Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0A09394gna 1ON79779741790.0
Smik_10.20na 2ON79979331970.0
Kwal_26.7996na 1ON78272931870.0
YJL212C (OPT1)na 2ON79979931860.0
Suva_6.290na 2ON80179731750.0
KLLA0E00397gsingletonON79376931720.0
Skud_10.5na 2ON79977531660.0
KLTH0D06754gna 1ON82772631650.0
TDEL0C00130singletonON79272931070.0
ZYRO0D00330gna 3ON79872830510.0
KNAG0G02310singletonON79079429490.0
SAKL0G15224gsingletonON80576314390.0
KLTH0E01496gna 3ON81477014250.0
KLLA0E00419gna 3ON79481714230.0
SAKL0F14674gna 3ON80580114210.0
Kwal_55.19788na 3ON81077213871e-180
Ecym_7185na 3ON80075712811e-164
ABR156Wna 3ON79676712561e-161
ZYRO0G22484gsingletonON8216878461e-100
ZYRO0C18568gsingletonON8217858351e-98
YPR194C (OPT2)na 4ON8777728345e-98
TPHA0C05020singletonON8967298331e-97
SAKL0D09350gna 5ON8877258242e-96
Kpol_455.13na 4ON8927718129e-95
Skud_16.498na 4ON8777708092e-94
KLLA0D15378gsingletonON8697808083e-94
ZYRO0D13332gsingletonON8897998059e-94
Kwal_55.19561singletonON8827268031e-93
ZYRO0D09922gsingletonON9228088042e-93
Suva_16.526na 4ON8777697942e-92
Ecym_2739na 5ON8677337802e-90
ADL399CsingletonON8857487559e-87
ACL205CsingletonON8907517374e-84
AGL027WsingletonON8777316988e-79
Smik_16.458na 4ON8556376961e-78
ZYRO0D17974gsingletonON7767914373e-44
CAGL0G00352g5.17ON291132940.009
KLTH0C02046g5.113ON2005100840.25
NDAI0I014906.137ON739100830.33
ZYRO0C14630g6.137ON717101800.58
Smik_4.877.327ON81081781.2
ZYRO0G16236g5.282ON50783771.3
TDEL0A017106.137ON71594771.6
NCAS0D033506.137ON73194761.9
SAKL0A06468g6.137ON732100752.5
ADL080W7.233ON863104735.0
NDAI0G048301.462ON84650718.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0A09394g
         (797 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0A09394g Chr1 complement(817374..819767) [2394 bp, 797 aa] {...  1614   0.0  
Smik_10.20 Chr10 complement(32201..34600) [2400 bp, 799 aa] {ON}...  1236   0.0  
Kwal_26.7996 s26 complement(604470..606818) [2349 bp, 782 aa] {O...  1232   0.0  
YJL212C Chr10 complement(33850..36249) [2400 bp, 799 aa] {ON}  O...  1231   0.0  
Suva_6.290 Chr6 (513382..515787) [2406 bp, 801 aa] {ON} YJL212C ...  1227   0.0  
KLLA0E00397g Chr5 (23256..25637) [2382 bp, 793 aa] {ON} highly s...  1226   0.0  
Skud_10.5 Chr10 complement(7830..10229) [2400 bp, 799 aa] {ON}  ...  1224   0.0  
KLTH0D06754g Chr4 complement(588021..590504) [2484 bp, 827 aa] {...  1223   0.0  
TDEL0C00130 Chr3 complement(9763..12141) [2379 bp, 792 aa] {ON}      1201   0.0  
ZYRO0D00330g Chr4 complement(22470..24866) [2397 bp, 798 aa] {ON...  1179   0.0  
KNAG0G02310 Chr7 complement(530112..532484) [2373 bp, 790 aa] {O...  1140   0.0  
SAKL0G15224g Chr7 complement(1311409..1313826) [2418 bp, 805 aa]...   558   0.0  
KLTH0E01496g Chr5 complement(146000..148444) [2445 bp, 814 aa] {...   553   0.0  
KLLA0E00419g Chr5 (28957..31341) [2385 bp, 794 aa] {ON} similar ...   552   0.0  
SAKL0F14674g Chr6 complement(1170374..1172791) [2418 bp, 805 aa]...   551   0.0  
Kwal_55.19788 s55 complement(125184..127616) [2433 bp, 810 aa] {...   538   e-180
Ecym_7185 Chr7 (379870..382272) [2403 bp, 800 aa] {ON} similar t...   498   e-164
ABR156W Chr2 (692938..695328) [2391 bp, 796 aa] {ON} Non-synteni...   488   e-161
ZYRO0G22484g Chr7 (1848658..1851123) [2466 bp, 821 aa] {ON} simi...   330   e-100
ZYRO0C18568g Chr3 (1457201..1459666) [2466 bp, 821 aa] {ON} simi...   326   1e-98
YPR194C Chr16 complement(924304..926937) [2634 bp, 877 aa] {ON} ...   325   5e-98
TPHA0C05020 Chr3 (1085361..1088051) [2691 bp, 896 aa] {ON}            325   1e-97
SAKL0D09350g Chr4 (775699..778362) [2664 bp, 887 aa] {ON} simila...   322   2e-96
Kpol_455.13 s455 (24582..27260) [2679 bp, 892 aa] {ON} (24582..2...   317   9e-95
Skud_16.498 Chr16 complement(866362..868995) [2634 bp, 877 aa] {...   316   2e-94
KLLA0D15378g Chr4 complement(1303787..1306396) [2610 bp, 869 aa]...   315   3e-94
ZYRO0D13332g Chr4 complement(1121064..1123733) [2670 bp, 889 aa]...   314   9e-94
Kwal_55.19561 s55 complement(25934..28582) [2649 bp, 882 aa] {ON...   313   1e-93
ZYRO0D09922g Chr4 (837954..840722) [2769 bp, 922 aa] {ON} simila...   314   2e-93
Suva_16.526 Chr16 complement(906594..909227) [2634 bp, 877 aa] {...   310   2e-92
Ecym_2739 Chr2 complement(1430077..1432680) [2604 bp, 867 aa] {O...   305   2e-90
ADL399C Chr4 complement(3872..6529) [2658 bp, 885 aa] {ON} Non-s...   295   9e-87
ACL205C Chr3 complement(1169..3841) [2673 bp, 890 aa] {ON} Non-s...   288   4e-84
AGL027W Chr7 (657958..660591) [2634 bp, 877 aa] {ON} Non-synteni...   273   8e-79
Smik_16.458 Chr16 complement(787205..789133,789181..789306,78932...   272   1e-78
ZYRO0D17974g Chr4 complement(1492455..1494785) [2331 bp, 776 aa]...   172   3e-44
CAGL0G00352g Chr7 (35994..36869) [876 bp, 291 aa] {ON} similar t...    41   0.009
KLTH0C02046g Chr3 complement(180744..186761) [6018 bp, 2005 aa] ...    37   0.25 
NDAI0I01490 Chr9 complement(351987..354206) [2220 bp, 739 aa] {O...    37   0.33 
ZYRO0C14630g Chr3 (1139589..1141742) [2154 bp, 717 aa] {ON} simi...    35   0.58 
Smik_4.87 Chr4 complement(165012..167444) [2433 bp, 810 aa] {ON}...    35   1.2  
ZYRO0G16236g Chr7 complement(1332425..1333948) [1524 bp, 507 aa]...    34   1.3  
TDEL0A01710 Chr1 complement(306168..308315) [2148 bp, 715 aa] {O...    34   1.6  
NCAS0D03350 Chr4 (626765..628960) [2196 bp, 731 aa] {ON} Anc_6.137     34   1.9  
SAKL0A06468g Chr1 complement(580333..582531) [2199 bp, 732 aa] {...    33   2.5  
ADL080W Chr4 (542121..544712) [2592 bp, 863 aa] {ON} Syntenic ho...    33   5.0  
NDAI0G04830 Chr7 (1162561..1165101) [2541 bp, 846 aa] {ON} Anc_1...    32   8.1  

>SAKL0A09394g Chr1 complement(817374..819767) [2394 bp, 797 aa] {ON}
           highly similar to uniprot|P40897 Saccharomyces
           cerevisiae YJL212C OPT1 Plasma membrane transporter that
           transports tetra- and pentapeptides and glutathione
           member of the OPT family
          Length = 797

 Score = 1614 bits (4179), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 785/797 (98%), Positives = 785/797 (98%)

Query: 1   MSYKQEKNFEKFERTSTSSLEQTVPLDTGKVSYVPNPEFEQERQIVKTLSATIDLEDPSE 60
           MSYKQEKNFEKFERTSTSSLEQTVPLDTGKVSYVPNPEFEQERQIVKTLSATIDLEDPSE
Sbjct: 1   MSYKQEKNFEKFERTSTSSLEQTVPLDTGKVSYVPNPEFEQERQIVKTLSATIDLEDPSE 60

Query: 61  KGSLLQDQDDAIWEGDPTYLPNSPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAG 120
           KGSLLQDQDDAIWEGDPTYLPNSPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAG
Sbjct: 61  KGSLLQDQDDAIWEGDPTYLPNSPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAG 120

Query: 121 VNQFFSLRYPSLSINFIVAQVICYPIGKILATLPDWKCKRVPFFDLNPGPFTKKEHAVVT 180
           VNQFFSLRYPSLSINFIVAQVICYPIGKILATLPDWKCKRVPFFDLNPGPFTKKEHAVVT
Sbjct: 121 VNQFFSLRYPSLSINFIVAQVICYPIGKILATLPDWKCKRVPFFDLNPGPFTKKEHAVVT 180

Query: 181 IAVALTSSTAYAMNILIAQTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASC 240
           IAVALTSSTAYAMNILIAQTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASC
Sbjct: 181 IAVALTSSTAYAMNILIAQTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASC 240

Query: 241 VWPQTLISVSLFDALHSGKIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYF 300
           VWPQTLISVSLFDALHSGKIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYF
Sbjct: 241 VWPQTLISVSLFDALHSGKIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYF 300

Query: 301 NFILWGPKTRHNFIANAIFGVESGLGAIPITFDYTQISQAMTGSVFATPFWVSANTYASX 360
           NFILWGPKTRHNFIANAIFGVESGLGAIPITFDYTQISQAMTGSVFATPFWVSANTYAS 
Sbjct: 301 NFILWGPKTRHNFIANAIFGVESGLGAIPITFDYTQISQAMTGSVFATPFWVSANTYASV 360

Query: 361 XXXXXXXXXXXYFTNTWYAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSPL 420
                      YFTNTWYAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSPL
Sbjct: 361 LLFFVVILPILYFTNTWYAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSPL 420

Query: 421 YVPFSYLLSYALNFAAVTAVFVHCALYHGKDIISKLRNSNHGGSDIHMRLYSKNYKDCPD 480
           YVPFSYLLSYALNFAAVTAVFVHCALYHGKDIISKLRNSNHGGSDIHMRLYSKNYKDCPD
Sbjct: 421 YVPFSYLLSYALNFAAVTAVFVHCALYHGKDIISKLRNSNHGGSDIHMRLYSKNYKDCPD 480

Query: 481 WWYGALQVVTLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAMTNQHVGLNII 540
           WWYGALQVVTLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAMTNQHVGLNII
Sbjct: 481 WWYGALQVVTLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAMTNQHVGLNII 540

Query: 541 TELVCGYMLPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIYASLI 600
           TELVCGYMLPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIYASLI
Sbjct: 541 TELVCGYMLPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIYASLI 600

Query: 601 SGLVNVGIQEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSLPQYLFSPGRIYNPLM 660
           SGLVNVGIQEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSLPQYLFSPGRIYNPLM
Sbjct: 601 SGLVNVGIQEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSLPQYLFSPGRIYNPLM 660

Query: 661 WFFLIGLVVPFIVFFLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTPYNYSLFFATSFLLN 720
           WFFLIGLVVPFIVFFLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTPYNYSLFFATSFLLN
Sbjct: 661 WFFLIGLVVPFIVFFLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTPYNYSLFFATSFLLN 720

Query: 721 EIRKRWPRWFGKYNFVMGSGVEAGVALSVTIIFLCVQYPGGKVNWWGNSVWKNTYDHQYK 780
           EIRKRWPRWFGKYNFVMGSGVEAGVALSVTIIFLCVQYPGGKVNWWGNSVWKNTYDHQYK
Sbjct: 721 EIRKRWPRWFGKYNFVMGSGVEAGVALSVTIIFLCVQYPGGKVNWWGNSVWKNTYDHQYK 780

Query: 781 KFYHLNKGETFGYDKWW 797
           KFYHLNKGETFGYDKWW
Sbjct: 781 KFYHLNKGETFGYDKWW 797

>Smik_10.20 Chr10 complement(32201..34600) [2400 bp, 799 aa] {ON}
           YJL212C (REAL)
          Length = 799

 Score = 1236 bits (3197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/793 (75%), Positives = 673/793 (84%), Gaps = 14/793 (1%)

Query: 14  RTSTSSLEQTVPL-----DTGKVSYVPNPEFEQERQIVKTLSATIDLED---PSEKGSLL 65
           ++  S    TVP+     D  K S+V + E     + V  L+AT D ED    S+K    
Sbjct: 12  KSEASLSPATVPIYIKVEDEKKNSFVKSTE-----EDVNNLTATTDEEDRDPESQKFDRH 66

Query: 66  QDQDDA-IWEGDPTYLPNSPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQF 124
             Q++  +W+GDPTYLPNSPYPEVRA V   DDPTI LNHWRTWFLTT+FV+VFAGVNQF
Sbjct: 67  SIQEEGLVWKGDPTYLPNSPYPEVRAAVSIEDDPTIRLNHWRTWFLTTIFVVVFAGVNQF 126

Query: 125 FSLRYPSLSINFIVAQVICYPIGKILATLPDWKCKRVPFFDLNPGPFTKKEHAVVTIAVA 184
           FSLRYPSL INF+VAQV+CYPIGK+LA LPDWKC RVPFFDLNPGPFTKKEHAVVTIAVA
Sbjct: 127 FSLRYPSLEINFLVAQVVCYPIGKVLALLPDWKCARVPFFDLNPGPFTKKEHAVVTIAVA 186

Query: 185 LTSSTAYAMNILIAQTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQ 244
           LTSSTAYAM IL AQ +FYNMKL  GYQ LLVWTSQM+GYGAAGL+RRWVVNPAS +WPQ
Sbjct: 187 LTSSTAYAMYILNAQGSFYNMKLNVGYQFLLVWTSQMIGYGAAGLTRRWVVNPASSIWPQ 246

Query: 245 TLISVSLFDALHSGKIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFIL 304
           TLISVSLFD+LHS KI+KT+ NGW+M RYKFFL V + SFVWYW+PGFLFTGLSYFN IL
Sbjct: 247 TLISVSLFDSLHSRKIEKTVANGWTMPRYKFFLIVLIGSFVWYWVPGFLFTGLSYFNVIL 306

Query: 305 WGPKTRHNFIANAIFGVESGLGAIPITFDYTQISQAMTGSVFATPFWVSANTYASXXXXX 364
           WG KTRHNFIAN IFG +SGLGA+PITFDYTQ+SQAM+GSVFATPF+VSANTYAS     
Sbjct: 307 WGSKTRHNFIANTIFGTQSGLGALPITFDYTQVSQAMSGSVFATPFYVSANTYASVLIFF 366

Query: 365 XXXXXXXYFTNTWYAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSPLYVPF 424
                  YFTNTWYAKYMP+IS STYDN Q+ YNVTKILN DFSINLEKYK YSP++VPF
Sbjct: 367 VIVLPCLYFTNTWYAKYMPVISGSTYDNTQHKYNVTKILNEDFSINLEKYKEYSPVFVPF 426

