIILDNSPISYAMNADNAIQVEGWISDPTDTALLNLLPLLEALRYTTDVRSILAL 437

Query: 377 KSGEQAF 383
           K+GE+AF
Sbjct: 438 KNGERAF 444

>Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON}
           complement(15969..17237) [1269 nt, 423 aa]
          Length = 422

 Score =  340 bits (873), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 188/434 (43%), Positives = 249/434 (57%), Gaps = 63/434 (14%)

Query: 1   MNAISYITNHVTPPKFDEANSIKKDQADAQAHG------TVSKSEQNAPEDDEDKNQTKK 54
           MNA+SYI++++  P  +E         D Q +        VS   Q   + ++  N+  +
Sbjct: 1   MNALSYISSNLITPIEEEELPSGSQSEDVQTYTNDVSDTCVSSQTQIISKVEDVLNEDNQ 60

Query: 55  ATKLSLLWSIILFLPNFFIIKPVLFFWYIITFPLNLIEHSPAXXXXXXXXXXXXSTGDEE 114
            + L L   ++LF P + ++KP+ F W++ITFP+ L E                S     
Sbjct: 61  RSTLVL---VLLFFPKYLLVKPIFFLWFLITFPITLFEQKNKKLPKSSANLDTMS----- 112

Query: 115 KTPSINIIVEEDEEDLAGDEIILQTDAVKGSLSTISESQQVKTIKAXXXXXXXXXXXXXA 174
           K+ ++NI+VEED     G EIILQ D + GSL     +QQ     +              
Sbjct: 113 KSKNLNILVEEDLS--GGGEIILQRDTLNGSLLKSRANQQ----HSHQSRHAKSSSSSVG 166

Query: 175 LGSRRMGRFLFPKKLIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKF 234
           L S+++GRFLFPKKLIP+S+L++ +KK LVLDLDETLIH            Q H+VEVKF
Sbjct: 167 LISKKIGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKF 226

Query: 235 AVSGISSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRL 294
            +SGIS+LY+VHKRPYCDLFLSKV +WY L++FTASMKEYADPVIDWLE+SF GSFS+R 
Sbjct: 227 PISGISTLYYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRF 286

Query: 295 YRQDCILRDGVGYIKDLSLIS--------------------------------------- 315
           YR DCILRDGVGYIKDLS+++                                       
Sbjct: 287 YRNDCILRDGVGYIKDLSIVNAIPGSHAASTTSHNNHNNNNNSNTNSNDNNDNNDTNAHT 346

Query: 316 ----KKSLNEIIIVDNSPISYAMNVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDIR 371
                  L+E+I++DNSP+SYAMNVDNAIQV+GWIS              E+LR TTD+R
Sbjct: 347 HQLQNNLLSEVILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVR 406

Query: 372 NVLSLKSGEQAFNI 385
           N+LSLK+GE+AFN+
Sbjct: 407 NILSLKNGERAFNV 420

>KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON}
           Anc_2.530 YHR004C
          Length = 443

 Score =  340 bits (873), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 205/445 (46%), Positives = 259/445 (58%), Gaps = 63/445 (14%)

Query: 1   MNAISYITNHVTPPKFDEANSI------------------KKDQADAQAHGT--VSKSEQ 40
           MN ISYIT H+  P    A S+                  + D AD +   T  V K E 
Sbjct: 1   MNTISYITQHLIYPLRPRAKSLHNEVKSGEGKVDDGVGVTENDVADGKLKTTANVEKQEN 60

Query: 41  NAPED---DEDKNQTKKATK--------------------LSLLWSIILFLPNFFIIKPV 77
           +  ++   D   +  +KA+K                     ++L  +I FLP + I KP+
Sbjct: 61  STLKEELLDRQGSDAEKASKPIIVINDGDILNENILHQKVWNVLVFVIFFLPTYLIYKPL 120

Query: 78  LFFWYIITFPLNLIEHSPAXXXXXXXXXXXXST---GDEEKTPSINIIVEEDEEDLA-GD 133
           L  W+++T PL L+E                S     D  K  SIN   EE EEDLA GD
Sbjct: 121 LLLWFLVTLPLALVERGIKLRNRPKMKTEKVSELVLSDPSKLGSIN---EEVEEDLAAGD 177

Query: 134 EIILQTDAVKGSLSTISESQQVKTIK-----AXXXXXXXXXXXXXALGSRRMGRFLFPKK 188
           E  LQ D VKGSL   + ++    +K     A               G+++MGRFLFPKK
Sbjct: 178 EFYLQRDIVKGSLLKATTNKHHTPLKSKKNSAQNQHGNETHPNSTVFGTKKMGRFLFPKK 237

Query: 189 LIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKR 248
           LIP+S+LN EKKK LV+DLDETLIH            QGH+VEVKF++SG+S+LY+V KR
Sbjct: 238 LIPKSILNREKKKTLVMDLDETLIHSVSRGTTHPNSSQGHIVEVKFSISGVSTLYYVFKR 297

Query: 249 PYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYI 308
           PYCDLFL+KV+KWY +V+FTASMKEYADPVIDWLESSF+G FS+RLYR DCILRDGVGYI
Sbjct: 298 PYCDLFLTKVSKWYDIVIFTASMKEYADPVIDWLESSFAGKFSRRLYRNDCILRDGVGYI 357

Query: 309 KDLSLISKKS--------LNEIIIVDNSPISYAMNVDNAIQVEGWISXXXXXXXXXXXXX 360
           KDL ++++ S        L ++IIVDNSP+SYA+NVDNAIQVEGWI+             
Sbjct: 358 KDLKMVTRGSNLGTSPDRLEDVIIVDNSPVSYALNVDNAIQVEGWINDPTDTDLLNLIPL 417

Query: 361 XEALRFTTDIRNVLSLKSGEQAFNI 385
            EAL  TTD+RN+LSLK+GE+AFNI
Sbjct: 418 LEALENTTDVRNILSLKNGEKAFNI 442

>Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar to
           Ashbya gossypii AGL070W
          Length = 352

 Score =  337 bits (864), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 184/389 (47%), Positives = 244/389 (62%), Gaps = 44/389 (11%)

Query: 1   MNAISYITNHVTPPKFDEANSIKKDQADAQAHGTVSKSEQNAPEDDEDKNQTKKATKLSL 60
           MN++SY+T    P      +S K++     +  ++    +    ++ + +Q  K  + S 
Sbjct: 1   MNSLSYLTGSSQP-----TSSSKEELRFPFSESSLPNVTEEQEVENGEVSQDSKGGRPSW 55

Query: 61  LWSIILFLPNFFIIKPVLFFWYIITFPLNLIEHSPAXXXXXXXXXXXXSTGDEEKTPSIN 120
           +W ++ FLP + IIKP+   W+++TFPLNLIEH+ +            S  +EE  P+ +
Sbjct: 56  VWRVVFFLPTWLIIKPIWLIWFVLTFPLNLIEHTSSKDG---------SVEEEEVIPTNS 106

Query: 121 I------IVEEDEEDLAGDEIILQTDAVKGSLSTISESQQVKTIKAXXXXXXXXXXXXXA 174
                  ++E+D  DL G+ ++L  D++K S  + S S    T                 
Sbjct: 107 QGSGGGEVIEDD--DLVGESMVLHEDSIKSSRPSTSRSSYTST----------------- 147

Query: 175 LGSRRMGRFLFPKKLIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKF 234
               R+G+FLFPKKLIPQS+L  ++KK+LVLDLDETLIH            QGHMVEV F
Sbjct: 148 ----RLGKFLFPKKLIPQSILQTDRKKVLVLDLDETLIHSMSRSTSSSNTSQGHMVEVTF 203