Query: 425 SYLLSYALNFAAVTAVFVHCALYHGKDIISKLRNSNHGGSDIHMRLYSKNYKDCPDWWYG 484
           SYLLSYALNFAAV AVFVHC LYHGKDI++K ++  +GG+DIHMR+YSKNYKDCPDWWY 
Sbjct: 427 SYLLSYALNFAAVIAVFVHCFLYHGKDIVAKFKDRKNGGTDIHMRIYSKNYKDCPDWWYL 486

Query: 485 ALQVVTLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAMTNQHVGLNIITELV 544
           ALQ+V +GLGF  VC +DT FPAWAFVIA+LIS  N +PQGILEAMTNQHVGLNIITEL+
Sbjct: 487 ALQLVMIGLGFVAVCCFDTKFPAWAFVIAILISLVNFIPQGILEAMTNQHVGLNIITELI 546

Query: 545 CGYMLPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIYASLISGLV 604
           CGYMLPL+PMAN+LFKLYGFIVMR GL+LSRDLKLA+YMKVSPRLIFAVQIYA++ISG+V
Sbjct: 547 CGYMLPLRPMANLLFKLYGFIVMRQGLNLSRDLKLAMYMKVSPRLIFAVQIYATIISGMV 606

Query: 605 NVGIQEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSLPQYLFSPGRIYNPLMWFFL 664
           NVG+QEWM HNIDG+C+  Q +GF C+NGRT+FNASIIWSLP+YLFS GRIY+PLMWFFL
Sbjct: 607 NVGVQEWMMHNIDGLCTSDQPNGFTCANGRTVFNASIIWSLPKYLFSSGRIYSPLMWFFL 666

Query: 665 IGLVVPFIVFFLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTPYNYSLFFATSFLLNEIRK 724
           IGL+ P +V+ +Q KFP+ +F K+ H+PVFFTGPGNIPPSTPYNYSLFFA SF LN IRK
Sbjct: 667 IGLLFPLVVYAVQWKFPNFKFAKHIHTPVFFTGPGNIPPSTPYNYSLFFAMSFCLNIIRK 726

Query: 725 RWPRWFGKYNFVMGSGVEAGVALSVTIIFLCVQYPGGKVNWWGNSVWKNTYDHQYKKFYH 784
           RW  WF KYNFVMG+GVEAGVA+SV IIFLCVQYPG K++WWGN+VWK TYD+ YKKFY 
Sbjct: 727 RWRAWFNKYNFVMGAGVEAGVAISVVIIFLCVQYPGAKLSWWGNNVWKRTYDNDYKKFYT 786

Query: 785 LNKGETFGYDKWW 797
           L KGETFGYDKWW
Sbjct: 787 LKKGETFGYDKWW 799

>Kwal_26.7996 s26 complement(604470..606818) [2349 bp, 782 aa] {ON}
           YJL212C (OPT1) - Oligopeptide transporter; Opt1p
           transports tetra- and pentapeptides, including the
           endogenous opioid pentapeptide leucine enkephalin.
           [contig 55] FULL
          Length = 782

 Score = 1232 bits (3187), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/729 (79%), Positives = 645/729 (88%)

Query: 69  DDAIWEGDPTYLPNSPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLR 128
           D  IWEGD T LPNSP+PEVRATVP TDDPTI +NHWRTWFLTTVFV+VFAGVNQFFSLR
Sbjct: 54  DQTIWEGDVTALPNSPFPEVRATVPATDDPTIVVNHWRTWFLTTVFVVVFAGVNQFFSLR 113

Query: 129 YPSLSINFIVAQVICYPIGKILATLPDWKCKRVPFFDLNPGPFTKKEHAVVTIAVALTSS 188
           YPSLSINF+VAQV+CYPIGKILA LP   C R P+F+LNPGPFTKKEHAVVTIAVALTSS
Sbjct: 114 YPSLSINFLVAQVVCYPIGKILALLPQRDCARCPWFNLNPGPFTKKEHAVVTIAVALTSS 173

Query: 189 TAYAMNILIAQTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLIS 248
           TAYAMNILIAQTNFYNMKLGAGY VLLVWTSQMLGYGAAGL+RRWVV PA+C+WPQTLIS
Sbjct: 174 TAYAMNILIAQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACIWPQTLIS 233

Query: 249 VSLFDALHSGKIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFILWGPK 308
           VSLFD+LH+  +D ++VNGW M+RY+FF+ V   SF+WYW+PGFLF GLSYFN +LWG K
Sbjct: 234 VSLFDSLHNRTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFNVVLWGSK 293

Query: 309 TRHNFIANAIFGVESGLGAIPITFDYTQISQAMTGSVFATPFWVSANTYASXXXXXXXXX 368
           TRHNFIAN IFGVESG+GA+PI+FDYTQ+SQAM+GSVFATP+WVSAN+ AS         
Sbjct: 294 TRHNFIANTIFGVESGIGALPISFDYTQVSQAMSGSVFATPYWVSANSCASVFIFFILIL 353

Query: 369 XXXYFTNTWYAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSPLYVPFSYLL 428
              YFTNTWYAKYMP+IS +T+DN Q  YNV+KILNPDFS+NLEKYK YSPL+VPFSYLL
Sbjct: 354 PILYFTNTWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLFVPFSYLL 413

Query: 429 SYALNFAAVTAVFVHCALYHGKDIISKLRNSNHGGSDIHMRLYSKNYKDCPDWWYGALQV 488
           SYALNFAAV AVFVHCALY+GKDI +K RN NHGG DIHMRLY++NYKDCPDWWY  LQV
Sbjct: 414 SYALNFAAVVAVFVHCALYNGKDIKNKFRNKNHGGQDIHMRLYTQNYKDCPDWWYLVLQV 473

Query: 489 VTLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAMTNQHVGLNIITELVCGYM 548
           V LGLGFAT+CG+D+H PAWAF +AL+ISF N +PQGILEA+TNQHVGLNIITEL+CGYM
Sbjct: 474 VMLGLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQHVGLNIITELICGYM 533

Query: 549 LPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIYASLISGLVNVGI 608
           LP KPMANVLFKLYGFIVMR GL+LSRDLKLALYMKV PRLIFA+QIYA++ISGLVNVGI
Sbjct: 534 LPFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQIYATIISGLVNVGI 593

Query: 609 QEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSLPQYLFSPGRIYNPLMWFFLIGLV 668
           QEWMR NI  +CS TQ DGF C+NGRTIFNASIIWS+PQ+LFSPGRIYNP+MWFFLIGL 
Sbjct: 594 QEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPQFLFSPGRIYNPIMWFFLIGLA 653

Query: 669 VPFIVFFLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTPYNYSLFFATSFLLNEIRKRWPR 728
           VP IVF LQ+ F  NQ +K+ H+PVFF GP +IPPSTPYNYSLFFA S++LN IRKRWP 
Sbjct: 654 VPLIVFALQRVFKHNQAIKFMHAPVFFAGPNSIPPSTPYNYSLFFAMSYVLNRIRKRWPL 713

Query: 729 WFGKYNFVMGSGVEAGVALSVTIIFLCVQYPGGKVNWWGNSVWKNTYDHQYKKFYHLNKG 788
           WF KYN+VMG+GVE GVAL+V IIFLCVQYPGGK+NWWGNSV+KNTYDH Y+K+Y L KG
Sbjct: 714 WFSKYNYVMGAGVETGVALAVVIIFLCVQYPGGKLNWWGNSVYKNTYDHAYRKYYVLKKG 773

Query: 789 ETFGYDKWW 797
           ETFGYDKWW
Sbjct: 774 ETFGYDKWW 782

>YJL212C Chr10 complement(33850..36249) [2400 bp, 799 aa] {ON}
           OPT1Proton-coupled oligopeptide transporter of the
           plasma membrane; also transports glutathione and
           phytochelatin; member of the OPT family
          Length = 799

 Score = 1231 bits (3186), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 588/799 (73%), Positives = 670/799 (83%), Gaps = 8/799 (1%)

Query: 3   YKQEKNFEKFERTSTSSLEQTVPLDTGKVSYVPNPEFEQERQIVKTLSATIDLED---PS 59
           Y++  + E    +  S    T+P+         +   +   + V  L+AT D ED    S
Sbjct: 5   YRESDSLE----SEPSPTPTTIPIQINMEEEKKDAFVKNIDEDVNNLTATTDEEDRDPES 60

Query: 60  EKGSLLQDQDDA-IWEGDPTYLPNSPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVF 118
           +K      Q++  +W+GDPTYLPNSPYPEVR+ V   DDPTI LNHWRTWFLTTVFV+VF
Sbjct: 61  QKFDRHSIQEEGLVWKGDPTYLPNSPYPEVRSAVSIEDDPTIRLNHWRTWFLTTVFVVVF 120

Query: 119 AGVNQFFSLRYPSLSINFIVAQVICYPIGKILATLPDWKCKRVPFFDLNPGPFTKKEHAV 178
           AGVNQFFSLRYPSL INF+VAQV+CYPIG+ILA LPDWKC +VPFFDLNPGPFTKKEHAV
Sbjct: 121 AGVNQFFSLRYPSLEINFLVAQVVCYPIGRILALLPDWKCSKVPFFDLNPGPFTKKEHAV 180

Query: 179 VTIAVALTSSTAYAMNILIAQTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPA 238
           VTIAVALTSSTAYAM IL AQ +FYNMKL  GYQ LLVWTSQM+GYGAAGL+RRWVVNPA
Sbjct: 181 VTIAVALTSSTAYAMYILNAQGSFYNMKLNVGYQFLLVWTSQMIGYGAAGLTRRWVVNPA 240

Query: 239 SCVWPQTLISVSLFDALHSGKIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLS 298
           S +WPQTLISVSLFD+LHS K++KT+ NGW+M RY+FFL V + SF+WYW+PGFLFTGLS
Sbjct: 241 SSIWPQTLISVSLFDSLHSRKVEKTVANGWTMPRYRFFLIVLIGSFIWYWVPGFLFTGLS 300

Query: 299 YFNFILWGPKTRHNFIANAIFGVESGLGAIPITFDYTQISQAMTGSVFATPFWVSANTYA 358
           YFN ILWG KTRHNFIAN IFG +SGLGA+PITFDYTQ+SQAM+GSVFATPF+VSANTYA
Sbjct: 301 YFNVILWGSKTRHNFIANTIFGTQSGLGALPITFDYTQVSQAMSGSVFATPFYVSANTYA 360

Query: 359 SXXXXXXXXXXXXYFTNTWYAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYS 418
           S            YFTNTWYAKYMP+IS STYDN QN YNVTKILN D+SINLEKYK YS
Sbjct: 361 SVLIFFVIVLPCLYFTNTWYAKYMPVISGSTYDNTQNKYNVTKILNEDYSINLEKYKEYS 420

Query: 419 PLYVPFSYLLSYALNFAAVTAVFVHCALYHGKDIISKLRNSNHGGSDIHMRLYSKNYKDC 478
           P++VPFSYLLSYALNFAAV AVFVHC LYHGKDI++K ++  +GG+DIHMR+YSKNYKDC
Sbjct: 421 PVFVPFSYLLSYALNFAAVIAVFVHCILYHGKDIVAKFKDRKNGGTDIHMRIYSKNYKDC 480

Query: 479 PDWWYGALQVVTLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAMTNQHVGLN 538
           PDWWY  LQ+V +GLGF  VC +DT FPAWAFVIA+LIS  N +PQGILEAMTNQHVGLN
Sbjct: 481 PDWWYLLLQIVMIGLGFVAVCCFDTKFPAWAFVIAILISLVNFIPQGILEAMTNQHVGLN 540

Query: 539 IITELVCGYMLPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIYAS 598
           IITEL+CGYMLPL+PMAN+LFKLYGFIVMR GL+LSRDLKLA+YMKVSPRLIFAVQIYA+
Sbjct: 541 IITELICGYMLPLRPMANLLFKLYGFIVMRQGLNLSRDLKLAMYMKVSPRLIFAVQIYAT 600

Query: 599 LISGLVNVGIQEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSLPQYLFSPGRIYNP 658
           +ISG+VNVG+QEWM HNIDG+C+  Q +GF C+NGRT+FNASIIWSLP+YLFS GRIYNP
Sbjct: 601 IISGMVNVGVQEWMMHNIDGLCTTDQPNGFTCANGRTVFNASIIWSLPKYLFSSGRIYNP 660

Query: 659 LMWFFLIGLVVPFIVFFLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTPYNYSLFFATSFL 718
           LMWFFLIGL+ P  V+ +Q KFP  +F K+ H+PVFFTGPGNIPPSTPYNYSLFFA SF 
Sbjct: 661 LMWFFLIGLLFPLAVYAVQWKFPKFKFAKHIHTPVFFTGPGNIPPSTPYNYSLFFAMSFC 720

Query: 719 LNEIRKRWPRWFGKYNFVMGSGVEAGVALSVTIIFLCVQYPGGKVNWWGNSVWKNTYDHQ 778
           LN IRKRW  WF KYNFVMG+GVEAGVA+SV IIFLCVQYPGGK++WWGN+VWK TYD+ 
Sbjct: 721 LNLIRKRWRAWFNKYNFVMGAGVEAGVAISVVIIFLCVQYPGGKLSWWGNNVWKRTYDND 780

Query: 779 YKKFYHLNKGETFGYDKWW 797
           YKKFY L KGETFGYDKWW
Sbjct: 781 YKKFYTLKKGETFGYDKWW 799

>Suva_6.290 Chr6 (513382..515787) [2406 bp, 801 aa] {ON} YJL212C
           (REAL)
          Length = 801

 Score = 1227 bits (3175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/797 (72%), Positives = 674/797 (84%), Gaps = 5/797 (0%)

Query: 6   EKNFEKFERTSTSSLEQTVPLDTGKVSYVPNPEFEQE-RQIVKTLSATIDLED---PSEK 61
            ++ +  E   ++SL   V       +     EF +   + V  L+AT D ED    S+K
Sbjct: 5   HRDVDSVESQPSTSLSPAVVAIQVSQAEDKKDEFVKNIDEDVNNLTATTDDEDHDPESQK 64

Query: 62  GSLLQDQDDA-IWEGDPTYLPNSPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAG 120
                 Q++  +W+GDPTYLPNSPYPEVR+ V   DDPTI LNHWRTWFLTT+FV+VFAG
Sbjct: 65  YDRHSIQEEGLVWKGDPTYLPNSPYPEVRSAVSIEDDPTIRLNHWRTWFLTTIFVVVFAG 124

Query: 121 VNQFFSLRYPSLSINFIVAQVICYPIGKILATLPDWKCKRVPFFDLNPGPFTKKEHAVVT 180
           VNQFFSLRYPSL INF+VAQV+C+PIG++LA LPDWKC RVPFFDLNPGPFTKKEHAVVT
Sbjct: 125 VNQFFSLRYPSLEINFLVAQVVCFPIGRMLALLPDWKCARVPFFDLNPGPFTKKEHAVVT 184

Query: 181 IAVALTSSTAYAMNILIAQTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASC 240
           IAVALTSSTAYAM IL AQ +FYNMKL  GYQ LLVWTSQM+GYGAAGL+RRWVVNPAS 
Sbjct: 185 IAVALTSSTAYAMYILNAQGSFYNMKLNVGYQFLLVWTSQMIGYGAAGLTRRWVVNPASS 244