Query: 235 AVSGISSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRL 294
           +VSG+SSLY+VHKRPYCDLFLS+V KWY LV+FTASM+EYADPVIDWLES  S  F++R 
Sbjct: 204 SVSGVSSLYYVHKRPYCDLFLSRVCKWYDLVIFTASMREYADPVIDWLESGISARFTKRK 263

Query: 295 YRQDCILRDGVGYIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWISXXXXXXX 354
           YR DCILRDG+GY+KDL++IS K+L + IIVDNSP+SYAMNVDNAIQVEGWIS       
Sbjct: 264 YRSDCILRDGIGYVKDLTMIS-KNLQDTIIVDNSPVSYAMNVDNAIQVEGWISDPTDTGL 322

Query: 355 XXXXXXXEALRFTTDIRNVLSLKSGEQAF 383
                  E LRFTTD RN+LSLK+GE AF
Sbjct: 323 LNLLPLLEGLRFTTDTRNILSLKNGEHAF 351

>TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {ON}
           Anc_2.530 YHR004C
          Length = 392

 Score =  332 bits (851), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 172/341 (50%), Positives = 216/341 (63%), Gaps = 30/341 (8%)

Query: 75  KPVLFFWYIITFPLNLIEHSPAXXXXXXXXXXXXSTGD---------------EEKTPSI 119
           KP+LF WY++TFPL L E + +            S  D                ++T  +
Sbjct: 51  KPLLFSWYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQL 110

Query: 120 NIIVEEDEEDLAGDEIILQTDAVKGSLSTISESQQVKTI--KAXXXXXXXXXXXXXALGS 177
             +    E+D+ G E+ILQ D VKGSL   S   +V                    A G+
Sbjct: 111 QNLDSVLEDDMKGGEMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSSVAFGT 170

Query: 178 RRMGRFLFPKKLIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVS 237
           ++MGRFLFPKKLIP+S+L++ +KK LVLDLDETLIH            Q H+VEVKF +S
Sbjct: 171 KKMGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRSNSNSNNAQAHLVEVKFQIS 230

Query: 238 GISSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQ 297
           GIS+LY+VHKRPYCDLFLS V+KWY L++FTASMKEYADPVIDWLESSF G+FS+R YR 
Sbjct: 231 GISTLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRN 290

Query: 298 DCILRDGVGYIKDLSLISKKS-------------LNEIIIVDNSPISYAMNVDNAIQVEG 344
            CILRDGVGYIKDLS+I+  +             L+EII++DNSP+SYAMNVDNAIQVEG
Sbjct: 291 HCILRDGVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEG 350

Query: 345 WISXXXXXXXXXXXXXXEALRFTTDIRNVLSLKSGEQAFNI 385
           WIS              E+LR+TTD+RN+LSLK+GE+AF+I
Sbjct: 351 WISDPTDQDLLNLLPFLESLRYTTDVRNILSLKNGERAFDI 391

>AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR004C (NEM1)
          Length = 343

 Score =  330 bits (846), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 183/391 (46%), Positives = 238/391 (60%), Gaps = 57/391 (14%)

Query: 1   MNAISYITNHVTPPKFDEANSIKKDQADAQAHGTVSKSEQNAPE--DDEDKNQTKKATKL 58
           MN++SY+T                  A  +  G    SE+   +  +++D  +       
Sbjct: 1   MNSLSYLTGAT-------------QHAAGKGDGRWPGSERGLAKVREEQDAARAGVGAGA 47

Query: 59  SLLWSIILFLPNFFIIKPVLFFWYIITFPLNLIEHSPAXXXXXXXXXXXXSTGDEEKTPS 118
           + +W ++ FLP + ++KPV+  W+++TFPL+LIE +              S+ + +  P 
Sbjct: 48  AWVWRVLFFLPKWLVVKPVVLVWFVLTFPLSLIEQT--------------SSKEADGAPG 93

Query: 119 ------INIIVEEDEEDLAGDEIILQTDAVKGSLSTISESQQVKTIKAXXXXXXXXXXXX 172
                   +    +++DLAG+ ++LQ D+VK S  + S S    T               
Sbjct: 94  PEAAEEEQLAEAVEDDDLAGESMVLQEDSVKSSRPSTSRSSYTSTR-------------- 139

Query: 173 XALGSRRMGRFLFPKKLIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEV 232
                  +G+FLFPKKLIPQS+L  ++KK+LVLDLDETLIH            QGHMVEV
Sbjct: 140 -------LGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHSMSRSTSSVSNSQGHMVEV 192

Query: 233 KFAVSGISSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQ 292
            FA SG+S+LY+VHKRPYCDLFLS+V+KWY LV+FTASMKEYADPVIDWLES  S  FSQ
Sbjct: 193 TFAASGVSTLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQ 252

Query: 293 RLYRQDCILRDGVGYIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWISXXXXX 352
           R YR DC+LRDGVGY+KDLS+IS K+L +IIIVDNSPISYAMNVDNAIQVEGWIS     
Sbjct: 253 RRYRSDCLLRDGVGYVKDLSIIS-KNLQDIIIVDNSPISYAMNVDNAIQVEGWISDPTDT 311

Query: 353 XXXXXXXXXEALRFTTDIRNVLSLKSGEQAF 383
                    E LRFTTD RN+LSLK+GE+AF
Sbjct: 312 GLLNLLPLLEGLRFTTDTRNILSLKNGERAF 342

>ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 336

 Score =  304 bits (778), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 173/387 (44%), Positives = 230/387 (59%), Gaps = 54/387 (13%)

Query: 1   MNAISYITNHVTPPKFDEANSIKKDQADAQAHGTVSKSEQNAPEDDE-DKNQTKKATKLS 59
           MNAISY++N           S     + + +HG + +SE+   ++DE ++ Q +     S
Sbjct: 1   MNAISYLSN--LSSTPSNPISSSSSSSSSSSHGVLVESEEEQEDNDEVNQFQNENDEGES 58

Query: 60  LLWSIILFLPNFFIIKPVLFFWYIITFPLNLIEHSPAXXXXXXXXXXXXSTGDEEKTPSI 119
           +             +KP    W++IT PL LIE+               S    E T   
Sbjct: 59  IF------------LKPFHLIWFVITSPLILIEYG------------LKSKQKVESTSRK 94

Query: 120 NIIVEEDE--EDLAGDEIILQTDAVKGSLSTISESQQVKTIKAXXXXXXXXXXXXXALGS 177
             I+ + E  +DLA DE+ LQ D VKG L                           A G+
Sbjct: 95  GEIIRKKEVDDDLAEDEMFLQRDTVKGGLRG------------------------KAFGT 130

Query: 178 RRMGRFLFPKKLIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVS 237
           ++MGRFLFPKKL+PQS+L  E+KK LV+DLDETLIH            QGHMVEV+F  S
Sbjct: 131 KKMGRFLFPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPS 190

Query: 238 GISSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQ 297
            IS+LY+VHKRP+CDLFLSKV+KWY L++FTASMKEYADPVIDWLESSF+G F +RLYR 
Sbjct: 191 SISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRH 250

Query: 298 DCILRDGVGYIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWISXXXXXXXXXX 357
           +C++R+GVGYIKDLS+++ + L+E++++DNSP SYA N DNAIQVEGWIS          
Sbjct: 251 NCVVREGVGYIKDLSVVT-EVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTDLLNL 309

Query: 358 XXXXEALRFTTDIRNVLSLKSGEQAFN 384
               EALR+ TD+R++L LK+GE+A  
Sbjct: 310 LPLLEALRYVTDVRSILGLKNGEKALG 336

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score =  297 bits (760), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 159/343 (46%), Positives = 202/343 (58%), Gaps = 40/343 (11%)

Query: 73  IIKPVLFFWYIITFPLNLIEHSPAXXXXXXXXXXXXSTGDEEKTPSINIIVEEDEEDL-A 131
           +IKP++F WYI TFPL LIE                       T         D +DL +
Sbjct: 58  LIKPLIFLWYIFTFPLLLIEQHTNRKYKDTPPLIDPKIASSSAT---------DLDDLNS 108

Query: 132 GDEIILQTDAVKGSLSTISESQQVKTIKAXXXXXXXX---------------XXXXXALG 176
            DEIILQTD++KGSL     +    T  A                             +G
Sbjct: 109 NDEIILQTDSIKGSLLEKKNTSAAATPSATPPATSPSPLVIKQKKIQNKSVYSLTSNFIG 168

Query: 177 SRRMGRFLFPKKLIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAV 236
           S+ MGRFLFPKKLIP S+L   K+K L+LDLDETLIH              H++EVKF  
Sbjct: 169 SKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLIHSMSRNISSSTISNYHLIEVKFPT 228

Query: 237 SG------------ISSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLES 284
                         +SSLY+V+KRPYCD FL+ V+ WY L++FTASMKEYADPVIDWLE 
Sbjct: 229 PTSAPTSAPGPSLPLSSLYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLED 288

Query: 285 SFSGSFSQRLYRQDCILRDGVGYIKDLSLI---SKKSLNEIIIVDNSPISYAMNVDNAIQ 341
           SF+G+F +RLYR  CILRDG+GYIKDLS++   ++ +LNE+I++DNSPIS+AMNVDNAIQ
Sbjct: 289 SFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQ 348

Query: 342 VEGWISXXXXXXXXXXXXXXEALRFTTDIRNVLSLKSGEQAFN 384
           V+GWIS              E+LR TTD+RN+L+LK+GE+AF+
Sbjct: 349 VQGWISDPTDTELLTLLPFLESLRHTTDVRNILALKNGERAFH 391

>KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} similar
           to uniprot|Q750M6 Ashbya gossypii AGL070W AGL070Wp and
           weakly similar to YHR004C uniprot|P38757 Saccharomyces
           cerevisiae YHR004C NEM1 Protein of the nuclear envelope
           required for the spherical shape of the nucleus required
           for normal sporulation
          Length = 374

 Score =  253 bits (647), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 136/341 (39%), Positives = 191/341 (56%), Gaps = 48/341 (14%)

Query: 58  LSLLWSIILFLPNFFIIKPVLFFWYIITFPLNLIEHSPAXXXXXXXXXXXXSTGDEEKTP 117
           +  +W I++FLPN+ +IKP++  WY+ITFPLNL+E +               +  E+ + 
Sbjct: 67  MRWIWCILIFLPNYLLIKPIITIWYVITFPLNLMETNTQGNKGLIQVGSETDSRTEKLS- 125

Query: 118 SINIIVEEDEEDLAGDEIILQTDAVKGSLSTISESQQVKTIKAXXXXXXXXXXXXXALGS 177
               +VEED      DEII+  D +K    T                             
Sbjct: 126 --KYVVEEDLS--PTDEIIINQDKMKPRPIT----------------------------- 152

Query: 178 RRMGRFLFPKKLIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQG---------H 228
             +G+F FPKKL+PQS+L +  +K+LVLDLDETLIH                       H
Sbjct: 153 EYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIH 212

Query: 229 MVEVKFAVSGISSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSG 288
           +VEV+F  + IS+LY V KRPYCD+FL + ++WY + +FTASMKEYADPVIDWL+ + S 
Sbjct: 213 LVEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSV 272

Query: 289 SFSQRLYRQDCILRDGVGYIKDLSLI-----SKKSLNEIIIVDNSPISYAMNVDNAIQVE 343
            F  R YR+DC LR GVGY+KD+  +     + + L+++II+DNSPISYAM++DNAIQV 
Sbjct: 273 QFHYRWYREDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVH 332

Query: 344 GWISXXXXXXXXXXXXXXEALRFTTDIRNVLSLKSGEQAFN 384
           GWI+              +A+R  TD R +L+LKSG  + +
Sbjct: 333 GWINDPSDSELLHLLPLLKAMRHVTDSRCILALKSGRASIS 373

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score =  103 bits (257), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 85/150 (56%), Gaps = 10/150 (6%)

Query: 198 EKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKRPYCDLFLSK 257
           E KK LVLDLDETL+H                VE+   V  +    +V KRP  D FL +
Sbjct: 227 EGKKCLVLDLDETLVHSSFKYLRTADFVIP--VEIDDQVHNV----YVIKRPGVDEFLER 280

Query: 258 VAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYIKDLSLISKK 317
           V K Y +VVFTAS+  Y DP++D L+    G+   RL+R  C   DG  YIK+LS I + 
Sbjct: 281 VGKLYEVVVFTASVSRYGDPLLDILDP--RGAVHHRLFRDSCYNYDG-NYIKNLSQIGRP 337

Query: 318 SLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
            L+++II+DNSP SY ++  +AI +  W S
Sbjct: 338 -LSDLIILDNSPASYILHPQHAIPISSWFS 366

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score =  101 bits (252), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 62/159 (38%), Positives = 92/159 (57%), Gaps = 10/159 (6%)

Query: 189 LIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKR 248
           L+P  +   ++KK L+LDLDETL+H                VE+   V  +    +V KR
Sbjct: 211 LLPPKLEKFQQKKCLILDLDETLVHSSFKYMHTADFVLP--VEIDDQVHNV----YVIKR 264

Query: 249 PYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYI 308
           P  D FLS+V + Y +VVFTAS+  YA+P++D L+   +G+   RL+R+ C   +G  YI
Sbjct: 265 PGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDP--NGTIHHRLFREACYNYEG-NYI 321

Query: 309 KDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
           K+LS I +  L+E II+DNSP SY  +  +A+ +  W S
Sbjct: 322 KNLSQIGRP-LSETIILDNSPASYIFHPQHAVPISSWFS 359

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score =  101 bits (252), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 93/159 (58%), Gaps = 10/159 (6%)

Query: 189 LIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKR 248
           L+P  +   ++KK L+LDLDETL+H                VE+   V  +    +V KR
Sbjct: 216 LLPPKLQEFQQKKCLILDLDETLVHSSFKYMHSADFVLP--VEIDDQVHNV----YVIKR 269

Query: 249 PYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYI 308
           P  D FL++V++ Y +VVFTAS+  YA+P++D L+   +G+   RL+R+ C   +G  YI
Sbjct: 270 PGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDP--NGTIHHRLFREACYNYEG-NYI 326

Query: 309 KDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
           K+LS I +  L+E II+DNSP SY  +  +A+ +  W S
Sbjct: 327 KNLSQIGRP-LSETIILDNSPASYIFHPQHAVPISSWFS 364

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score =  101 bits (251), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 91/164 (55%), Gaps = 16/164 (9%)

Query: 187 KKLIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVS---GISSLY 243
           + L+P        KK LVLDLDETL+H              H  +    V     I ++Y
Sbjct: 208 RTLLPPQTNECFGKKCLVLDLDETLVHSSFKYL--------HTADFVLPVDIDDQIHNVY 259

Query: 244 FVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRD 303
            + KRP  D FL +VA+ Y +VVFTAS+  Y DP++D L+S  S S   RL+R+ C   +
Sbjct: 260 VI-KRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDS--SNSIHHRLFREACYNYE 316

Query: 304 GVGYIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
           G  Y+K+L+ I +  L+EI+I+DNSP SY  +  +AI +  W S
Sbjct: 317 G-NYVKNLAQIGRP-LSEIVILDNSPASYMFHPQHAIPISSWFS 358

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score =  100 bits (250), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 92/159 (57%), Gaps = 10/159 (6%)

Query: 189 LIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKR 248
           L+P  +   ++KK L+LDLDETL+H                VE+   V  +    +V KR
Sbjct: 211 LLPPKLQEFQQKKCLILDLDETLVHSSFKYMQTADFVLP--VEIDDQVHNV----YVIKR 264