Query: 241 VWPQTLISVSLFDALHSGKIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYF 300
           +WPQTLISVSLFD+LHS  ++K++ NGW M RY+FFL++ + SF+WYW+PGFLFTGLSYF
Sbjct: 245 IWPQTLISVSLFDSLHSRDVEKSVANGWKMPRYRFFLFILIGSFIWYWVPGFLFTGLSYF 304

Query: 301 NFILWGPKTRHNFIANAIFGVESGLGAIPITFDYTQISQAMTGSVFATPFWVSANTYASX 360
           N +LWGPKTR+NFIAN IFG +SGLGA+PITFDYTQISQAM+GSVFATPF+VSANTYAS 
Sbjct: 305 NVVLWGPKTRYNFIANTIFGTQSGLGALPITFDYTQISQAMSGSVFATPFYVSANTYASV 364

Query: 361 XXXXXXXXXXXYFTNTWYAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSPL 420
                      YFTNTWYAK+MP+IS+STYDN QN YNVTKILN D+SINLEKYK YSP+
Sbjct: 365 LIFFVIVLPCLYFTNTWYAKFMPVISSSTYDNTQNKYNVTKILNEDYSINLEKYKEYSPV 424

Query: 421 YVPFSYLLSYALNFAAVTAVFVHCALYHGKDIISKLRNSNHGGSDIHMRLYSKNYKDCPD 480
           +VPFSYLLSYALNFAAV AVFVHC LYHGKDI++K ++  +GG DIHMR+YSKNYKDCPD
Sbjct: 425 FVPFSYLLSYALNFAAVIAVFVHCILYHGKDIVAKFKDRKNGGVDIHMRIYSKNYKDCPD 484

Query: 481 WWYGALQVVTLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAMTNQHVGLNII 540
           WWY  LQ+V +GLGF  VC +DT FPAWAFVIA+LIS  N +PQGILEAMTNQHVGLNII
Sbjct: 485 WWYLTLQIVMIGLGFVAVCCFDTKFPAWAFVIAILISLVNFIPQGILEAMTNQHVGLNII 544

Query: 541 TELVCGYMLPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIYASLI 600
           TEL+CGYMLPL+PMAN+LFKLYGFIVMR GL+LSRDLKLA+YMKVSPRLIFA+QIYA++I
Sbjct: 545 TELICGYMLPLRPMANLLFKLYGFIVMRQGLNLSRDLKLAMYMKVSPRLIFAIQIYATII 604

Query: 601 SGLVNVGIQEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSLPQYLFSPGRIYNPLM 660
           SGLVNVG+QEWM HNIDG+C+  Q +GF C+NGRT+FN+SIIWSLP+YLFSPGRIYNPLM
Sbjct: 605 SGLVNVGVQEWMMHNIDGLCTTDQPNGFTCANGRTVFNSSIIWSLPKYLFSPGRIYNPLM 664

Query: 661 WFFLIGLVVPFIVFFLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTPYNYSLFFATSFLLN 720
           WFFLIGL+ P +V+ +Q KFP+ +F K+ H+PVFFTGPGNIPPSTPYNYSLFFATSF L+
Sbjct: 665 WFFLIGLLFPIVVYAIQWKFPNFKFAKHIHTPVFFTGPGNIPPSTPYNYSLFFATSFCLH 724

Query: 721 EIRKRWPRWFGKYNFVMGSGVEAGVALSVTIIFLCVQYPGGKVNWWGNSVWKNTYDHQYK 780
            IRKRW  W+ KYNFVMG+GVEAGVA++V IIFLCVQYPGGK++WWGN+VWK TYD+ YK
Sbjct: 725 IIRKRWRAWYNKYNFVMGAGVEAGVAIAVVIIFLCVQYPGGKLSWWGNNVWKRTYDNDYK 784

Query: 781 KFYHLNKGETFGYDKWW 797
           KFY L KGETFGYDKWW
Sbjct: 785 KFYTLKKGETFGYDKWW 801

>KLLA0E00397g Chr5 (23256..25637) [2382 bp, 793 aa] {ON} highly
           similar to uniprot|P40897 Saccharomyces cerevisiae
           YJL212C OPT1 Plasma membrane transporter that transports
           tetra- and pentapeptides and glutathione member of the
           OPT family
          Length = 793

 Score = 1226 bits (3172), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/769 (75%), Positives = 660/769 (85%), Gaps = 11/769 (1%)

Query: 40  EQERQIVKTLSATIDLEDPSEKGSLLQ----------DQDDA-IWEGDPTYLPNSPYPEV 88
           + + QI      TI LE   ++  L+           D+DD  +W+GDPTYLPNSPYP+V
Sbjct: 25  QIQLQITVKNENTISLEKDIKEEELVNESEFHDSESIDEDDGLVWKGDPTYLPNSPYPDV 84

Query: 89  RATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFIVAQVICYPIGK 148
           R  V   DDPTI LNHWRTWFLTT+FV+VFAGVNQFFSLRYPSLSI+FIVAQVICYPIGK
Sbjct: 85  RFAVSIEDDPTIRLNHWRTWFLTTIFVVVFAGVNQFFSLRYPSLSIDFIVAQVICYPIGK 144

Query: 149 ILATLPDWKCKRVPFFDLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFYNMKLG 208
           +LA LPDWKC+RVPFFDLNPGPFTKKEHAVVTIAVALTSSTAYAM IL AQ +FYNMKL 
Sbjct: 145 VLAKLPDWKCRRVPFFDLNPGPFTKKEHAVVTIAVALTSSTAYAMYILNAQGSFYNMKLN 204

Query: 209 AGYQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLISVSLFDALHSGKIDKTIVNGW 268
            GYQ LLVWTSQM+GYGAAGL+RRWVVNPAS +WPQTLISVSLFD+LHS KI++ +VNGW
Sbjct: 205 VGYQFLLVWTSQMIGYGAAGLTRRWVVNPASAIWPQTLISVSLFDSLHSRKIERAVVNGW 264

Query: 269 SMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFILWGPKTRHNFIANAIFGVESGLGAI 328
           SM RYKFF+ VF+ SFVWYW+PGFLFTGLSYFN ILWGPKTR NF+AN IFGVESGLGA 
Sbjct: 265 SMPRYKFFVIVFIASFVWYWVPGFLFTGLSYFNVILWGPKTRDNFVANTIFGVESGLGAF 324

Query: 329 PITFDYTQISQAMTGSVFATPFWVSANTYASXXXXXXXXXXXXYFTNTWYAKYMPIISTS 388
           PI+FDYTQISQAM+GSVFATPF+VSANTYAS            YF+NTWYAKYMP+IS S
Sbjct: 325 PISFDYTQISQAMSGSVFATPFYVSANTYASVLLFFVIILPCLYFSNTWYAKYMPVISGS 384

Query: 389 TYDNQQNSYNVTKILNPDFSINLEKYKGYSPLYVPFSYLLSYALNFAAVTAVFVHCALYH 448
           TYDN Q+ YNVTKILN D+SINLEKYK YSP++VPFSYLLSYALNFAAV AVFVHC LYH
Sbjct: 385 TYDNTQSKYNVTKILNEDYSINLEKYKNYSPIFVPFSYLLSYALNFAAVIAVFVHCILYH 444

Query: 449 GKDIISKLRNSNHGGSDIHMRLYSKNYKDCPDWWYGALQVVTLGLGFATVCGWDTHFPAW 508
           GKDI++KL++  +GG+DIH R+YSKNY DCPDWWY  LQVV +GLGF TVC +D+ FPAW
Sbjct: 445 GKDILAKLKDRRNGGTDIHARIYSKNYADCPDWWYLVLQVVMIGLGFVTVCAFDSKFPAW 504

Query: 509 AFVIALLISFANIVPQGILEAMTNQHVGLNIITELVCGYMLPLKPMANVLFKLYGFIVMR 568
           AFVIA+LIS  N +PQGILEAMTNQHVGLNIITEL+CGYMLPL+PMAN+LFKLYGFIVMR
Sbjct: 505 AFVIAILISLVNFIPQGILEAMTNQHVGLNIITELICGYMLPLRPMANLLFKLYGFIVMR 564

Query: 569 HGLDLSRDLKLALYMKVSPRLIFAVQIYASLISGLVNVGIQEWMRHNIDGICSKTQKDGF 628
            GL+LSRDLKLA+YMKV PRLIF +QIYA+++SG+VNVG+QEWM HNI+GICS  Q +GF
Sbjct: 565 QGLNLSRDLKLAMYMKVPPRLIFFIQIYATILSGMVNVGVQEWMTHNIEGICSTDQSNGF 624

Query: 629 ICSNGRTIFNASIIWSLPQYLFSPGRIYNPLMWFFLIGLVVPFIVFFLQKKFPSNQFLKY 688
            C+NGRT+FNASIIWSLP+YLFSPGRIYNPLMWFFLIGLVVP IV+ +Q+KFP  QF KY
Sbjct: 625 TCANGRTVFNASIIWSLPKYLFSPGRIYNPLMWFFLIGLVVPLIVYAIQRKFPKIQFAKY 684

Query: 689 CHSPVFFTGPGNIPPSTPYNYSLFFATSFLLNEIRKRWPRWFGKYNFVMGSGVEAGVALS 748
            H+PVFFTGPGNIPPSTPYNYSLFF+ SF L+ IRKRW  WF KYN+VMG+ VE+GVA++
Sbjct: 685 IHTPVFFTGPGNIPPSTPYNYSLFFSASFCLHIIRKRWGPWFKKYNYVMGAAVESGVAIA 744

Query: 749 VTIIFLCVQYPGGKVNWWGNSVWKNTYDHQYKKFYHLNKGETFGYDKWW 797
           V IIFLCVQ+PG ++NWWGN+VWKNTYDH YKKFY L +G+TFG+ KWW
Sbjct: 745 VVIIFLCVQFPGAELNWWGNNVWKNTYDHNYKKFYTLEEGQTFGHTKWW 793

>Skud_10.5 Chr10 complement(7830..10229) [2400 bp, 799 aa] {ON}
           YJL212C (REAL)
          Length = 799

 Score = 1224 bits (3166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/775 (74%), Positives = 664/775 (85%), Gaps = 9/775 (1%)

Query: 27  DTGKVSYVPNPEFEQERQIVKTLSATIDLED---PSEKGSLLQDQDDA-IWEGDPTYLPN 82
           D  K ++V N +     + +   + T D ED    S+K      Q++  +W+GDPTYLPN
Sbjct: 30  DEKKDAFVKNID-----EDINNFTTTTDEEDRDPESQKFDRHSIQEEGLVWKGDPTYLPN 84

Query: 83  SPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFIVAQVI 142
           SPYPEVRA V   DDPTI LNHWRTWFLTT+FV+VFAGVNQFFSLRYPSL INFIVAQV+
Sbjct: 85  SPYPEVRAAVSIEDDPTIRLNHWRTWFLTTIFVVVFAGVNQFFSLRYPSLEINFIVAQVV 144

Query: 143 CYPIGKILATLPDWKCKRVPFFDLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNF 202
           C+PIG++LA LPDWKC+R PFFDLNPGPFTKKEHAVVTIAVALTSSTAYAM IL AQ +F
Sbjct: 145 CFPIGRVLALLPDWKCRRAPFFDLNPGPFTKKEHAVVTIAVALTSSTAYAMYILNAQGSF 204

Query: 203 YNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLISVSLFDALHSGKIDK 262
           YNMKL  GYQ LLVWTSQM+GYGAAGL+RRWVVNPAS +WPQTLISVSLFD+LHS KI+K
Sbjct: 205 YNMKLNVGYQFLLVWTSQMIGYGAAGLTRRWVVNPASSIWPQTLISVSLFDSLHSRKIEK 264

Query: 263 TIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFILWGPKTRHNFIANAIFGVE 322
           T+ NGW+M RY+FFL V + SF+WYW+PGFLFTGLSYFN +LWG KTRHNFIAN IFG +
Sbjct: 265 TVANGWTMPRYRFFLIVLIGSFLWYWVPGFLFTGLSYFNVVLWGSKTRHNFIANTIFGTQ 324

Query: 323 SGLGAIPITFDYTQISQAMTGSVFATPFWVSANTYASXXXXXXXXXXXXYFTNTWYAKYM 382
           SGLGA+PITFDYTQISQAM+GSVFATPF+VSANTYAS            YFTNTWYAKYM
Sbjct: 325 SGLGALPITFDYTQISQAMSGSVFATPFYVSANTYASVLIFFVIVLPCLYFTNTWYAKYM 384

Query: 383 PIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSPLYVPFSYLLSYALNFAAVTAVFV 442
           P+IS STYDN QN YNVTKILN D+SINLEKYK YSP++VPFSYLLSYALNFAAV AVFV
Sbjct: 385 PVISGSTYDNTQNKYNVTKILNEDYSINLEKYKEYSPVFVPFSYLLSYALNFAAVIAVFV 444

Query: 443 HCALYHGKDIISKLRNSNHGGSDIHMRLYSKNYKDCPDWWYGALQVVTLGLGFATVCGWD 502
           HC LYHGK+I++K ++  +GG+DIHMR+Y+KNYKDCPDWWY  LQ+V +GLGF  VC +D
Sbjct: 445 HCFLYHGKEILAKFKDRKNGGTDIHMRIYTKNYKDCPDWWYLLLQIVMIGLGFVAVCCFD 504

Query: 503 THFPAWAFVIALLISFANIVPQGILEAMTNQHVGLNIITELVCGYMLPLKPMANVLFKLY 562
           T FPAWAFVIA+LIS  N +PQGILEAMTNQHVGLNIITEL+CGYMLPL+PMAN+LFKLY
Sbjct: 505 TKFPAWAFVIAILISLVNFIPQGILEAMTNQHVGLNIITELICGYMLPLRPMANLLFKLY 564

Query: 563 GFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIYASLISGLVNVGIQEWMRHNIDGICSK 622
           GFIVMR GL+LSRDLKLA+YMKVSPRLIFAVQIYA++ISG+VNVG+QEWM HNIDG+C+ 
Sbjct: 565 GFIVMRQGLNLSRDLKLAMYMKVSPRLIFAVQIYATIISGMVNVGVQEWMMHNIDGLCTT 624

Query: 623 TQKDGFICSNGRTIFNASIIWSLPQYLFSPGRIYNPLMWFFLIGLVVPFIVFFLQKKFPS 682
            Q +GF C+NGRT+FNASIIWSLP+YLFS GRIYNPLMWFFLIGL+ P +V+ +Q KFP+
Sbjct: 625 DQPNGFTCANGRTVFNASIIWSLPKYLFSTGRIYNPLMWFFLIGLLFPLVVYAVQWKFPN 684

Query: 683 NQFLKYCHSPVFFTGPGNIPPSTPYNYSLFFATSFLLNEIRKRWPRWFGKYNFVMGSGVE 742
            +F K+ H+PVFFTGPGNIPPSTPYNYSLFFA SF LN IRKRW  WF KYNFVMG+GVE
Sbjct: 685 FKFAKHIHTPVFFTGPGNIPPSTPYNYSLFFAMSFCLNVIRKRWRAWFNKYNFVMGAGVE 744

Query: 743 AGVALSVTIIFLCVQYPGGKVNWWGNSVWKNTYDHQYKKFYHLNKGETFGYDKWW 797
           AGVA++V IIFLCVQYPGGK++WWGN+VWK TYD+ YKKFY LNKGETFGYD WW
Sbjct: 745 AGVAIAVVIIFLCVQYPGGKLSWWGNNVWKRTYDNDYKKFYTLNKGETFGYDNWW 799

>KLTH0D06754g Chr4 complement(588021..590504) [2484 bp, 827 aa] {ON}
           highly similar to uniprot|P40897 Saccharomyces
           cerevisiae YJL212C OPT1 Plasma membrane transporter that
           transports tetra- and pentapeptides and glutathione
           member of the OPT family
          Length = 827