Query: 249 PYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYI 308
           P  D FL +V++ Y +VVFTAS+  YA+P++D L+   +G+   RL+R+ C   +G  YI
Sbjct: 265 PGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDP--NGTIHHRLFREACYNYEG-NYI 321

Query: 309 KDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
           K+LS I +  L+E II+DNSP SY  +  +A+ +  W S
Sbjct: 322 KNLSQIGRP-LSETIILDNSPASYIFHPQHAVPISSWFS 359

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score =  100 bits (250), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 85/150 (56%), Gaps = 10/150 (6%)

Query: 198 EKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKRPYCDLFLSK 257
           + KK LVLDLDETL+H                  +   +   +   +V KRP  D FL +
Sbjct: 305 KNKKCLVLDLDETLVHSSFKYIDTADFV------LPVTIDDQTHQVYVIKRPGVDEFLKR 358

Query: 258 VAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYIKDLSLISKK 317
           V K + +VVFTAS+  Y DP++D L+S  S S   RL+R+ C + DG  Y+K+LS I  +
Sbjct: 359 VGKIFEVVVFTASVSRYGDPLLDILDS--SKSIHHRLFRESCYIYDG-NYVKNLSQIG-R 414

Query: 318 SLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
            L++III+DNSP SY  +  +AI +  W S
Sbjct: 415 PLSDIIILDNSPASYIFHPQHAIPISSWFS 444

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 99.4 bits (246), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 93/164 (56%), Gaps = 15/164 (9%)

Query: 184 LFPKKLIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLY 243
           L P KL+P      ++KK L+LDLDETL+H                VE+   V  +    
Sbjct: 204 LLPPKLLP-----FQQKKCLILDLDETLVHSSFKYLHTADFVLP--VEIDDQVHNV---- 252

Query: 244 FVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRD 303
           +V KRP  D FL +V++ Y +VVFTAS+  YA+P++D L+   + +   RL+R+ C   +
Sbjct: 253 YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDP--NRTIHHRLFREACYNYE 310

Query: 304 GVGYIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
           G  YIK+LS I  + L+E II+DNSP SY  +  +A+ +  W S
Sbjct: 311 G-NYIKNLSQIG-RPLSETIILDNSPASYIFHPQHAVPISSWFS 352

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 98.6 bits (244), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 94/171 (54%), Gaps = 12/171 (7%)

Query: 179 RMGRFLFP--KKLIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAV 236
           + G++  P  K L+P    N + KK L+LDLDETL+H                VE+   V
Sbjct: 221 QQGQYHAPGYKTLLPPQDENTKGKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQV 278

Query: 237 SGISSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYR 296
             +    +V KRP  + FL +V K + +VVFTAS+  Y DP++D L++        RL+R
Sbjct: 279 HNV----YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDA--DKVIHHRLFR 332

Query: 297 QDCILRDGVGYIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
           + C   +G  YIK+LS I +  L++III+DNSP SY  +  +AI +  W S
Sbjct: 333 EACYNYEG-NYIKNLSQIGRP-LSDIIILDNSPASYIFHPQHAIPISSWFS 381

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 97.4 bits (241), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 84/151 (55%), Gaps = 16/151 (10%)

Query: 200 KKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVS---GISSLYFVHKRPYCDLFLS 256
           KK LVLDLDETL+H              H  +    V     I ++Y + KRP  D FL 
Sbjct: 277 KKCLVLDLDETLVHSSFKYL--------HTADFVLPVDIDDQIHNVYVI-KRPGVDEFLQ 327

Query: 257 KVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYIKDLSLISK 316
           +V + Y +VVFTAS+  Y DP++D L+   S +   RL+R  C   +G  YIK+LS I  
Sbjct: 328 RVGELYEVVVFTASVSRYGDPLLDVLDK--SNNIHHRLFRDACYTYEG-NYIKNLSQIG- 383

Query: 317 KSLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
           + L+EIII+DNSP SY  +  +AI +  W S
Sbjct: 384 RPLSEIIILDNSPPSYIFHPQHAIPISSWFS 414

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 97.1 bits (240), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 86/159 (54%), Gaps = 10/159 (6%)

Query: 189 LIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKR 248
           L+P      + KK LVLDLDETL+H                V +   V  +    +V KR
Sbjct: 229 LLPPQTEQFKGKKCLVLDLDETLVHSSFKYLRTADFVLP--VNIDDQVHNV----YVIKR 282

Query: 249 PYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYI 308
           P  D FL +V + Y +VVFTAS+  Y DP++D L+     S   RL+R+ C   +G  YI
Sbjct: 283 PGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQ--HKSIHHRLFREACYNYEG-NYI 339

Query: 309 KDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
           K+LS I +  L+EIII+DNSP SY  +  +AI V  W S
Sbjct: 340 KNLSQIGRP-LSEIIILDNSPASYIFHPQHAIPVSSWFS 377

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 97.8 bits (242), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 62/164 (37%), Positives = 90/164 (54%), Gaps = 19/164 (11%)

Query: 189 LIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAV-----SGISSLY 243
           L P+  +  + KK LVLDLDETL+H              ++    F +       I ++Y
Sbjct: 332 LSPKDEIKFKHKKCLVLDLDETLVHSSFK----------YLPNADFNLPVNIDDQIHNVY 381

Query: 244 FVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRD 303
            + KRP  D FL KV K + +V+FTAS+  Y DP++D L+     S   RL+R+ C   +
Sbjct: 382 VI-KRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPK-GKSIHHRLFREACYNYE 439

Query: 304 GVGYIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
           G  YIK+LS +  + L+EIII+DNSP SY  +  +AI +  W S
Sbjct: 440 G-NYIKNLSQMG-RPLSEIIILDNSPASYIFHPQHAIPISSWFS 481

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 97.4 bits (241), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 91/159 (57%), Gaps = 8/159 (5%)

Query: 189 LIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKR 248
           L+P     ++ KK L+LDLDETL+H               ++ ++     I ++Y + KR
Sbjct: 301 LLPPKDSKDKHKKCLILDLDETLVHSSFKFINNPDF----ILPIEIEDGQIHNVYVI-KR 355

Query: 249 PYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYI 308
           P  D FL +V KWY +V+FTAS+  YA+P++D L+   +   + RL+R  C   +   +I
Sbjct: 356 PGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHN-LINHRLFRDACYNYEN-NFI 413

Query: 309 KDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
           K+LS I  + L++III+DNSP SY  +  +AI +  W S
Sbjct: 414 KNLSQIG-RPLHDIIILDNSPASYIFHPQHAIPISSWFS 451

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 97.1 bits (240), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 57/159 (35%), Positives = 88/159 (55%), Gaps = 9/159 (5%)

Query: 189 LIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKR 248
           L P+ +    +KK L+LDLDETL+H                  +   +   +   +V KR
Sbjct: 312 LAPKEIKRFGRKKCLILDLDETLVHSSFKYVDSADFV------IPVTIDNQTHHVYVIKR 365

Query: 249 PYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYI 308
           P  D FL +V++ Y +VVFTAS+  Y DP+++ L+ + +     RL+R+ C   +G  Y+
Sbjct: 366 PGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILDPA-NTIIHHRLFRESCYTYEG-NYV 423

Query: 309 KDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
           K+LS + +  LNEIII+DNSP SY  +  +AI +  W S
Sbjct: 424 KNLSQLGRP-LNEIIILDNSPASYIFHPQHAIPISSWFS 461

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 95.9 bits (237), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 59/149 (39%), Positives = 85/149 (57%), Gaps = 10/149 (6%)

Query: 199 KKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKRPYCDLFLSKV 258
            KK LVLDLDETL+H                VE++  +  +    +V KRP  D FL +V
Sbjct: 227 NKKCLVLDLDETLVHSSFKYVRTADFVLP--VEIEDQIHNV----YVIKRPGVDEFLKRV 280

Query: 259 AKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYIKDLSLISKKS 318
            + Y +VVFTAS+  Y DP+++ L+   S S   RL+R+ C   +G  YIK+L+ I +  
Sbjct: 281 GELYEVVVFTASVSRYGDPLLNILDQ--SNSVHHRLFREACYNYEG-NYIKNLAQIGRP- 336

Query: 319 LNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
           L++III+DNSP SY  +  +AI +  W S
Sbjct: 337 LSDIIILDNSPASYMFHPQHAIPISSWFS 365

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 94.7 bits (234), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 93/171 (54%), Gaps = 12/171 (7%)

Query: 179 RMGRFLFP--KKLIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAV 236
           + G++  P    L+P    + + KK L+LDLDETL+H                VE+   V
Sbjct: 234 QQGQYHAPGYNTLLPPQDESTKGKKCLILDLDETLVHSSFKYLRSADFVLS--VEIDDQV 291

Query: 237 SGISSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYR 296
             +    +V KRP  + FL +V K + +VVFTAS+  Y DP++D L++        RL+R
Sbjct: 292 HNV----YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDT--DKVIHHRLFR 345

Query: 297 QDCILRDGVGYIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
           + C   +G  YIK+LS I  + L++III+DNSP SY  +  +AI +  W S
Sbjct: 346 EACYNYEG-NYIKNLSQIG-RPLSDIIILDNSPASYIFHPQHAIPISSWFS 394

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 84/153 (54%), Gaps = 20/153 (13%)

Query: 200 KKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAV-----SGISSLYFVHKRPYCDLF 254
           +K LVLDLDETL+H              ++    F +       I ++Y + KRP  D F
Sbjct: 311 RKCLVLDLDETLVHSSFK----------YLKSADFVLPVDIDDQIHNVYVI-KRPGVDEF 359

Query: 255 LSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYIKDLSLI 314
           L +V K Y +VVFTAS+  Y DP++D L+     S   RL+R+ C   +G  YIK+LS I
Sbjct: 360 LRRVGKLYEVVVFTASVSRYGDPLLDILDK--DKSIHHRLFREACYNYEG-NYIKNLSQI 416

Query: 315 SKKSLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
            +  L+ III+DNSP SY  +  +AI +  W S
Sbjct: 417 GRP-LSNIIILDNSPASYIFHPQHAIPISSWFS 448

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 94.7 bits (234), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/159 (37%), Positives = 89/159 (55%), Gaps = 10/159 (6%)

Query: 189 LIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKR 248
           L+P    + + KK L+LDLDETL+H                VE+   V  +    +V KR
Sbjct: 234 LLPPQGESTKGKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHNV----YVIKR 287

Query: 249 PYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYI 308
           P  + FL +V K + +VVFTAS+  Y DP++D L++  +     RL+R+ C   +G  YI
Sbjct: 288 PGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDT--NKVIHHRLFREACYNYEG-NYI 344

Query: 309 KDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
           K+LS I +  L++III+DNSP SY  +  +AI +  W S
Sbjct: 345 KNLSQIGRP-LSDIIILDNSPASYIFHPQHAIPISSWFS 382

>KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 409

 Score = 94.4 bits (233), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 62/159 (38%), Positives = 84/159 (52%), Gaps = 10/159 (6%)

Query: 189 LIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKR 248
           L+P        KK LVLDLDETL+H                VE+   V  +    +V KR
Sbjct: 228 LLPVKTEQFSGKKCLVLDLDETLVHSSFKFLRTADFVI--PVEIDNQVHNV----YVIKR 281

Query: 249 PYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYI 308
           P  D FL  V + Y +VVFTAS+  Y DP++D L+ +       RL+R  C   DG  YI
Sbjct: 282 PGVDDFLRLVGQLYEVVVFTASVSRYGDPLLDVLDQNH--CIHHRLFRDSCYNYDG-NYI 338

Query: 309 KDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
           K+LS I +  L+++II+DNSP SY  +  +AI +  W S
Sbjct: 339 KNLSQIGRP-LSDLIILDNSPASYIFHPQHAIPISSWFS 376

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 94.0 bits (232), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 88/159 (55%), Gaps = 10/159 (6%)

Query: 189 LIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKR 248
           L+P    + + KK L+LDLDETL+H                VE+   V  +    +V KR
Sbjct: 234 LLPPPDKSIKDKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHNV----YVIKR 287

Query: 249 PYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYI 308
           P  + FL +V K + +VVFTAS+  Y DP++D L++        RL+R+ C   +G  YI
Sbjct: 288 PGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDT--DKVIHHRLFREACYNYEG-NYI 344

Query: 309 KDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
           K+LS I +  L+EIII+DNSP SY  +  +AI +  W S
Sbjct: 345 KNLSQIGRP-LSEIIILDNSPASYIFHPQHAIPISSWFS 382

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 94.4 bits (233), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 86/159 (54%), Gaps = 10/159 (6%)

Query: 189 LIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKR 248
           L+P    +   KK LVLDLDETL+H                V++   +  +    +V KR
Sbjct: 301 LLPPQSKHLSGKKCLVLDLDETLVHSSFKYLKGADFVL--PVDIDDQIHNV----YVMKR 354

Query: 249 PYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYI 308
           P  D FL KV   + +V+FTAS+  Y DP++D L+     S   RL+R+ C   +G  YI
Sbjct: 355 PGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILDK--HKSVHHRLFREACYNYEG-NYI 411

Query: 309 KDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
           K+LS I +  L+EIII+DNSP SY  +  +AI +  W S
Sbjct: 412 KNLSQIGRP-LSEIIILDNSPASYIFHPQHAIPISSWFS 449

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 93.6 bits (231), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 87/164 (53%), Gaps = 20/164 (12%)

Query: 189 LIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAV-----SGISSLY 243
           L+P        KK LVLDLDETL+H              ++    F +       I ++Y
Sbjct: 272 LLPPRAPAFNGKKCLVLDLDETLVHSSFK----------YLRTADFVLPVDIDDQIHNVY 321

Query: 244 FVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRD 303
            + KRP  D FL +V   Y +VVFTAS+  Y DP++D L+     +   RL+R+ C   +
Sbjct: 322 VI-KRPGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILDK--HKTIHHRLFRESCYNYE 378

Query: 304 GVGYIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
           G  YIK+LS I  + L++III+DNSP SY  +  +AI +  W S
Sbjct: 379 G-NYIKNLSQIG-RPLSDIIILDNSPASYIFHPQHAIPISSWFS 420

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 93.6 bits (231), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 60/164 (36%), Positives = 90/164 (54%), Gaps = 20/164 (12%)

Query: 189 LIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAV-----SGISSLY 243
           L+P    +  +KK LVLDLDETL+H              ++    F +       I ++Y
Sbjct: 302 LLPPPEKSLSRKKCLVLDLDETLVHSSFK----------YLKSADFVLPVDIDDQIHNVY 351

Query: 244 FVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRD 303
            + KRP  D FL +V + + +VVFTAS+  Y DP++D L+     S   RL+R+ C   +
Sbjct: 352 VI-KRPGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLDK--GKSIHHRLFREACYNYE 408

Query: 304 GVGYIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
           G  YIK+LS + +  L++III+DNSP SY  +  +AI +  W S
Sbjct: 409 G-NYIKNLSQLGRP-LSDIIILDNSPASYIFHPQHAIPISSWFS 450

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score = 94.0 bits (232), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 58/153 (37%), Positives = 84/153 (54%), Gaps = 20/153 (13%)

Query: 200 KKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAV-----SGISSLYFVHKRPYCDLF 254
           KK L+LDLDETL+H              ++    F +       I ++Y + KRP  D F
Sbjct: 518 KKCLILDLDETLVHSSFK----------YLTSADFVIPVDIDEQIHNVYVI-KRPGVDQF 566