 Score = 1223 bits (3165), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/726 (79%), Positives = 643/726 (88%)

Query: 72  IWEGDPTYLPNSPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLRYPS 131
           +WEG+ + L NSP+PEVRATVP TDDPTI LNHWRTWFLTTVFVIVFAGVNQFFSLRYPS
Sbjct: 102 VWEGNVSLLQNSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPS 161

Query: 132 LSINFIVAQVICYPIGKILATLPDWKCKRVPFFDLNPGPFTKKEHAVVTIAVALTSSTAY 191
           LSINF+VAQV+CYP+GKILA LP+W C R P+F+LNPGPFTKKEHAVVTIAVALTSSTAY
Sbjct: 162 LSINFLVAQVVCYPVGKILALLPEWDCPRCPWFNLNPGPFTKKEHAVVTIAVALTSSTAY 221

Query: 192 AMNILIAQTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLISVSL 251
           AMNILIAQTNFYNMKL AGY +LLVWTSQML YGAAGL+RRWVV+PA+C+WPQTLISVSL
Sbjct: 222 AMNILIAQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSL 281

Query: 252 FDALHSGKIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFILWGPKTRH 311
           FD+LH+  IDKT VNGWSM+RY+FF+ VF  SFVWYW+PGFLF GLSYFN +LWGPKTRH
Sbjct: 282 FDSLHNRSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRH 341

Query: 312 NFIANAIFGVESGLGAIPITFDYTQISQAMTGSVFATPFWVSANTYASXXXXXXXXXXXX 371
           NFIAN IFGVESG+GA+PITFDYTQISQA+TGSVFATP+WVSAN+ AS            
Sbjct: 342 NFIANTIFGVESGIGALPITFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPIL 401

Query: 372 YFTNTWYAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSPLYVPFSYLLSYA 431
           YFTNTWYAKYMP+IS STYDN Q  YNV++ILN D+SIN EKYK YSPL+VPFSYLLSYA
Sbjct: 402 YFTNTWYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYA 461

Query: 432 LNFAAVTAVFVHCALYHGKDIISKLRNSNHGGSDIHMRLYSKNYKDCPDWWYGALQVVTL 491
           LNFAAV AVFVHC LY+GK+I +K RN N+GG DIHMRLYS+NYKDCPDWWY  LQV+ +
Sbjct: 462 LNFAAVIAVFVHCFLYNGKEIKNKFRNKNYGGQDIHMRLYSQNYKDCPDWWYVVLQVIMI 521

Query: 492 GLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAMTNQHVGLNIITELVCGYMLPL 551
            LGF  VC +++H PAWAFV+AL ISF N +PQGILEA+TNQHVGLNIITEL+CGYMLP 
Sbjct: 522 ALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHVGLNIITELICGYMLPF 581

Query: 552 KPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIYASLISGLVNVGIQEW 611
           +PMAN+LFKLYGFIVMR GL+LSRDLKLALYMKV PRLIFAVQIYA++ISGLVNVGIQEW
Sbjct: 582 RPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQIYATVISGLVNVGIQEW 641

Query: 612 MRHNIDGICSKTQKDGFICSNGRTIFNASIIWSLPQYLFSPGRIYNPLMWFFLIGLVVPF 671
           MR NI  +CS TQ DGF C+NGRTIFNASIIWS+P+YLFSPGRIYNP+MWFFLIGLVVP 
Sbjct: 642 MRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPKYLFSPGRIYNPIMWFFLIGLVVPI 701

Query: 672 IVFFLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTPYNYSLFFATSFLLNEIRKRWPRWFG 731
           IVF LQKKF  N+ LK+CHSPVFF GPGNIPPSTPYNY+L+FA S+ LN IRKR+PRWF 
Sbjct: 702 IVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTLYFALSWALNTIRKRFPRWFS 761

Query: 732 KYNFVMGSGVEAGVALSVTIIFLCVQYPGGKVNWWGNSVWKNTYDHQYKKFYHLNKGETF 791
           KYNFVMG+GVE GVAL+V IIFLCVQYPGG +NWWGN+V+KNTYDH Y+KFY+L KGE F
Sbjct: 762 KYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNWWGNNVYKNTYDHNYRKFYNLKKGEKF 821

Query: 792 GYDKWW 797
           GYDKWW
Sbjct: 822 GYDKWW 827

>TDEL0C00130 Chr3 complement(9763..12141) [2379 bp, 792 aa] {ON} 
          Length = 792

 Score = 1201 bits (3107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/729 (77%), Positives = 637/729 (87%)

Query: 69  DDAIWEGDPTYLPNSPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLR 128
           DD +WEGD + LPNSPYP+VRA VP  DDP I LNHWRTWFLTTVFV+VFAGVNQFFSLR
Sbjct: 64  DDGVWEGDVSLLPNSPYPDVRAVVPIDDDPGIILNHWRTWFLTTVFVVVFAGVNQFFSLR 123

Query: 129 YPSLSINFIVAQVICYPIGKILATLPDWKCKRVPFFDLNPGPFTKKEHAVVTIAVALTSS 188
           YPSL INF+VAQV+C+P+GK LA LPDWKCKR  FFDLNPGPFTKKEHAV+TIAVALTSS
Sbjct: 124 YPSLEINFLVAQVVCFPVGKALALLPDWKCKRFSFFDLNPGPFTKKEHAVITIAVALTSS 183

Query: 189 TAYAMNILIAQTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLIS 248
           TAYAM IL AQ +FY+MKL AGYQ+LLVWTSQMLGYGAAGL+RRWVV+P SC+WPQTLIS
Sbjct: 184 TAYAMYILNAQVSFYHMKLNAGYQLLLVWTSQMLGYGAAGLTRRWVVDPPSCIWPQTLIS 243

Query: 249 VSLFDALHSGKIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFILWGPK 308
           VSLFD+LHS K+DKTIVNGWS+ RYK F +V + SFVW+W+PGFLF GLSYFN +LWGPK
Sbjct: 244 VSLFDSLHSRKVDKTIVNGWSLDRYKMFYFVLIGSFVWHWVPGFLFKGLSYFNVVLWGPK 303

Query: 309 TRHNFIANAIFGVESGLGAIPITFDYTQISQAMTGSVFATPFWVSANTYASXXXXXXXXX 368
           TR NF+ANA+FGV SG+G +PI+FDYTQ+SQAM+GSVFATPFWVSANTYAS         
Sbjct: 304 TRQNFVANALFGVSSGIGLLPISFDYTQVSQAMSGSVFATPFWVSANTYASVLIFFVIVL 363

Query: 369 XXXYFTNTWYAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSPLYVPFSYLL 428
              YFTNTWYAKYMP+IS ST+DN Q+SYNV KILN D+SINLEKYK YSP++VPFSYLL
Sbjct: 364 PILYFTNTWYAKYMPVISGSTFDNTQSSYNVKKILNADYSINLEKYKEYSPVFVPFSYLL 423

Query: 429 SYALNFAAVTAVFVHCALYHGKDIISKLRNSNHGGSDIHMRLYSKNYKDCPDWWYGALQV 488
           +Y LNFAAV AVFVHCALYHGKDI +KLR+SN GG DIH R+Y+KNYK+CPDWWYG LQ+
Sbjct: 424 NYGLNFAAVVAVFVHCALYHGKDIYNKLRDSNFGGMDIHRRIYTKNYKECPDWWYGVLQI 483

Query: 489 VTLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAMTNQHVGLNIITELVCGYM 548
           +TL LGF TVC + THFP WAFVIAL+I++AN +PQGILEA+TNQHVGLNIITEL+CGYM
Sbjct: 484 ITLALGFVTVCAFPTHFPPWAFVIALIIAYANFLPQGILEAITNQHVGLNIITELICGYM 543

Query: 549 LPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIYASLISGLVNVGI 608
           LPLKPMAN+LFKLYGFIVMR GL+LSRDLKLALYMKVSPRLIFA+QIYA++ISGLVNVGI
Sbjct: 544 LPLKPMANLLFKLYGFIVMRQGLNLSRDLKLALYMKVSPRLIFAIQIYATIISGLVNVGI 603

Query: 609 QEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSLPQYLFSPGRIYNPLMWFFLIGLV 668
           QEWMR NI  IC+ TQ DGF C+NGRTIFNASIIWSLP+YLFSPGRIYNPLMWFFLIGL+
Sbjct: 604 QEWMRTNIKDICTTTQADGFTCANGRTIFNASIIWSLPKYLFSPGRIYNPLMWFFLIGLL 663

Query: 669 VPFIVFFLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTPYNYSLFFATSFLLNEIRKRWPR 728
            P +VF +QKKFP   F KY H+PVFFTG  NIPPSTPYNYSLFF  SF+L  IRK WP 
Sbjct: 664 APIVVFLIQKKFPKVSFFKYLHTPVFFTGTNNIPPSTPYNYSLFFGMSFMLFLIRKNWPL 723

Query: 729 WFGKYNFVMGSGVEAGVALSVTIIFLCVQYPGGKVNWWGNSVWKNTYDHQYKKFYHLNKG 788
           WF KYNFV G+GVE GVA++V IIFLCVQ+PGG ++WWGN+V+KNT D + +KFY L +G
Sbjct: 724 WFSKYNFVTGAGVETGVAIAVVIIFLCVQFPGGHLDWWGNTVYKNTGDLKSQKFYVLKEG 783

Query: 789 ETFGYDKWW 797
           ETFGYDKWW
Sbjct: 784 ETFGYDKWW 792

>ZYRO0D00330g Chr4 complement(22470..24866) [2397 bp, 798 aa] {ON}
           highly similar to uniprot|P40897 Saccharomyces
           cerevisiae YJL212C OPT1 Plasma membrane transporter that
           transports tetra- and pentapeptides and glutathione
           member of the OPT family
          Length = 798

 Score = 1179 bits (3051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/728 (77%), Positives = 635/728 (87%)

Query: 70  DAIWEGDPTYLPNSPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLRY 129
           D IWEGDP+ +P+SPYPEVRA +  TDDP+I LNHWRTWFL TVFV+VFAGVNQFFSLRY
Sbjct: 71  DDIWEGDPSEMPDSPYPEVRAVLSPTDDPSIVLNHWRTWFLVTVFVVVFAGVNQFFSLRY 130

Query: 130 PSLSINFIVAQVICYPIGKILATLPDWKCKRVPFFDLNPGPFTKKEHAVVTIAVALTSST 189
           PSL+I+F+VAQVICYP+GK LA LPDWKCK VPFF+LNPGPFTKKEHAVVTIAVALTSST
Sbjct: 131 PSLTIDFLVAQVICYPLGKTLACLPDWKCKLVPFFNLNPGPFTKKEHAVVTIAVALTSST 190

Query: 190 AYAMNILIAQTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLISV 249
           AYAM IL AQ +FYNM + +GYQ+LLVW+SQMLGYGAAGL+RRWVVNPASC+WPQTLISV
Sbjct: 191 AYAMYILNAQVSFYNMSVNSGYQLLLVWSSQMLGYGAAGLTRRWVVNPASCIWPQTLISV 250

Query: 250 SLFDALHSGKIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFILWGPKT 309
           SLFD+LHS  I+K+ VNGW + RYKFFL+V + SFVWYW+PGFLFTGLSYFN +LWGPKT
Sbjct: 251 SLFDSLHSRTIEKSSVNGWKVPRYKFFLFVLIGSFVWYWVPGFLFTGLSYFNIVLWGPKT 310

Query: 310 RHNFIANAIFGVESGLGAIPITFDYTQISQAMTGSVFATPFWVSANTYASXXXXXXXXXX 369
           RHNF+ N IFGV SG+GA+PI+FDYTQISQAMTGSVFATPFWVSANTYAS          
Sbjct: 311 RHNFVLNTIFGVSSGIGALPISFDYTQISQAMTGSVFATPFWVSANTYASVLIFFVFLLP 370

Query: 370 XXYFTNTWYAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSPLYVPFSYLLS 429
             YFTNTWYAKYMP+ISTST+DN Q  YNVT+ILNPDF++NLEKYK YSPL+VPFSYLLS
Sbjct: 371 ILYFTNTWYAKYMPVISTSTFDNTQKKYNVTRILNPDFTVNLEKYKSYSPLFVPFSYLLS 430

Query: 430 YALNFAAVTAVFVHCALYHGKDIISKLRNSNHGGSDIHMRLYSKNYKDCPDWWYGALQVV 489
           YALNFAAV AVFVHC LYHGKDI  KL+++N GGSDIH RLY +NYKDCPDWWY  LQV+
Sbjct: 431 YALNFAAVIAVFVHCGLYHGKDIYGKLKDANFGGSDIHRRLYQQNYKDCPDWWYLVLQVI 490

Query: 490 TLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAMTNQHVGLNIITELVCGYML 549
            LGLGFA VCG+DTHFPAWAFV+ALLI+FAN +PQGILEA+TNQHVGLN+ITELVCGYML
Sbjct: 491 MLGLGFAAVCGFDTHFPAWAFVVALLIAFANFIPQGILEAITNQHVGLNVITELVCGYML 550

Query: 550 PLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIYASLISGLVNVGIQ 609
           P +PMAN+LFKLYGFIVMR GL LSRDLKLALYMK+ PRLIF +QIYA+++SGLVNVG+Q
Sbjct: 551 PFRPMANLLFKLYGFIVMRQGLSLSRDLKLALYMKIPPRLIFCIQIYATIVSGLVNVGVQ 610

Query: 610 EWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSLPQYLFSPGRIYNPLMWFFLIGLVV 669
           EWMRHNI   CS  Q +GFIC+NGRT+FNASIIWS+P+YLFS GRIYNPLMWFFLIGL +
Sbjct: 611 EWMRHNIKDFCSPDQSNGFICANGRTVFNASIIWSMPKYLFSSGRIYNPLMWFFLIGLGL 670

Query: 670 PFIVFFLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTPYNYSLFFATSFLLNEIRKRWPRW 729
           P  +F LQ   P   FLKY H+P+FF GPGNIPPSTPYNYSLFFA SF L  IR+RWP W
Sbjct: 671 PLAIFGLQLLLPKVNFLKYIHTPIFFAGPGNIPPSTPYNYSLFFAMSFWLYIIRRRWPLW 730

Query: 730 FGKYNFVMGSGVEAGVALSVTIIFLCVQYPGGKVNWWGNSVWKNTYDHQYKKFYHLNKGE 789
           F KYNFVMG+GVEAGVA+SV +IFLCVQYPGG + WWGN VWKNTYD+Q KK+Y +  G+
Sbjct: 731 FKKYNFVMGAGVEAGVAISVLVIFLCVQYPGGTLKWWGNDVWKNTYDYQSKKYYTVKAGD 790

Query: 790 TFGYDKWW 797
            FGYDKWW
Sbjct: 791 KFGYDKWW 798

>KNAG0G02310 Chr7 complement(530112..532484) [2373 bp, 790 aa] {ON} 
          Length = 790

 Score = 1140 bits (2949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/794 (68%), Positives = 641/794 (80%), Gaps = 17/794 (2%)

Query: 16  STSSLEQTV-PLDTGKVSYVPNPEFEQERQIVKTLSATIDLEDPSEKGSLLQDQDDAI-- 72
           S  S E++V  L+ G+V YV     +    I+   +++   +   + G +++     +  
Sbjct: 2   SIPSEEESVHTLEDGEVHYV-----KHGANIISYDTSSTIEKTKGKTGVVVESVQSFVED 56

Query: 73  ---------WEGDPTYLPNSPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQ 123
                    WEGDPT + NSPY +VRA VP  DDPTIE+NHWRTWFLTTVFVI+FAGVNQ
Sbjct: 57  EEEEDDGLDWEGDPTDMKNSPYAQVRAVVPVGDDPTIEINHWRTWFLTTVFVILFAGVNQ 116

Query: 124 FFSLRYPSLSINFIVAQVICYPIGKILATLPDWKCKRVPFFDLNPGPFTKKEHAVVTIAV 183
           FFSLRYPSL+INF+VAQV CYPIGK+L+ LPDWKCKR  FFDLNPGPFTKKEHA+VTI+V
Sbjct: 117 FFSLRYPSLTINFLVAQVCCYPIGKLLSWLPDWKCKRCHFFDLNPGPFTKKEHAIVTISV 176

Query: 184 ALTSSTAYAMNILIAQTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWP 243
           ALTSSTAYAM +L AQT FY  K   GYQ LLVWTSQMLGYGAAGL+RRW+V PA+CVWP
Sbjct: 177 ALTSSTAYAMYVLNAQTAFYKKKQSVGYQFLLVWTSQMLGYGAAGLTRRWIVYPAACVWP 236

Query: 244 QTLISVSLFDALHSGKIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFI 303
           QTLI+VSLFD+LH+  IDKTIVNGW +TRY+FF +V L SFVWYW+PG+LFTGLS FN I
Sbjct: 237 QTLIAVSLFDSLHNTAIDKTIVNGWRITRYRFFFFVLLGSFVWYWVPGYLFTGLSNFNVI 296

Query: 304 LWGPKTRHNFIANAIFGVESGLGAIPITFDYTQISQAMTGSVFATPFWVSANTYASXXXX 363
           LWGPKTR+NFI N IFGV+SG+G +P+TFDYTQISQA+TGSVFATPF+V ANTYAS    
Sbjct: 297 LWGPKTRNNFIVNTIFGVKSGMGLMPVTFDYTQISQALTGSVFATPFYVVANTYASVFIF 356

Query: 364 XXXXXXXXYFTNTWYAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSPLYVP 423
                   YF N WYAKYMP+IS +TYDN   S+NVTK++NPDF+INLEKYK YSP+ VP
Sbjct: 357 FMIVLPFLYFYNVWYAKYMPVISGTTYDNTGKSFNVTKVINPDFTINLEKYKKYSPIMVP 416

Query: 424 FSYLLSYALNFAAVTAVFVHCALYHGKDIISKLRNSNHGGSDIHMRLYSKNYKDCPDWWY 483
           FSYLL+YALNFAAV AVFVHC LYHGKDI+    N  HGG DIH R Y KNY DCPDWWY
Sbjct: 417 FSYLLAYALNFAAVVAVFVHCGLYHGKDIMKGFTNRFHGGRDIHTRTYLKNYNDCPDWWY 476

Query: 484 GALQVVTLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAMTNQHVGLNIITEL 543
           G +QVV  GLGFATVCG+D+  P WAF+IA+++S  N +PQGILEAMTNQHVGLNIITEL
Sbjct: 477 GIVQVVVAGLGFATVCGFDSGLPVWAFIIAIMLSLVNFIPQGILEAMTNQHVGLNIITEL 536

Query: 544 VCGYMLPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIYASLISGL 603
           +CGYMLPL+PM+N+LFKLYGFIVMR GL+LSRDLKL +YMKV PRL+F +Q+YA++ISG+
Sbjct: 537 ICGYMLPLRPMSNLLFKLYGFIVMRQGLELSRDLKLGVYMKVPPRLLFFIQMYATIISGM 596

Query: 604 VNVGIQEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSLPQYLFSPGRIYNPLMWFF 663
           V VGIQEWM  +ID +CS TQKDGFIC+NGRT+FNASIIWSLP+YLFSP R+Y+PLMWFF
Sbjct: 597 VTVGIQEWMYVHIDDVCSTTQKDGFICANGRTMFNASIIWSLPKYLFSPHRLYSPLMWFF 656

Query: 664 LIGLVVPFIVFFLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTPYNYSLFFATSFLLNEIR 723
           LIGL+VP  V+  Q+ F  NQFLK+ ++PVFFTGPGNIPPSTPYNY+L+FA  ++L  IR
Sbjct: 657 LIGLLVPLGVYAAQRVFKKNQFLKHINTPVFFTGPGNIPPSTPYNYTLYFAMGYMLFTIR 716

Query: 724 KRWPRWFGKYNFVMGSGVEAGVALSVTIIFLCVQYPGGKVNWWGNSVWKNTYDHQYKKFY 783
           KR+PRWF KYNFVMG+ VE GVA++V IIFLCVQYP G + WWGN+VWKNTYD +YK +Y
Sbjct: 717 KRFPRWFNKYNFVMGAAVETGVAIAVVIIFLCVQYPAGNIKWWGNTVWKNTYDGKYKTYY 776

Query: 784 HLNKGETFGYDKWW 797
            L K ETFG  KWW
Sbjct: 777 TLKKNETFGPQKWW 790

>SAKL0G15224g Chr7 complement(1311409..1313826) [2418 bp, 805 aa]
           {ON} similar to uniprot|P40897 Saccharomyces cerevisiae
           YJL212C OPT1 Plasma membrane transporter that transports
           tetra- and pentapeptides and glutathione member of the
           OPT family
          Length = 805

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/763 (39%), Positives = 450/763 (58%), Gaps = 26/763 (3%)

Query: 47  KTLSATIDLE-DP-SEK--GSLLQDQDDAIWEGDPTYLPNSPYPEVRATVPNTDDPTIEL 102
              SAT   E DP SEK   + L+D+   I     T   +SPYPEVRA VP+TDDP +  
Sbjct: 56  SAFSATRSAEYDPLSEKLSAAALEDEYAGI-----TIEDDSPYPEVRAAVPSTDDPLLPQ 110

Query: 103 NHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFIVAQVICYPIGKILAT-LPDWKC-KR 160
           N  R W L  +   +   +N  FSL  PS+ +   V  ++ +P+GK     +PD +   +
Sbjct: 111 NTVRMWTLGLIMTTIGCALNMLFSLHSPSIVLTTFVTSILAWPLGKAWERFIPDVRVFGK 170

Query: 161 VPFFDLNPGPFTKKEHAVVTIA--VALTSSTAYAMNILIAQTNFYNMKLGAGYQVLLVWT 218
                LNPGPF  KEHA++TI   V+     AYA +IL+A  NFY+   G G+ +L +W+
Sbjct: 171 YGGPSLNPGPFNLKEHALITIMGNVSFGGGNAYATDILLAMNNFYHKNFGWGFNLLAIWS 230

Query: 219 SQMLGYGAAGLSRRWVVNPASCVWPQTLISVSLFDALHSGKIDKTIVNGWSMTRYKFFLY 278
           +Q +G+  AGL++  +V PAS VWP  L++ +    LH  +  K   NGW+++R KFF  
Sbjct: 231 TQCIGFAMAGLAKDVLVTPASMVWPSNLVTCTFLTNLHVNENHKA--NGWTISRLKFFFL 288

Query: 279 VFLFSFVWYWLPGFLFTGLSYFNFILWGPKTRHNFIANAIFGVESGLGAIPITFDYTQIS 338
           +F+  FV+YW PGF+F  LSYF ++ W     +N I N +FG  +GLG IP+TFD+ QI+
Sbjct: 289 IFVIGFVYYWFPGFIFQALSYFAWVTW--IKPNNVIVNQVFGASTGLGIIPLTFDWNQIA 346

Query: 339 QAMTGSVFATPFWVSANTYASXXXXXXXXXXXXYFTNTWYAKYMPIISTSTYDNQQNSYN 398
               GS    P  V      S            +++N WY KY+PI  + +YD  Q SYN
Sbjct: 347 -GYVGSPLIPPAGVIFTILLSMVSIFWVVVPAIHYSNVWYGKYLPISDSGSYDRFQGSYN 405

Query: 399 VTKILNPDFSINLEKYKGYSPLYVPFSYLLSYALNFAAVTAVFVHCALYHGKDIISKLRN 458
           V++I+  + + +   Y  YSPLY+  ++ +SY ++FA+ TA  VH AL+HGKDI +++R 
Sbjct: 406 VSRIVGDNLTFDKAAYNKYSPLYLSATFAISYGMSFASTTATVVHAALFHGKDIWNQVRR 465

Query: 459 SNHGGSDIHMRLYSKNYKDCPDWWYGALQVVTLGLGFATVCGWDTHFPAWAFVIALLISF 518
                 D+H RL  + YKD P WWY  + VV  GL  AT+ GW+T  P +A VIALLI+ 
Sbjct: 466 VKTEEKDVHARLM-QQYKDTPQWWYAIVFVVFFGLSIATIRGWNTEMPVFALVIALLIAA 524

Query: 519 ANIVPQGILEAMTNQHVGLNIITELVCGYMLPLKPMANVLFKLYGFIVMRHGLDLSRDLK 578
             ++P GI+ A+TN  VGLN+ITE + GYMLP KP+A + FK +G+I     +  ++D+K
Sbjct: 525 FFLLPIGIIYALTNISVGLNVITEFIIGYMLPGKPIAMMFFKTFGYITNNQAITFAQDMK 584

Query: 579 LALYMKVSPRLIFAVQIYASLISGLVNVGIQEWMRHNIDGICSKTQKDGFICSNGRTIFN 638
           L  YMKV+PR++F+ Q  A++   LV + + +W + NI  IC   QK  F C   R  FN
Sbjct: 585 LGHYMKVAPRIMFSAQFVATIWGSLVQICVLKWAQGNIKDICEPHQKSHFTCPGSRVFFN 644

Query: 639 ASIIWSL--PQYLFSPGRIYNPLMWFFLIGLVVPFIVFFLQKKFPSNQFLKYCHSPVFFT 696
           AS+IW +  PQ +FS G++YN +M+FFL+G ++P + + + KK+P N  +++ + PVFF+
Sbjct: 645 ASVIWGVIGPQRMFSSGQMYNKVMYFFLLGALLPIVNWLILKKWP-NSLVRHLNWPVFFS 703

Query: 697 GPGNIPPSTPYNYSLFFATSFLLN-EIRKRWPRWFGKYNFVMGSGVEAGVALSVTIIFLC 755
           G G IPP+TPYNY  +          ++++W  W+ KYN+ + +G++  +A S  +IFLC
Sbjct: 704 GTGLIPPATPYNYGAYCMVGIFFGYYVKQKWFHWWSKYNYSLSAGLDISLAWSSLMIFLC 763

Query: 756 VQYPGGKV-NWWGNSVWKNTYDHQYKKF-YHLNKGETFGYDKW 796
           +        +WWGN+V  NT D++       L + ++FG  KW
Sbjct: 764 LSLTNTDAPSWWGNNV-INTSDYEGTAIQVQLEEDQSFGLTKW 805

>KLTH0E01496g Chr5 complement(146000..148444) [2445 bp, 814 aa] {ON}
           similar to uniprot|P40897 Saccharomyces cerevisiae
           YJL212C OPT1 Plasma membrane transporter that transports
           tetra- and pentapeptides and glutathione member of the
           OPT family
          Length = 814

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/770 (38%), Positives = 450/770 (58%), Gaps = 23/770 (2%)

Query: 38  EFEQERQIVKTLSATIDLEDPSEKGSLLQDQDDAIWEGDPTYLPNSPYPEVRATVPNTDD 97
           + E+ R +      + D +    K S + + D+       T   +SPYPEVRA+VP+TDD
Sbjct: 57  DIEKSRSVGLAALRSADYDPLGGKISAIAENDE---YAGITVEDDSPYPEVRASVPSTDD 113

Query: 98  PTIELNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFIVAQVICYPIGKIL-ATLPDW 156
           P++  N  R W +  +   +  G+N  FS+  P++ +   V  ++ +P+G+     +PD 
Sbjct: 114 PSLVQNTIRMWTIGMIMTTIGCGLNMLFSMHSPTIVLTTFVTSILAWPLGRAWDMVMPDK 173

Query: 157 KC-KRVPFFDLNPGPFTKKEHAVVTIA--VALTSSTAYAMNILIAQTNFYNMKLGAGYQV 213
               R     LNPGPF  KEHA++T    VA  S  AYA +I+++  NFYN   G G+ +
Sbjct: 174 PVFGRFGGPSLNPGPFNVKEHALITAMGNVAFGSGNAYATDIILSMNNFYNKDFGWGFDL 233

Query: 214 LLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLISVSLFDALHSGKIDKTIVNGWSMTRY 273
           L VW++Q +G+  AGLSR+ +V PAS +WP  L++ +    +H    +  + NGW ++R 
Sbjct: 234 LAVWSTQCIGFAMAGLSRKVLVTPASMIWPANLVTCTFLTNMHIN--ENHVANGWKISRL 291

Query: 274 KFFLYVFLFSFVWYWLPGFLFTGLSYFNFILW-GPKTRHNFIANAIFGVESGLGAIPITF 332
           KFF+ VF+  FV+YW PGF+F  LSYF ++ W  PK   + I N +FG  +GLG IP+TF
Sbjct: 292 KFFMIVFIVGFVYYWFPGFIFQALSYFAWVTWIKPK---DVIVNQVFGASTGLGLIPLTF 348

Query: 333 DYTQISQAMTGSVFATPFWVSANTYASXXXXXXXXXXXXYFTNTWYAKYMPIISTSTYDN 392
           D+ QI+    GS    P  V A    S            +++N WY KY+PI  + +YD 
Sbjct: 349 DWNQIA-GYVGSPLVPPLGVIATILLSMVIIFWIVVPAVHYSNIWYGKYLPISDSGSYDR 407

Query: 393 QQNSYNVTKILNPDFSINLEKYKGYSPLYVPFSYLLSYALNFAAVTAVFVHCALYHGKDI 452
            QN+YNV+KI++   + N + Y+ YSPLY+  ++ +SY L+FA   A   H   +HGK I
Sbjct: 408 FQNTYNVSKIVSESLTFNKDAYREYSPLYLSATFAISYGLSFAGTMATITHAICFHGKQI 467

Query: 453 ISKLRN-SNHGGSDIHMRLYSKNYKDCPDWWYGALQVVTLGLGFATVCGWDTHFPAWAFV 511
              +RN ++    D+H +L  +NY+D P WW+  + ++  GL  ATV  W T  P +  +
Sbjct: 468 WGAIRNITSSEEEDVHAKLM-RNYRDVPQWWFIVVFLIFFGLSIATVRAWPTEMPVFTLI 526

Query: 512 IALLISFANIVPQGILEAMTNQHVGLNIITELVCGYMLPLKPMANVLFKLYGFIVMRHGL 571
           IALLI+F  ++P GI+ A+TN  VGLN+ITE + GYM P KP+A + FK +G+I     +
Sbjct: 527 IALLIAFFFLLPVGIIYALTNIAVGLNVITEFIIGYMTPGKPIAMMFFKTFGYITNNQAI 586

Query: 572 DLSRDLKLALYMKVSPRLIFAVQIYASLISGLVNVGIQEWMRHNIDGICSKTQKDGFICS 631
             ++D+K+  YMKV+PR++F+ Q+ A++  GLV + + +W + NI+ IC+  QK  F C 
Sbjct: 587 TFAQDMKIGHYMKVAPRVLFSAQLVATVWGGLVQMCVMKWAQGNIEDICTSKQKSHFTCP 646