Query: 255 LSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYIKDLSLI 314
           L  V+K + +VVFTAS+  Y DP++D L+         RL+R+ C   +G  YIK+LS I
Sbjct: 567 LETVSKIFEVVVFTASVSRYGDPLLDVLDK--HRCIHHRLFREACYDYEG-NYIKNLSQI 623

Query: 315 SKKSLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
            +  L+E+II+DNSP SY  +  +AI +  W S
Sbjct: 624 GRP-LSELIILDNSPASYIFHPQHAIPISSWFS 655

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 92.4 bits (228), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 59/148 (39%), Positives = 81/148 (54%), Gaps = 10/148 (6%)

Query: 200 KKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKRPYCDLFLSKVA 259
           KK LVLDLDETL+H                VE+   +  +    +V KRP  D FL  V 
Sbjct: 240 KKCLVLDLDETLVHSSFKFLRTADFVI--PVEIDNQIHNV----YVIKRPGVDEFLKLVG 293

Query: 260 KWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYIKDLSLISKKSL 319
           + Y +VVFTAS+  Y DP++D L+   +     RL+R  C   DG  YIK+LS I +  L
Sbjct: 294 QLYEVVVFTASVSRYGDPLLDVLDQ--TQCIHHRLFRDSCYNYDG-NYIKNLSQIGRP-L 349

Query: 320 NEIIIVDNSPISYAMNVDNAIQVEGWIS 347
           +++II+DNSP SY  +  +AI +  W S
Sbjct: 350 SDLIILDNSPASYIFHPQHAIPISSWFS 377

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 92.4 bits (228), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 82/148 (55%), Gaps = 10/148 (6%)

Query: 200 KKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKRPYCDLFLSKVA 259
           KK LVLDLDETL+H                VE+   V  +    +V KRP  D FL ++ 
Sbjct: 244 KKCLVLDLDETLVHSSFKYLRTADFVIP--VEIDNQVHNV----YVIKRPGVDEFLRRIT 297

Query: 260 KWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYIKDLSLISKKSL 319
           + Y +VVFTAS+  Y DP++D L+     +   RL+R  C   +G  YIK+LS I +  L
Sbjct: 298 ELYEVVVFTASVSRYGDPLLDILDK--DKTIHHRLFRDSCYNYEG-NYIKNLSQIGRP-L 353

Query: 320 NEIIIVDNSPISYAMNVDNAIQVEGWIS 347
           +++II+DNSP SY  +  +AI +  W S
Sbjct: 354 SDMIILDNSPASYIFHPQHAIPISSWFS 381

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 92.8 bits (229), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 86/161 (53%), Gaps = 10/161 (6%)

Query: 187 KKLIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVH 246
           + L+P       ++K LVLDLDETL+H                VE+   V  +    +V 
Sbjct: 309 RTLLPPQFPQFYRRKCLVLDLDETLVHSSFKYLHTADFVI--PVEIDNQVHNV----YVI 362

Query: 247 KRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVG 306
           KRP  D FL +V + Y +VVFTAS+  Y DP++D L+         RL+R  C   +G  
Sbjct: 363 KRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILDK--HNVVHHRLFRDSCYNYEG-N 419

Query: 307 YIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
           YIK+LS I +  L+++II+DNSP SY  +  +AI +  W S
Sbjct: 420 YIKNLSQIGRP-LSDLIILDNSPASYIFHPHHAIPISSWFS 459

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 89.7 bits (221), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 85/159 (53%), Gaps = 10/159 (6%)

Query: 189 LIPQSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKR 248
           L+P        +K LVLDLDETL+H                VE+   V  +    +V KR
Sbjct: 297 LLPPQRPEFRGRKCLVLDLDETLVHSSFKYLHTADFVI--PVEIDNQVHNV----YVIKR 350

Query: 249 PYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYI 308
           P  D FL +V + + +VVFTAS+  Y DP++D L+     +   RL+R  C   +G  YI
Sbjct: 351 PGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILDQ--YKAVHHRLFRDSCYNYEG-NYI 407

Query: 309 KDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
           K+LS I +  L+++II+DNSP SY  +  +A+ +  W S
Sbjct: 408 KNLSQIGRP-LSDLIILDNSPASYIFHPQHAVPISSWFS 445

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 88.6 bits (218), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 88/150 (58%), Gaps = 9/150 (6%)

Query: 198 EKKKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKRPYCDLFLSK 257
           + +K LVLDLDETL+H                ++ +F      ++Y + KRP  D FL  
Sbjct: 177 QNRKCLVLDLDETLVHSSFKYVSTADFVLPVDIDDQF-----QNVYVI-KRPGVDAFLQY 230

Query: 258 VAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYIKDLSLISKK 317
            +K + +V+FTAS+++Y +P++D L+S+ +     RL+R  C   +G  YIK+L+ + + 
Sbjct: 231 TSKLFEVVIFTASVEKYGNPLLDILDST-NDLVHHRLFRDACYNYNG-NYIKNLAQLGRP 288

Query: 318 SLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
            L++III+DNSP SY  + ++AI +  W S
Sbjct: 289 -LSDIIILDNSPTSYLFHPNHAIPISSWFS 317

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 84/153 (54%), Gaps = 19/153 (12%)

Query: 200 KKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAV-----SGISSLYFVHKRPYCDLF 254
           KK LVLDLDETL+H              ++    F +       I ++Y + KRP  + F
Sbjct: 302 KKCLVLDLDETLVHSSFK----------YLQTADFVLPVNIDEQIHNVYVI-KRPGVEEF 350

Query: 255 LSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYIKDLSLI 314
           L +V + + +VVFTAS+  Y DP++D L+         RL+R+ C   +G  YIK+LS +
Sbjct: 351 LKRVGELFEVVVFTASVARYGDPLLDILDPGRQ-LIHHRLFREACYNYEG-NYIKNLSQM 408

Query: 315 SKKSLNEIIIVDNSPISYAMNVDNAIQVEGWIS 347
             + L+EIII+DNSP SY  +  +AI +  W S
Sbjct: 409 G-RPLSEIIILDNSPASYIFHPQHAIPISSWFS 440

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 79/148 (53%), Gaps = 10/148 (6%)

Query: 200 KKILVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFAVSGISSLYFVHKRPYCDLFLSKVA 259
           +K LVLDLDETL+H                V++   V  +    +V KRP  D FL  V 
Sbjct: 282 RKCLVLDLDETLVHSSFKYLNIADFVL--PVDIDNQVQNV----YVSKRPGVDEFLKIVG 335

Query: 260 KWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYIKDLSLISKKSL 319
             Y ++VFTAS+  Y +P++D L+         RL+R  C + +G  Y+K+LS I +  L
Sbjct: 336 DLYEVIVFTASVSRYGNPLMDILDP--HKYIHHRLFRDSCYVYEG-NYVKNLSQIGRP-L 391

Query: 320 NEIIIVDNSPISYAMNVDNAIQVEGWIS 347
            +III+DNSP SY  +  +AI +  W S
Sbjct: 392 GDIIILDNSPASYIFHPQHAIPISSWFS 419

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 64/99 (64%), Gaps = 3/99 (3%)

Query: 247 KRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVG 306
           KRP  D FL  ++++Y +V+F+++   Y+D + + L+       S  L+++ C+ +DGV 
Sbjct: 217 KRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDP-IHAFVSYNLFKEHCVYKDGV- 274

Query: 307 YIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGW 345
           +IKDLS +++  L+++II+D  P SY +  +NAI +E W
Sbjct: 275 HIKDLSKLNR-DLSKVIIIDTDPNSYKLQPENAIPMEPW 312

>TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.527
           YPL063W
          Length = 477

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 63/99 (63%), Gaps = 3/99 (3%)

Query: 247 KRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVG 306
           KRP CD FL  ++++Y +V+F+++   YA+ + + L+       S  L+++ C+ +DGV 
Sbjct: 208 KRPGCDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLD-PIHAFVSYNLFKEHCVYKDGV- 265