Query: 632 NGRTIFNASIIWSL--PQYLFSPGRIYNPLMWFFLIGLVVPFIVFFLQKKFPSNQFLKYC 689
             +  FNASIIW +  PQ +FS G++Y+ LM+FF++G  +P + + + KK+P    ++Y 
Sbjct: 647 GSKVFFNASIIWGVIGPQRMFSAGQMYDKLMYFFILGAGLPVVNWLVLKKWP-RSLVRYL 705

Query: 690 HSPVFFTGPGNIPPSTPYNYSLFFATSFLLNE-IRKRWPRWFGKYNFVMGSGVEAGVALS 748
           + PVFF+G G IPP+TPYNY  +          I+K +  W+ KYN+ + +G++  +A S
Sbjct: 706 NWPVFFSGTGLIPPATPYNYGAYCMVGIFFGYFIKKNYFNWWAKYNYSLSAGLDISLAWS 765

Query: 749 VTIIFLCVQYPGGKV-NWWGNSVWKNTYDHQYKKFYH-LNKGETFGYDKW 796
             IIFL +        +WWGN+V  NT D+      H L  GE+FG  KW
Sbjct: 766 SLIIFLALGLTNTDAPSWWGNNV-INTIDYDGTAIQHQLTDGESFGLKKW 814

>KLLA0E00419g Chr5 (28957..31341) [2385 bp, 794 aa] {ON} similar to
           uniprot|P40897 Saccharomyces cerevisiae YJL212C OPT1
           Plasma membrane transporter that transports tetra- and
           pentapeptides and glutathione member of the OPT family
          Length = 794

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/817 (36%), Positives = 457/817 (55%), Gaps = 52/817 (6%)

Query: 8   NFEKFERTSTSSLEQTVPLDTGKVSYVPNPEFEQERQIVKTLSATIDLEDPSE------- 60
           N  K   ++ + + + V LD G           QER  + +    ++LED          
Sbjct: 2   NHIKSVLSADAPVTEKVLLDVG-----------QERSFINSSDDNLNLEDKKRGLEVNVF 50

Query: 61  ------------KGSLLQDQDDAIWEGDPTYLPNSPYPEVRATVPNTDDPTIELNHWRTW 108
                          +++D+   I   D     +S YPEVRA VP++DDPT+  N  R W
Sbjct: 51  AARSDYLLGSQLSHEVIEDEYAGIVVED-----DSAYPEVRAAVPSSDDPTLPQNTVRMW 105

Query: 109 FLTTVFVIVFAGVNQFFSLRYPSLSINFIVAQVICYPIGKIL-ATLPDWKC-KRVPFFDL 166
            +  +   V +G+N  FSL  PS+ ++  V  ++ +PIGK     +PD K   R     L
Sbjct: 106 VIGMLMATVGSGLNLLFSLHSPSIVLSAFVTSILAWPIGKAWDKVMPDVKLFGRFGGPSL 165

Query: 167 NPGPFTKKEHAVVTIA--VALTSSTAYAMNILIAQTNFYNMKLGAGYQVLLVWTSQMLGY 224
           NP PF  KEH ++ I   V+     AYA +I +A  N++    G G+ ++ +  +Q +G+
Sbjct: 166 NPSPFNLKEHCLIQIMANVSFGGGEAYATDIFLAMNNYFEADFGWGFDIVTILATQCIGF 225

Query: 225 GAAGLSRRWVVNPASCVWPQTLISVSLFDALHSGKIDKTIVNGWSMTRYKFFLYVFLFSF 284
             AGL +  ++ PAS +WP  L++ +    LH    +  + NGW ++R KFF  VF+  F
Sbjct: 226 ALAGLVKDILITPASMIWPSNLVTCTFLTNLHIN--ENHMANGWKISRLKFFFMVFIIGF 283

Query: 285 VWYWLPGFLFTGLSYFNFILWGPKTRHNFIANAIFGVESGLGAIPITFDYTQISQAMTGS 344
           V+YW PGF+F  LSYF ++ W      N I N IFG  +GLG IP+TFD+ QI+    GS
Sbjct: 284 VYYWFPGFIFQALSYFAWVTW--IRPDNVIINQIFGASTGLGIIPLTFDWNQIA-GYVGS 340

Query: 345 VFATPFWVSANTYASXXXXXXXXXXXXYFTNTWYAKYMPIISTSTYDNQQNSYNVTKILN 404
               P     +   S            +++N W+ KY+PI  + +YD  Q SYNV+KI+ 
Sbjct: 341 PLVPPVSTIFSILLSMIMIFWVTVPAIHYSNVWFGKYLPISDSGSYDRFQQSYNVSKIVT 400

Query: 405 PDFSINLEKYKGYSPLYVPFSYLLSYALNFAAVTAVFVHCALYHGKDIISKLRNSNHGGS 464
           P+ S +++ YK YSPLY+P ++++SY ++FA+ TA  VH  L+HGK+I    RN      
Sbjct: 401 PNLSFDIDAYKSYSPLYLPATFVISYGMSFASNTATLVHAGLFHGKEITGAFRNVKKEQE 460

Query: 465 DIHMRLYSKNYKDCPDWWYGALQVVTLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQ 524
           DIH RL  KNY+D P WWYG + +V  GL  A +  W+T  P WA + AL+I+   +VP 
Sbjct: 461 DIHNRLM-KNYRDVPHWWYGIVFLVFFGLAIAGIRAWNTEMPVWALIFALVIAGVFLVPI 519

Query: 525 GILEAMTNQHVGLNIITELVCGYMLPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMK 584
           GI+ A+T+  VGLN++TE + GY+LP KP+A + FK +G+I     +  ++D+KL  YMK
Sbjct: 520 GIICAVTSISVGLNVLTEFIIGYILPGKPIAMMFFKTFGYITNHQAVTYAQDMKLGHYMK 579

Query: 585 VSPRLIFAVQIYASLISGLVNVGIQEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWS 644
           ++PRL+F+ Q  A++ S +V V + +W + NI  +C   QK  F C N R  FNA+IIW 
Sbjct: 580 IAPRLMFSAQFIATVWSSVVQVCVLKWAQGNITDVCDAHQKSHFTCPNARVFFNAAIIWG 639

Query: 645 L--PQYLFSPGRIYNPLMWFFLIGLVVPFIVFFLQKKFPSNQFLKYCHSPVFFTGPGNIP 702
           +  PQ +FS G++Y+ ++WFFLIG  +P I + + KK+P +  +KY + PVFF+G G IP
Sbjct: 640 VIGPQRMFSSGQLYSKVLWFFLIGASLPLINWLVLKKWPKSP-IKYLNWPVFFSGTGLIP 698

Query: 703 PSTPYNYSLFFATSFLLNE-IRKRWPRWFGKYNFVMGSGVEAGVALSVTIIFLCVQYPGG 761
           P+TPYNY  +          I+++W  W+ KYN+ + + ++  +A S  +IF C+     
Sbjct: 699 PATPYNYGSYCMVGITFGYFIKRKWFHWWTKYNYSLSAALDISLAWSSLMIFFCLTLTNT 758

Query: 762 KV-NWWGNSVWKNTYDHQYKKFYH-LNKGETFGYDKW 796
              NWWGN+V  +T D++       LN GE+FG  KW
Sbjct: 759 NAPNWWGNTV-IDTIDYEGTAIQSILNDGESFGLTKW 794

>SAKL0F14674g Chr6 complement(1170374..1172791) [2418 bp, 805 aa]
           {ON} similar to uniprot|P40897 Saccharomyces cerevisiae
           YJL212C OPT1 Plasma membrane transporter that transports
           tetra- and pentapeptides and glutathione member of the
           OPT family
          Length = 805

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/801 (36%), Positives = 460/801 (57%), Gaps = 22/801 (2%)

Query: 9   FEKFERTSTSSLEQTVPLDTGK--VSYVPNPEFEQERQIVKTLSATIDLEDPSEKGSLLQ 66
           F + +   +S+ +++   D+GK  + + P      + + + + +   D  DP+E G  + 
Sbjct: 14  FTEQDSIRSSNSDRSFDTDSGKDRIVFFPQEASVAKAEPIASTAFQNDSIDPNELGRKVS 73

Query: 67  DQ--DDAIWEGDPTYLPNSPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQF 124
            +  DD       T   +SPY EVRA VP+TD+P I  N  R W L  +   + + +N  
Sbjct: 74  SEVLDDG--YAGITVDDDSPYAEVRAAVPSTDNPVIPQNTIRMWTLGFIMTTIGSAINML 131

Query: 125 FSLRYPSLSINFIVAQVICYPIGKILAT-LPDWKC-KRVPFFDLNPGPFTKKEHAVVTIA 182
           FS+  PS+ +   V  ++ +P+GK  A  LPD +   +     LNPGPF  KEH ++T+ 
Sbjct: 132 FSMHSPSIILTTFVTSILAWPLGKAWARFLPDVRIFGKYGGPSLNPGPFNLKEHTLITVM 191

Query: 183 --VALTSSTAYAMNILIAQTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASC 240
             V+     AYA +IL++  NFY    G G+ +L +W++Q +G+  AGL+++ +V P++ 
Sbjct: 192 GNVSFGGGNAYATDILLSMNNFYGTDFGWGFGLLAIWSTQCIGFSLAGLAKKILVTPSTM 251

Query: 241 VWPQTLISVSLFDALHSGKIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYF 300
           +WP  L++ +    LH    +    +GW+++R +FF  VFL  F++YW PGF+F GLSYF
Sbjct: 252 IWPSNLVTCTFLTNLHIN--ENHSASGWTISRLRFFFLVFLIGFLYYWFPGFIFEGLSYF 309

Query: 301 NFILWGPKTRHNFIANAIFGVESGLGAIPITFDYTQISQAMTGSVFATPFWVSANTYASX 360
            ++ W     +N + N +FG  +GLG IPITFD+ QI+   TGS    P  V      S 
Sbjct: 310 AWVTW--IKPNNVVINQVFGASTGLGLIPITFDWNQIA-GYTGSPLIPPVGVLVTILLSM 366

Query: 361 XXXXXXXXXXXYFTNTWYAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSPL 420
                      +++N WY KY+PI  + +YD  Q  YNV+KI++   + +   YK YSPL
Sbjct: 367 VIIFWIVVPIIHYSNVWYGKYLPISDSESYDRFQQPYNVSKIVDDSLTFDPAGYKKYSPL 426

Query: 421 YVPFSYLLSYALNFAAVTAVFVHCALYHGKDIISKLRNSNHGGSDIHMRLYSKNYKDCPD 480
           Y+  S+ ++Y ++FA+ TA  VH  L+HGKD+  + R+      D+H RL  + YK+ P 
Sbjct: 427 YLSASFAIAYGMSFASTTATIVHAVLFHGKDVWDQARSLKVEEEDVHARLM-REYKETPC 485

Query: 481 WWYGALQVVTLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAMTNQHVGLNII 540
           WWY  + +V  GL   TV  W+T  P +A +IAL+I+   ++P GI+ A+TN  VGLN+ 
Sbjct: 486 WWYAIVFLVFFGLAVVTVRVWNTEMPVYALIIALVIAAFFLLPIGIIYALTNIPVGLNVF 545

Query: 541 TELVCGYMLPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIYASLI 600
           TE + GYMLP KP+A + FK +G+I     +  ++D+KL  YMKV+PRL+F  Q  A++ 
Sbjct: 546 TEFIVGYMLPGKPIAMMFFKTFGYITNNQAIIFAQDMKLGHYMKVAPRLLFTAQFLATIW 605

Query: 601 SGLVNVGIQEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSL--PQYLFSPGRIYNP 658
             LV + + +W +  I G+CS  QKD + C   R  FNAS+IW +  P  +FS G+IYN 
Sbjct: 606 GSLVQICVLKWAQDTIPGLCSDDQKDNYTCPGSRVFFNASVIWGVIGPDKMFSSGKIYNG 665

Query: 659 LMWFFLIGLVVPFIVFFLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTPYNYSLFFATSFL 718
           L++FFL+G ++P I + + +K+P N  ++Y + PVFF+G   IPP+TP+NY  +      
Sbjct: 666 LLYFFLLGAILPVINWLILRKWP-NSLIQYMNWPVFFSGTAMIPPATPFNYGAYCMVGIF 724

Query: 719 LN-EIRKRWPRWFGKYNFVMGSGVEAGVALSVTIIFLCVQYPGGKV-NWWGNSVWKNTYD 776
               +R++W  W+ KYN+ + +G++ G+A S  IIFLC+        +WWGNSV  +T D
Sbjct: 725 FGYYVRRKWFHWWSKYNYSLSAGLDIGLAWSSLIIFLCLYLTNASFPDWWGNSVVDSTMD 784

Query: 777 HQYKKF-YHLNKGETFGYDKW 796
                    L+ GE+FG   W
Sbjct: 785 SWGTAIQRQLSDGESFGLTSW 805

>Kwal_55.19788 s55 complement(125184..127616) [2433 bp, 810 aa] {ON}
           YJL212C (OPT1) - Oligopeptide transporter; Opt1p
           transports tetra- and pentapeptides, including the
           endogenous opioid pentapeptide leucine enkephalin.
           [contig 159] FULL
          Length = 810

 Score =  538 bits (1387), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 285/772 (36%), Positives = 440/772 (56%), Gaps = 24/772 (3%)

Query: 40  EQERQIVKTLSATIDLEDPSEKGSLLQDQDDAIWEGD---PTYLPNSPYPEVRATVPNTD 96
             E  + KT S  +     ++   L     +A+   +    T   +SPYPEVRA VP++D
Sbjct: 48  SSEHDLEKTKSGHLLPRQSADFDPLAAQLSEAVVNDEYAGITVEDDSPYPEVRAAVPSSD 107

Query: 97  DPTIELNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFIVAQVICYPIGK----ILAT 152
           D ++  N  R W L  +   +  G+N  FS+  PS+ +   V  ++ +P+G+    I+  
Sbjct: 108 DTSLVQNTVRMWTLGMIMSTIGCGLNMLFSMHSPSIVLTTFVTSILAWPLGRGWDLIMPD 167

Query: 153 LPDWKCKRVPFFDLNPGPFTKKEHAVVTIA--VALTSSTAYAMNILIAQTNFYNMKLGAG 210
            P +     P    NPGPF  KEHA++T    V+    +AYA +I+++  NFYN   G G
Sbjct: 168 KPMFGRFGGP--SWNPGPFNVKEHALITAMGNVSFGGGSAYATDIILSMNNFYNKDFGWG 225

Query: 211 YQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLISVSLFDALHSGKIDKTIVNGWSM 270
           + +L  W++Q +G+  AGL R  +V PAS +WP  L++ +    +H    +  + NGW++
Sbjct: 226 FDLLATWSTQCIGFAMAGLVRNVLVTPASMIWPANLVTTTFLTNMHVN--ENHVANGWTI 283

Query: 271 TRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFILWGPKTRHNFIANAIFGVESGLGAIPI 330
           +R KFFL +FL  F++YW PGF+F  LSYF ++ W     ++ I N +FG  SGLG IP+
Sbjct: 284 SRLKFFLIIFLAGFIYYWFPGFIFQALSYFAWVTW--IKPNDVIVNQVFGASSGLGLIPL 341

Query: 331 TFDYTQISQAMTGSVFATPFWVSANTYASXXXXXXXXXXXXYFTNTWYAKYMPIISTSTY 390
           TFD+ QI+    GS    P  V      S            +++N WY KY+PI  +S+Y
Sbjct: 342 TFDWNQIA-GYVGSPLVPPLGVIVTILLSMILIFWVVVPAVHYSNVWYGKYLPISDSSSY 400

Query: 391 DNQQNSYNVTKILNPDFSINLEKYKGYSPLYVPFSYLLSYALNFAAVTAVFVHCALYHGK 450
           D  Q +YNV+KI++ + S +   Y+ YSPLY+  ++ +SY L+FA +T+  +H   +HGK
Sbjct: 401 DRYQGTYNVSKIVSENLSFDKAAYEEYSPLYLSATFAISYGLSFAGITSTIMHAICFHGK 460

Query: 451 DIISKLRNSNHG-GSDIHMRLYSKNYKDCPDWWYGALQVVTLGLGFATVCGWDTHFPAWA 509
            I   +RN       D+H RL  + Y+D P WWY  + V+  G+  AT+  W T  P + 
Sbjct: 461 LIWDHMRNIKRAEDEDVHARLM-RQYRDVPQWWYLIVFVIFFGMSVATIRAWPTEMPVFT 519

Query: 510 FVIALLISFANIVPQGILEAMTNQHVGLNIITELVCGYMLPLKPMANVLFKLYGFIVMRH 569
            +IALLI+F  ++P GI+ A+TN  VGLN+ITE + GYM P KP+A + FK YG+I    
Sbjct: 520 LIIALLIAFFFLLPVGIIYALTNISVGLNVITEFIIGYMTPGKPIAMMFFKTYGYITNNQ 579

Query: 570 GLDLSRDLKLALYMKVSPRLIFAVQIYASLISGLVNVGIQEWMRHNIDGICSKTQKDGFI 629
            +  ++D+KL  Y+K++PR++FA Q+ A++   LV + + +W + NI+ +C++ Q   F 
Sbjct: 580 AITFAQDMKLGHYLKLAPRVLFAAQLIATIWGSLVQICVMKWAQGNIEDVCTRKQASHFT 639

Query: 630 CSNGRTIFNASIIWSL--PQYLFSPGRIYNPLMWFFLIGLVVPFIVFFLQKKFPSNQFLK 687
           C   R  FNASIIW +  PQ +FS G++YN LM+FF++G  +P + + + KK+P + ++K
Sbjct: 640 CPGARVFFNASIIWGVIGPQRMFSAGQMYNKLMYFFILGAGLPVVNWLILKKWPGS-YIK 698

Query: 688 YCHSPVFFTGPGNIPPSTPYNYSLFFATSFLLN-EIRKRWPRWFGKYNFVMGSGVEAGVA 746
           Y + PVFF+G G IPP+TPYNY  +     +    I+ R+  W+ KYN+ + +G++  +A
Sbjct: 699 YLNWPVFFSGTGLIPPATPYNYGAYCMVGIIFGYYIKTRFFNWWAKYNYTLSAGLDISLA 758

Query: 747 LSVTIIFLCVQYPGGKV-NWWGNSVWKNTYDHQYKKFYH-LNKGETFGYDKW 796
            S  IIFL +         WWGN V   T D  Y      L +GE FG   W
Sbjct: 759 WSSLIIFLALGLTNTDAPKWWGNDVMNGTMDTNYTAVQRTLQEGEFFGLKSW 810

>Ecym_7185 Chr7 (379870..382272) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii ABR156W
          Length = 800

 Score =  498 bits (1281), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 276/757 (36%), Positives = 427/757 (56%), Gaps = 51/757 (6%)

Query: 45  IVKTLSATIDLEDPSEKGSLLQDQDDAIWEGDPTYLPNSPYPEVRATVPNTDDPTIELNH 104
           ++  LS  +D++   E  SL  + D             SPYPEVRA VP+ DD ++  N 
Sbjct: 52  LIDKLSGQVDVD---EYASLTVEGD-------------SPYPEVRAAVPSYDDSSLLQNT 95

Query: 105 WRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFIVAQVICYPIGKILAT-LPDWKC---KR 160
            R W +      V + +N  FS+  P +++   V  ++ +P+GK     +P+W+      
Sbjct: 96  VRMWAIGLFMTTVGSALNMLFSMHTPPIALTAFVTSLMGWPMGKAWEYFVPNWRLFGPLG 155

Query: 161 VPFFDLNPGPFTKKEHAVVTIA--VALTSSTAYAMNILIAQ--TNFYNMKLGAGYQVLLV 216
            P+  LNP PF  KEHA++TI   VA     AYA +IL++    +FYN   G  + +L V
Sbjct: 156 GPY--LNPTPFNLKEHALITIMGNVAFGGGNAYATDILLSMHIKDFYNRNYGWAFDLLAV 213

Query: 217 WTSQMLGYGAAGLSRRWVVNPASCVWPQTLISVSLFDALHSGKIDKTIVNGWSMTRYKFF 276
           W++Q +G+  AG+  + +V PA  +WP  L++ +    +H    +  + NGW ++R KFF
Sbjct: 214 WSTQCIGFSLAGMCHQILVKPAVMIWPSALVTCTFLTNIHIN--ENHVANGWKISRLKFF 271

Query: 277 LYVFLFSFVWYWLPGFLFTGLSYFNFILW-GPKTRHNFIANAIFGVESGLGAIPITFDYT 335
           L VF+  FVWYW+PG+LF  L  F + LW  PK   N I N +FG ++G+G +P+TFD+ 
Sbjct: 272 LIVFIIGFVWYWIPGYLFQALGTFVWPLWIAPK---NVIVNQLFGPQTGMGLLPLTFDWN 328

Query: 336 QISQAMTGSVFATPFWVSANTYASXXXXXXXXXXXXYFTNTWYAKYMPIISTSTYDNQQN 395
           QIS   TGS    P         S            +++N WY KY+P+  + +YD  QN
Sbjct: 329 QIS-GFTGSPLVPPVSAIITIAISVVSIFWILLPIIHYSNIWYGKYLPMSRSKSYDRYQN 387

Query: 396 SYNVTKILNPDFSINLEKYKGYSPLYVPFSYLLSYALNFAAVTAVFVHCALYHGKDIISK 455
           +YNV+ I++   S++ ++Y+ YSPLY+P S+ +SY ++FA++TA  +H  L+HGKDI+++
Sbjct: 388 TYNVSAIVDETLSLDKQEYQNYSPLYLPTSFAISYGMSFASITATVMHTILFHGKDIVAR 447

Query: 456 LRNSNHGGSDIHMRLYSKNYKDCPDWWYGALQVVTLGLGFATVCGWDTHFPAWAFVIALL 515
           +R+      D+H RL  K+YK  P WWY  + +V L +  A + GWDT  P WA + AL 
Sbjct: 448 MRSLKTEEEDVHARLM-KSYKTVPWWWYACVFLVFLAMSIAVIAGWDTQMPIWALIFALG 506

Query: 516 ISFANIVPQGILEAMTNQHVGLNIITELVCGYMLPLKPMANVLFKLYGFIVMRHGLDLSR 575
           I+   ++P GI+ A+TN  VGLN+ITE + GY+LP +P+A + FK +G+I     +  ++
Sbjct: 507 IATVFLLPVGIIYALTNISVGLNVITEFLIGYVLPGRPIAMMFFKTFGYITNNQAITFAQ 566

Query: 576 DLKLALYMKVSPRLIFAVQIYASLISGLVNVGIQEWMRHNIDGICSKTQKDG-FICSNGR 634
           D+K+  Y+K++PRL+F  Q  A++  G V V +  W   NI  +C+   KDG F C +  
Sbjct: 567 DMKIGHYLKLAPRLMFTAQFLATIWGGTVQVAVMRWAEGNIPDLCT---KDGSFNCPHAT 623

Query: 635 TIFNASIIWSL--PQYLFSPGRIYNPLMWFFLIGLVVPFIVFFLQKKFPS---------N 683
             FNASIIW +  PQ +FS G++Y+ L +FF+ G ++P I + +  K+P           
Sbjct: 624 VFFNASIIWGVIGPQRMFSSGQLYSKLNYFFIAGAILPVINWLILNKWPKRFEKYGRIPK 683

Query: 684 QFLKYCHSPVFFTGPGNIPPSTPYNYSLFFATSFLLNEIRKR-WPRWFGKYNFVMGSGVE 742
              KY   PVFF+G G IPP+T YNY  +           KR W  W+ KYN+ + + ++
Sbjct: 684 ICAKYLSWPVFFSGTGMIPPATAYNYGAYCILGIFFGYFVKRYWFHWWTKYNYSLSAALD 743

Query: 743 AGVALSVTIIFLCVQ-YPGGKVNWWGNSVWKNTYDHQ 778
            G+A S  I+F     +     +WWGN+V  NT D +
Sbjct: 744 IGLAWSALIVFFSTSIHTVNPPSWWGNNVVSNTLDSK 780

>ABR156W Chr2 (692938..695328) [2391 bp, 796 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YJL212C (OPT1)
          Length = 796

 Score =  488 bits (1256), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 273/767 (35%), Positives = 419/767 (54%), Gaps = 33/767 (4%)

Query: 50  SATIDLEDPSEKGSLLQDQDDAIWEGDPTYLPN------SPYPEVRATVPNTDDPTIELN 103
           + +++   P E      D++ A  EGD     +      SPYPEVRA VP+ DD T+  N
Sbjct: 33  TVSVETPGPFETSEKKVDKEGADTEGDSGEFTDVLVEDDSPYPEVRAAVPSFDDTTMLQN 92

Query: 104 HWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFIVAQVICYPIGKILAT-LPDWKC-KRV 161
             R W +  +   + + VN  FS+  PS++++  V  ++ +P+G+  A  +P+ +   R 
Sbjct: 93  TVRMWTIGLLMTTIGSAVNMLFSMHAPSMAVSTFVTSMLAWPLGRFWARWVPNVRIFGRF 152

Query: 162 PFFDLNPGPFTKKEHAVVTIA--VALTSSTAYAMNILIAQTNFYNMKLGAGYQVLLVWTS 219
               LNPGPF+ KEHA++T+   ++     AYA +IL++   FY    G  + +L +W++
Sbjct: 153 GGPFLNPGPFSLKEHALITVMGNISFGGGAAYATDILLSMNMFYKRDYGWLFDLLAIWST 212

Query: 220 QMLGYGAAGLSRRWVVNPASCVWPQTLISVSLFDALHSGKIDKTIVNGWSMTRYKFFLYV 279
           Q +G+  AGL  + ++ P   +WP TL+  +    +H    +  + NGW ++R KFF+ +
Sbjct: 213 QCIGFSLAGLCYKILITPPLMIWPSTLVQCTFLSNIHIH--NNKVANGWKVSRLKFFMII 270

Query: 280 FLFSFVWYWLPGFLFTGLSYFNFILW-GPKTRHNFIANAIFGVESGLGAIPITFDYTQIS 338
           F+  F++YWLPG+LF  LS F ++ W  PK   N + N IFG  +GLG +PITFD+ QI+
Sbjct: 271 FIAGFIYYWLPGYLFQALSSFAWVTWIAPK---NVVVNQIFGSSTGLGLLPITFDWNQIA 327

Query: 339 QAMTGSVFATPFWVSANTYASXXXXXXXXXXXXYFTNTWYAKYMPIISTSTYDNQQNSYN 398
               GS    P         S            +++NTWY  Y+PI  +++ D  Q  YN
Sbjct: 328 -GYVGSPLVPPISAIFTILCSMVTIFWIVVPIVHYSNTWYGNYVPISDSTSMDRFQQRYN 386

Query: 399 VTKILNPDFSINLEKYKGYSPLYVPFSYLLSYALNFAAVTAVFVHCALYHGKDIISKLRN 458
           VTK++N   S++LE Y  YS LY+P ++ +SY ++FA+V A   H A +H + I + +RN
Sbjct: 387 VTKVVNQRLSLDLEAYHSYSRLYLPTTFAISYGMSFASVMATISHTACFHWRTIYNGVRN 446

Query: 459 SNHGGSDIHMRLYSKNYKDCPDWWYGALQVVTLGLGFATVCGWDTHFPAWAFVIALLISF 518
            N    D+H RL  + YK  P WWY     V L L  ATV  WDT  P WA  +AL I+ 
Sbjct: 447 INTQDRDVHARLMER-YKAPPYWWYLVTFFVFLALSIATVRAWDTQLPVWALFLALAIAG 505

Query: 519 ANIVPQGILEAMTNQHVGLNIITELVCGYMLPLKPMANVLFKLYGFIVMRHGLDLSRDLK 578
             ++P GI+ A+TN  VGLN+ITE + GYMLP +P+A + FK +G+I     +  ++D+K
Sbjct: 506 FFLLPVGIIYALTNMAVGLNVITEFIIGYMLPGRPIAMMFFKTFGYITNSQAITFAQDMK 565

Query: 579 LALYMKVSPRLIFAVQIYASLISGLVNVGIQEWMRHNIDGICSKTQKDGFICSNGRTIFN 638
           L  Y+KV+P+L+F  Q  A++    V + +  W   NI G+C+K Q   F C      F 
Sbjct: 566 LGHYLKVAPKLMFTAQFIATIWGSTVQIAVLRWSEANIKGLCTKAQPGHFTCPGATVFFT 625

Query: 639 ASIIWSL--PQYLFSPGRIYNPLMWFFLIGLVVPFIVFFLQKKFPSNQF----------L 686
           ASIIW +  PQ +FS G++Y+ L +FF++G  +P + + +  K+ S +F           
Sbjct: 626 ASIIWGVIGPQRMFSAGQMYSSLNYFFVLGFFLPIVNWLILSKW-SKRFEKSGRGLKFVA 684

Query: 687 KYCHSPVFFTGPGNIPPSTPYNYSLFFATSFLLNEIRKRWP-RWFGKYNFVMGSGVEAGV 745
           KY   PVFF+G G IPP+TPYNY  +           KR+  +W+ KYN+ + + ++ G+
Sbjct: 685 KYLSWPVFFSGTGLIPPATPYNYGSYCIVGIFFGYFIKRYYFQWWCKYNYSLSAALDIGL 744

Query: 746 ALSVTIIFLCVQYPGGKVN-WWGNSVWKNTYDHQYKKFYHLNKGETF 791
           A    IIF        K   WWGN+V      +     Y L +GE F
Sbjct: 745 AWGALIIFFSTGIAVRKAPVWWGNTVIDTLDTNGQAIKYILQEGEYF 791

>ZYRO0G22484g Chr7 (1848658..1851123) [2466 bp, 821 aa] {ON} similar
           to uniprot|O59822 Schizosaccharomyces pombe SPCC1840
           SPCC965.02 protein and weakly similar to YJL212C
           uniprot|P40897 Saccharomyces cerevisiae YJL212C OPT1
           Plasma membrane transporter that transports tetra- and
           pentapeptides and glutathione member of the OPT family
          Length = 821

 Score =  330 bits (846), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 198/687 (28%), Positives = 347/687 (50%), Gaps = 22/687 (3%)

Query: 103 NHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFIVAQVICYPIGKILAT-LPDWK--CK 159
           N  R W ++ +  +V AG++ FF+ R+PS+SI  IVAQ+I YP G I A  +P+WK    
Sbjct: 129 NTLRMWLMSIILSMVIAGIDSFFAFRFPSISIGPIVAQLISYPCGIIWARIMPNWKFSIG 188

Query: 160 RVPFFDLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFYNMKLGAGYQVLLVWTS 219
               F+LNPG F+ +E A+V +      +T    N  + Q  F+ + +G G  +L     
Sbjct: 189 SKYTFELNPGNFSPQEQALVYLFCNTVIATGLLRNTQVEQIKFFKVDVGIGRFILFDMVG 248