Query: 307 YIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGW 345
           +IKD+S ++ + L +++ +D  P +Y +  +NAI ++ W
Sbjct: 266 HIKDISKLN-RDLGKVVTIDTDPNTYKLQPENAIPMDPW 303

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 64/99 (64%), Gaps = 3/99 (3%)

Query: 247 KRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVG 306
           KRP  D FL  +++++ +V+F+++   Y+D + + L+       S  L+++ C+ +DGV 
Sbjct: 217 KRPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLDP-IHAFVSYNLFKEHCVYKDGV- 274

Query: 307 YIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGW 345
           +IKDLS +++  L+++II+D  P SY +  +NAI ++ W
Sbjct: 275 HIKDLSKLNR-DLSKVIIIDTEPNSYKLQPENAIPMDPW 312

>NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527
          Length = 491

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 63/99 (63%), Gaps = 3/99 (3%)

Query: 247 KRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVG 306
           KRP  D FL  ++++Y +V+F+++   Y + + + L+       S  L+++ C+ +DGV 
Sbjct: 228 KRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLDP-LHAFISYNLFKEHCVYKDGV- 285

Query: 307 YIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGW 345
           +IKDLS +++  +N+++I+D  P +Y +  +NAI V+ W
Sbjct: 286 HIKDLSKLNR-DVNKVLIIDTEPNNYKLQPENAIPVKPW 323

>SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 478

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 62/99 (62%), Gaps = 3/99 (3%)

Query: 247 KRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVG 306
           KRP  D FL  ++++Y +V+F+++   YA+ V + ++       +  LY++ C+ +DGV 
Sbjct: 216 KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKVAEKMD-PIHAFVTYNLYKEHCLYKDGV- 273

Query: 307 YIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGW 345
           +IKDLS ++ + L + +I+D  P SY +  +NAI V+ W
Sbjct: 274 HIKDLSKLN-RDLGKTMIIDTDPNSYKLQPENAIPVKPW 311

>NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 63/99 (63%), Gaps = 3/99 (3%)

Query: 247 KRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVG 306
           KRP  D FL  ++++Y +V+F+++   Y + + + L+       S  L+++ C+ +DGV 
Sbjct: 236 KRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLDP-LHAFISYSLFKEHCVYKDGV- 293

Query: 307 YIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGW 345
           +IKDLS +++  +N+++I+D  P +Y +  +NAI +E W
Sbjct: 294 HIKDLSKLNR-DVNKVLIIDTDPNNYKLQPENAIPMEPW 331

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 64/99 (64%), Gaps = 3/99 (3%)

Query: 247 KRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVG 306
           KRP  D FL  +++++ +V+F+++   Y++ + + L+       S  L+++ C+ +DGV 
Sbjct: 222 KRPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAEKLDP-IHAFVSYNLFKEHCVYKDGV- 279

Query: 307 YIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGW 345
           +IKDLS +++  L+++II+D  P SY +  +NAI +E W
Sbjct: 280 HIKDLSKLNR-DLSKVIIIDTDPNSYKLQPENAIPMEPW 317

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 63/99 (63%), Gaps = 3/99 (3%)

Query: 247 KRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVG 306
           KRP  + FL  ++++Y +V+F+++   Y++   + L+       S  L+++ C+ +DGV 
Sbjct: 220 KRPGAEYFLGYLSQYYEIVLFSSNYMMYSEKTAEKLDP-IHAFVSYNLFKEHCVYKDGV- 277

Query: 307 YIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGW 345
           +IKDLS + K+ L+++II+D  P SY +  +NAI ++ W
Sbjct: 278 HIKDLSKL-KRDLSKVIIIDTDPNSYKLQPENAIPMDPW 315

>Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON}
           complement(11098..12567) [1470 nt, 490 aa]
          Length = 489

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 62/99 (62%), Gaps = 3/99 (3%)

Query: 247 KRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVG 306
           KRP  D FL  ++++Y +V+F+++   Y++ + + L+       S  LY++ C+ ++G  
Sbjct: 226 KRPGVDYFLGYLSQYYEVVLFSSNYMMYSEKIAEKLDP-IHAFISYNLYKEHCVYKEG-D 283

Query: 307 YIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGW 345
           +IKDLS +++  L ++IIVD  P SY +  +NAI ++ W
Sbjct: 284 HIKDLSKLNR-DLGKVIIVDTDPASYKLQPENAIPMQPW 321

>KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 476

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 61/99 (61%), Gaps = 3/99 (3%)

Query: 247 KRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVG 306
           KRP  D FL  ++++Y +V+F+++   Y+D V + L+       +  L+++ C+ +DGV 
Sbjct: 213 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLD-PIHAFITYNLFKEHCLYKDGV- 270

Query: 307 YIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGW 345
           +IKDLS ++ + L + IIVD  P +Y +  +NAI +  W
Sbjct: 271 HIKDLSKLN-RDLGKTIIVDCDPNAYKLQPENAIPMRPW 308

>ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 489

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 61/99 (61%), Gaps = 3/99 (3%)

Query: 247 KRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVG 306
           KRP CD FL  ++++Y +V+F+++   Y+D + + L+       S  L+++ C+ +DG+ 
Sbjct: 221 KRPGCDYFLGYLSQYYEIVLFSSNYMMYSDRICEKLD-PIHAFISYNLFKEHCVYKDGI- 278

Query: 307 YIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGW 345
           +IKD+S ++ + + +++++D  P  Y    +NAI  + W
Sbjct: 279 HIKDISKMN-RDVGKVVMIDTDPNCYKSQPENAIPAKPW 316

>Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]
           {ON} YPL063W - Protein required for cell viability
           [contig 26] FULL
          Length = 474

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 62/99 (62%), Gaps = 3/99 (3%)

Query: 247 KRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVG 306
           KRP  D FL  ++++Y +V+F+++   Y+D V + L+       +  L+++ C+ +DGV 
Sbjct: 212 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLD-PIHAFITYNLFKEHCLYKDGV- 269

Query: 307 YIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGW 345
           +IKDLS ++ + L + +I+D  P +Y +  +NAI ++ W
Sbjct: 270 HIKDLSKLN-RDLGKTVIIDCDPNAYKLQPENAIPMKPW 307

>CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063w
          Length = 485

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 62/99 (62%), Gaps = 3/99 (3%)

Query: 247 KRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVG 306
           KRP  D FL  ++++Y +V+F+++   YA+ + + ++       S  L+++ C+ +DGV 
Sbjct: 223 KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKIAEKMD-PIHAFISYNLFKEHCVYKDGV- 280

Query: 307 YIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGW 345
           +IKDLS ++ + L +++I+D    SY +  +NAI ++ W
Sbjct: 281 HIKDLSKLN-RDLKKVMIIDTDENSYKLQPENAIPMDPW 318

>TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {ON}
           Anc_8.527 YPL063W
          Length = 485

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 62/99 (62%), Gaps = 3/99 (3%)

Query: 247 KRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVG 306
           KRP  D FL  ++++Y +V+F+++   Y+D + + L+       S  L+++ C+ +DGV 
Sbjct: 221 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDRIAEKLD-PIHAFVSYNLFKEHCLYKDGV- 278

Query: 307 YIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGW 345
           +IKDLS +++    +++I+D  P SY +  +NAI ++ W
Sbjct: 279 HIKDLSKLNRDE-KKVLIIDVDPNSYKLQPENAIPMKPW 316

>TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.527
           YPL063W
          Length = 478

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 62/99 (62%), Gaps = 3/99 (3%)

Query: 247 KRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVG 306
           KRP  D FL  ++++Y +V+F+++   Y++ + + L+       S  LY++ C+ ++G  
Sbjct: 217 KRPGTDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLD-PIHAFVSYNLYKEHCVYKEGT- 274

Query: 307 YIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGW 345
           +IKDLS ++ + L++++I+D  P +Y    +NAI V+ W
Sbjct: 275 HIKDLSKLN-RDLDKVLIIDCDPNNYKFQPENAIPVKPW 312

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 62/99 (62%), Gaps = 3/99 (3%)

Query: 247 KRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVG 306
           KRP  D FL  ++++Y +V+F+++   YA+ + + L+       +  L+++ C+ +DGV 
Sbjct: 220 KRPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLD-PIHAFITYNLFKEHCLYKDGV- 277

Query: 307 YIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGW 345
           +IKDLS ++ + L +++I+D    S+ +  +NAI +E W
Sbjct: 278 HIKDLSKLN-RDLGKVLIIDTDENSFKLQPENAIYLEPW 315

>Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar to
           Ashbya gossypii ADR045W
          Length = 490

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 247 KRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVG 306
           KRP  D FL  ++++Y +V+F+++   +++ + + L+       +  L+++ C+ +DG+ 
Sbjct: 227 KRPGADYFLGYLSQYYEIVLFSSNYMMHSEKIAEKLD-PIHAFITYNLFKEHCVYKDGI- 284

Query: 307 YIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGW 345
           +IKDLS ++ + L + II+D    ++ +  +NAI  E W
Sbjct: 285 HIKDLSHLN-RDLGKTIIIDTDANAFKLQPENAIHAEPW 322

>KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.527
           YPL063W
          Length = 448

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 61/99 (61%), Gaps = 3/99 (3%)

Query: 247 KRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVG 306
           KRP  D FL  ++++Y +V+F+++   Y++ + + L+       S  L+++ C+ + G  
Sbjct: 191 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLD-PIHAFISYNLFKEHCVYKKG-K 248

Query: 307 YIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGW 345
           +IKDLS ++ + +N++II+D    +Y +  +NAI ++ W
Sbjct: 249 HIKDLSKLN-RDVNKVIIIDTDKNNYKLQPENAIPMKPW 286

>ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL063W
          Length = 476

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 55/98 (56%), Gaps = 3/98 (3%)

Query: 248 RPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGY 307
           RP  D  L  ++ +Y  V+F ++   Y+  V++ L+       +  L++  C+ +DG+ +
Sbjct: 217 RPGADYLLGYLSDYYENVLFPSNYMVYSKKVVEKLDP-IRAFITYNLFKDHCVYKDGI-H 274

Query: 308 IKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGW 345
           IKDLS +++  L + +I+D  P S  + ++NAI  E W
Sbjct: 275 IKDLSHLNR-DLGKTLIIDTDPNSVKLQMENAILAEPW 311

>KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.527
           YPL063W
          Length = 450

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 247 KRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVG 306
           KRP  D FL  ++++Y +V+F+++   Y++ + + L+       S  L+++ C+ +D V 
Sbjct: 211 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSERIAEKLD-PLHAFISYNLFKEHCVYKDHV- 268

Query: 307 YIKDLSLISKKSLNEIIIVDNSPISYAMNVDNAIQVEGW 345
           +IKDLS ++ + + +++I+D    SY +  +NA+ +  W
Sbjct: 269 HIKDLSKLN-RDVRKVVIMDTDANSYKLQPENALPMAPW 306

>KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.839
           YMR277W
          Length = 724

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 41/103 (39%), Gaps = 22/103 (21%)

Query: 195 LNNEKKKILVLDLDETLIHXXXXXX-------------XXXXXXQGHMVE----VKFAVS 237
           L NEKK +LV+DLD+T+IH                         Q   +E    + F   
Sbjct: 164 LRNEKKLVLVVDLDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYM 223

Query: 238 GI-----SSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYA 275
           G         Y+V  RP    F  KVA  + + ++T + + YA
Sbjct: 224 GPKPTPRKCWYYVKVRPGLKEFFKKVAPLFEMHIYTMATRAYA 266

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 43/103 (41%), Gaps = 22/103 (21%)

Query: 195 LNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGH------MVEVK-FAVSGISSL----- 242
           L NEKK +LV+DLD+T+IH                     + +VK F++     L     
Sbjct: 162 LKNEKKLVLVVDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYM 221

Query: 243 ----------YFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYA 275
                     Y+V  RP    F  K+A  Y + ++T + + YA
Sbjct: 222 GPKPPVRTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYA 264

>TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {ON}
           Anc_8.661 YPL147W
          Length = 915

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 39/87 (44%), Gaps = 14/87 (16%)

Query: 254 FLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYIKDLSL 313
           F+  +  W+ L+ F AS   Y +  I  L+   S +F   L R          YI DL L
Sbjct: 266 FIVDIGYWF-LIAFPAS---YTNAAIKLLQRKLSLNFRVNLTR----------YIHDLYL 311

Query: 314 ISKKSLNEIIIVDNSPISYAMNVDNAI 340
             K S  +II   N+  S   N+DN+I
Sbjct: 312 DKKLSFYKIIFDYNANSSIIKNIDNSI 338

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 66/158 (41%), Gaps = 26/158 (16%)

Query: 192 QSVLNNEKKKILVLDLDETLIHXXXXXXXXXXXXQGH------MVEVK-FAVSGISSL-- 242
           ++ L  EKK +LV+DLD+T+IH                     + +VK F++     L  
Sbjct: 160 RTRLRKEKKLVLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPT 219

Query: 243 -------------YFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGS 289
                        Y+V  RP    FL K+A  + + ++T + + YA  +   ++ +    
Sbjct: 220 LYMGPKPPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPN-GDL 278

Query: 290 FSQRLYRQDCILRDGVGYIKDLSLISKKSLNEIIIVDN 327
           F  R+  +D    +G    K L  +     + +I++D+
Sbjct: 279 FGDRILSRD---ENGSMTTKSLERLFPTDQSMVIVIDD 313

>ZYRO0D09108g Chr4 (782402..783634) [1233 bp, 410 aa] {ON} similar
           to uniprot|O59832 Schizosaccharomyces pombe SPCC965
           SPCC965.12 protein
          Length = 410

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 49/112 (43%), Gaps = 13/112 (11%)

Query: 226 QGHMVEVKFAVSGISSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYAD-PVIDWLES 284
            G  + +   + G+           CDL L+ + ++Y L V   ++    D P      S
Sbjct: 128 HGQSISITLGIEGLHQ---------CDLSLAVLRQYYRLGVRYITLTHNCDNPFATAASS 178

Query: 285 SFSGSFSQRL--YRQDCILR-DGVGYIKDLSLISKKSLNEIIIVDNSPISYA 333
             +G     L  Y  DCI   + +G I DLS +S K++ + + V  +P+ ++
Sbjct: 179 IAAGKPDHGLTCYGVDCIKEMNRLGLIVDLSHVSHKTMVDTLKVTRAPVIFS 230

>TDEL0D04690 Chr4 (861474..863987) [2514 bp, 837 aa] {ON} Anc_3.153
           YDL040C
          Length = 837

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 262 YTLVVFTASMKEYADPVIDWLESSFS-GSFSQRLYRQDCILRDGVGYIKDLSLISKK 317
           + L ++  + K+YA+ V  W ++S + GS +Q++YR    L+  +G +K  +L+S+K
Sbjct: 84  HVLGIYMRTTKKYAESV-KWFQASLNNGSTNQQIYRDLATLQSQIGDLKG-ALVSRK 138

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 243 YFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQD 298
           Y+V  RP    F  KVA  Y + ++T + + YA+ +   ++   S  F  R+  +D
Sbjct: 232 YYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGS-LFGNRILSRD 286

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,331,553
Number of extensions: 1349163
Number of successful extensions: 5563
Number of sequences better than 10.0: 82
Number of HSP's gapped: 5542
Number of HSP's successfully gapped: 85
Length of query: 385
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 274
Effective length of database: 40,753,473
Effective search space: 11166451602
Effective search space used: 11166451602
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)