Query: 220 QMLGYGAAGLSRRWVVNPASCVWPQTLISVSLFDALHSGKIDKTIVNGWSMTRYKFFLYV 279
            ++ +G AGLS   +V+    +WP  L   +L +ALHSG   K  ++ +   ++ FF+  
Sbjct: 249 YLIAWGMAGLSIPMLVDREELIWPSVLSPSALINALHSGT--KGSISDFKKPKFSFFMIA 306

Query: 280 FLFSFVWYWLPGFLFTGLSYFN-FILW-GPKTRHNFIANAIFGVESGLGAIPITFDYTQI 337
           F  SFVWYW    +F  ++    F  W  PK +   +   +FGV++GLG +PI+FD+  I
Sbjct: 307 FAGSFVWYWFSDLIFPFIASLGAFPSWIRPKNK---VLGQVFGVKNGLGLLPISFDWPTI 363

Query: 338 SQAMTGSVFATPFWVSANTYASXXXXXXXXXXXXYFTNTWYAKYMPIISTSTYDNQQNSY 397
           S     +   TP W     +AS            Y+ N W   ++P++S   +D    SY
Sbjct: 364 SN--INNPLTTPVWAGVMIFASFFFWAWIVIPGLYYQNHWETAHLPLMSNKIFDKNGQSY 421

Query: 398 NVTKILNPDFSINLEKYKGYSPLYVPFSYLLSYALNFAAVTAVFVHCALYHGKDIISKLR 457
            V  ++N  + ++L+KYK YSP+Y+P  +L+  AL     +++ +        D+    +
Sbjct: 422 QVKNVVNSKWELDLDKYKQYSPVYLPIGFLIQLALGLGGFSSMMIFFFWKFKSDVWDPFK 481

Query: 458 NSNHGGSDIHMRLYSKNYKDCPDWWYGALQVVTLGLGFATVCGW--DTHFPAWAFVIALL 515
             +   +  +   Y+K +       +    V+ L LGF  V  W  DT   +  F+++++
Sbjct: 482 QHSTKKTAHYKSAYNKFFVAA----FIGSMVLGLALGFVFVEAWNRDTQIDSGGFIVSII 537

Query: 516 ISFANIVPQGILEAMTNQHVGLNIITELVCGYMLPLKPMANVLFKLYGFIVMRHGLDLSR 575
           I     +P  ++E+ ++  + +N    +V  +    KPMA + F  +G+ + +H +  ++
Sbjct: 538 IGIVLYLPVALVESKSSFTLNMNGFFNVVGAFWYKGKPMATLYFLNFGYSIFQHAMHFTQ 597

Query: 576 DLKLALYMKVSPRLIFAVQIYASLISGLVNVGIQEWMRHNIDGICSKTQKDGFICSNGRT 635
             KL  YMK  PRL   V   A + + LV   +  ++ +++  +C+    +  +C + +T
Sbjct: 598 GAKLGYYMKTPPRLTLFVLFVAGVWASLVTPSVTGYVLYHVGNVCTSNAHNNMVCRSQQT 657

Query: 636 IFNASIIWSL-PQYLFSPGRIYNPLMWFFLIGLVVPFIVFFLQKKFPSNQFLKYCHSPVF 694
            FN  IIW L   +LFS G  Y  +M+FFL+G  V  IV  +Q   P ++   +    + 
Sbjct: 658 AFNTQIIWGLFGSHLFSTGGRYQFIMYFFLVGAGVALIVILMQWWRPRSRVWSHVSPTLL 717

Query: 695 FTGPGNIPPSTPYNYSLFFATSFLLN-EIRKRWPRWFGKYNFVMGSGVEAGVALSVTIIF 753
            +G  ++P ST  +Y  +F +  + N  I ++ P+W+ KYN ++ S ++ GVA++  I++
Sbjct: 718 LSGAEDMPTSTGLHYGTWFMSILVFNFFIHRKRPQWWRKYNLILASALDCGVAIAAIIVY 777

Query: 754 LCVQYPGGKVN--WWGNSVWKNTYDHQ 778
             V Y GG  +  WW   V  ++ D +
Sbjct: 778 FAVTYTGGSSHYKWWATEVTSSSCDSK 804

>ZYRO0C18568g Chr3 (1457201..1459666) [2466 bp, 821 aa] {ON} similar
           to uniprot|O59822 Schizosaccharomyces pombe SPCC1840
           SPCC965.02 protein and weakly similar to YJL212C
           uniprot|P40897 Saccharomyces cerevisiae YJL212C OPT1
           Plasma membrane transporter that transports tetra- and
           pentapeptides and glutathione member of the OPT family
          Length = 821

 Score =  326 bits (835), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 218/785 (27%), Positives = 374/785 (47%), Gaps = 31/785 (3%)

Query: 5   QEKNFEKFERTSTSSLEQTVPLDTGKVSYVPNPEFEQERQIVKTLSATIDLEDPSEKGSL 64
           +EKN    E+    S   +   + G   +V   E  QE+  +K        EDP E GS 
Sbjct: 40  EEKNPTLTEKDPHISSSDSPNDEEGYHKFVGGKE--QEQTSIKKAGE----EDPFE-GSS 92

Query: 65  LQDQDDAIWEGDPTYLPNSPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQF 124
             D   +I   D   +  +    +       D P    N  R W +  +  +V   ++ F
Sbjct: 93  FNDSSSSIAAADVLDITRADIHHIVDFKETEDYP--PANTLRMWLMGIILSMVIGAIDTF 150

Query: 125 FSLRYPSLSINFIVAQVICYPIGKI-LATLPDWK--CKRVPFFDLNPGPFTKKEHAVVTI 181
           F+ R+PS++I+ IV Q+I YP G +    +P+WK        F+LNPG F+ +E A+V +
Sbjct: 151 FAFRFPSIAISPIVGQLISYPFGILWYRIMPNWKFSIGSRYTFELNPGKFSPQEQALVYL 210

Query: 182 AVALTSSTAYAMNILIAQTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASCV 241
                  T    N  + QT F+N+ +G G  +L      +L +G AGL+   +V+    +
Sbjct: 211 FCNTVYGTGVLKNTQVEQTRFFNVDVGIGRFILFNIVGYLLAWGMAGLAIPILVDREELI 270

Query: 242 WPQTLISVSLFDALHSGKIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYFN 301
           WP  L   +L +A HS    K   +     ++ FF+  F  SFVWYW    +   ++   
Sbjct: 271 WPSVLGPSALINAFHSDTKGK--FSDLKKPKFSFFMIAFAGSFVWYWFSDLILPFIANLG 328

Query: 302 -FILW-GPKTRHNFIANAIFGVESGLGAIPITFDYTQISQAMTGSVFATPFWVSANTYAS 359
            F  W  PK +   +   +FGV++GLG +PI+FD+  +S     +   TP W     +AS
Sbjct: 329 AFPSWIRPKNK---VLGQVFGVKNGLGLLPISFDWPTVSN--ISNPLTTPVWAGVMIFAS 383

Query: 360 XXXXXXXXXXXXYFTNTWYAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSP 419
                       Y+ + W   +MP++S   +D    SY V K++N  + ++ EKYK YSP
Sbjct: 384 FFFWAWVVIPGLYYQDHWQTAHMPLMSNKIFDKNGESYQVKKVVNKKWELDFEKYKKYSP 443

Query: 420 LYVPFSYLLSYALNFAAVTAVFVHCALYHGKDIISKLRNSNHGGSDIHMRLYSKNYKDCP 479
           +Y+P  +L+  AL     ++V          D+       +   +  +   Y+K +    
Sbjct: 444 VYLPIGFLIQLALGLGGFSSVMTFFFWKFKSDVWDPFMQHSTKKTAHYKPAYTKPFVAA- 502

Query: 480 DWWYGALQVVTLGLGFATVCGWD--THFPAWAFVIALLISFANIVPQGILEAMTNQHVGL 537
              Y A  V+ LGLGF  V  WD  T   +  FV++++I     +P  ++E+ ++  + +
Sbjct: 503 ---YIASMVLGLGLGFVFVEAWDRDTQIDSGGFVVSIIIGIVLFLPVALVESRSSFLLNM 559

Query: 538 NIITELVCGYMLPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIYA 597
           N I  ++  +    KPMA + F  +GF + +HG+  ++  KL  YMK  PRL   V + +
Sbjct: 560 NGILNVIGAFWYKGKPMATLYFLNFGFSLFQHGMHFTQGAKLGYYMKTPPRLTILVLLVS 619

Query: 598 SLISGLVNVGIQEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSL-PQYLFSPGRIY 656
            + + L+   +  ++ +++  +C+    +   C + +T FN  I+W L   +LFS G  Y
Sbjct: 620 GIWTSLIIPSVTGYVLYHVGNVCTPNAHNNMTCKSQQTAFNTQIVWGLFGSHLFSNGGRY 679

Query: 657 NPLMWFFLIGLVVPFIVFFLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTPYNYSLFFATS 716
             +M+FFL+G  V  IV  +Q + P+++F       +  +G  ++P ST  +Y  +F   
Sbjct: 680 QFIMYFFLVGAGVSLIVILMQWRRPNSRFWSKVSPTLLLSGAEDMPTSTGLHYGTWFFLV 739

Query: 717 FLLNE-IRKRWPRWFGKYNFVMGSGVEAGVALSVTIIFLCVQYPGGKVN--WWGNSVWKN 773
            + N  I K+ P W+ KYN ++ + ++ GVA++  I++  V Y GG  +  WW   V  +
Sbjct: 740 LVFNGFIHKKRPHWWRKYNLILATALDCGVAIAAIIVYFAVSYTGGSSHYKWWATEVTSS 799

Query: 774 TYDHQ 778
           + D +
Sbjct: 800 SCDSK 804

>YPR194C Chr16 complement(924304..926937) [2634 bp, 877 aa] {ON}
           OPT2Oligopeptide transporter; member of the OPT family,
           with potential orthologs in S. pombe and C. albicans;
           also plays a role in formation of mature vacuoles
          Length = 877

 Score =  325 bits (834), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 237/772 (30%), Positives = 384/772 (49%), Gaps = 62/772 (8%)

Query: 34  VPNPEFEQERQIVKTLSATIDLEDPSEKGSLLQDQDDAIWEGDPTYLPNSPYPEVRATVP 93
           +P+ ++E+ +++V       DLED   K  + +     I         +SPY EVRA V 
Sbjct: 102 IPHDQYEEWKRLV-------DLEDLDSKEGIDEYDSFDIRAFASAIKFHSPYQEVRAVVD 154

Query: 94  NTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFIVAQVICYPIGKILA-T 152
             DDPTI +  +R +FL  ++ ++ +G N+FFS R  S+S+N  + Q+  Y  GK  A T
Sbjct: 155 PEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPIIQMFLYICGKAWAKT 214

Query: 153 LPDWKCK-RVPFFDLN-PGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFYNMKLGAG 210
           +P W    R   + +N   P+T+KE    T+  A+     Y    ++ Q  FY+     G
Sbjct: 215 IPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAICQGAFYTHYNILTQKLFYHSAFSFG 274

Query: 211 YQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLISVSLFDALHSGKIDKTIVNGWSM 270
           YQ LL  + Q +G+G AG+ R++VV PA  +WP  + ++++  AL   +  ++      M
Sbjct: 275 YQFLLSLSVQFIGFGFAGILRKFVVYPARALWPTVMPTIAINKALLGKEKHES-----GM 329

Query: 271 TRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFILWGPKTRHNFIANAIFGVESGLGAIPI 330
           +RYKFF   F   F++ W P ++   L+ FN++ W   +  N +AN   GV +GLG  PI
Sbjct: 330 SRYKFFFLTFFIMFIYNWFPTYIINILNTFNWMTWIKPSNIN-LANITGGV-TGLGINPI 387

Query: 331 T-FDYTQISQAMTGSVFATPFWVSANTYASXXXXXXXXXXXXYFTNTWYAKYMPIISTST 389
           + FD+  IS     S    PFW     Y              Y++N    +Y+PI + S 
Sbjct: 388 SSFDWNVIS---FNSPLVYPFWSYLTQYLGCILAALIVIAV-YYSNYMSCQYLPIFTNSL 443

Query: 390 YDNQQNSYNVTKILNPDFSINLEKYKGYSPLYVPFSYLLSYALNFAAVTAVFVHCALYHG 449
           Y N  +S+ VT++L+ D  ++++KY+ YSP Y     L+SY     A   +     + H 
Sbjct: 444 YTNTGHSFKVTEVLDSDNKLDVKKYQSYSPPYYSAGNLVSYGAFICAYPLMITWSFIVHS 503

Query: 450 KDIISKLRN-------------------SNHGGSDIHMRLYS---KNYKDCPDWWYGALQ 487
           K + +  ++                   S++   D +   +S   KNYK+ PDWWY A+ 
Sbjct: 504 KLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKNYKEVPDWWYFAIL 563

Query: 488 VVTLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAMTNQHVGLNIITELVCGY 547
           + +L +G A V  + T+ P W   + L  +F  ++P  IL+A T    GLN++ E+V GY
Sbjct: 564 IGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPTTILQATTGYSFGLNLLIEMVMGY 623

Query: 548 MLPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIYASLISGLVNVG 607
            LP  P+A ++ K +G+ +     +   +LK+A Y K+ P  +F  Q     I   VN+G
Sbjct: 624 ALPGNPIAIMILKAFGYNIDGQADNYVSNLKIAHYCKIPPMALFRGQCVIVFIQIFVNLG 683

Query: 608 IQEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSLPQYLFSPGRIYN---PLM-WFF 663
           +  W   NI   C+  Q   F C +  T +NAS++W        P RI+N   P+  W +
Sbjct: 684 VLNWQISNIKDFCTPHQNAKFTCPDAVTYYNASVVWG----AIGPKRIFNYIYPIFKWCW 739

Query: 664 LIGLVVPFIVFFLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTPYNYSLFFATSFLLNEIR 723
           LIG  +  I F + K++   +F      P+ F G G +  S PYN  +++ +  +++ I 
Sbjct: 740 LIGACIG-IFFGVWKRW--GKFYPRYFDPMLFVG-GMLNMSPPYNL-MYYTSGMIVSYIS 794

Query: 724 KRWPR-----WFGKYNFVMGSGVEAGVALSVTIIFLCVQYPGGKVNWWGNSV 770
           + + +      + KYN+V+ +G   G+ LS  IIF  VQY     NWWGN+V
Sbjct: 795 QYYMKRHHLNLWEKYNYVLSAGFSTGLVLSAIIIFFAVQYKDTAFNWWGNTV 846

>TPHA0C05020 Chr3 (1085361..1088051) [2691 bp, 896 aa] {ON} 
          Length = 896

 Score =  325 bits (833), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 223/729 (30%), Positives = 363/729 (49%), Gaps = 51/729 (6%)

Query: 82  NSPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFIVAQV 141
           +SPY EVRA V  TDDP I +  +R++FL  +  IV +G N+FFS R  ++S+N  V Q+
Sbjct: 160 HSPYKEVRAVVEATDDPNIPVETFRSYFLALLCAIVGSGFNEFFSHRVVTISVNTSVIQM 219

Query: 142 ICYPIGKILAT-LPDW--KCKRVPFFDLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIA 198
             Y  GK     +P W    K   +      P+T KE    T+  A+ S T Y    ++ 
Sbjct: 220 FLYFFGKAWERYIPCWGISVKGRKYAINIDKPWTAKEQMFATLLFAICSGTFYTHYNILT 279

Query: 199 QTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLISVSLFDALHSG 258
           Q  +Y   +  GYQ  L  + Q LG+G AG+ RR+VV     +WP  + +++L  AL   
Sbjct: 280 QKVYYKEDVPFGYQFWLSLSVQFLGFGFAGILRRYVVYNPRALWPTVMTTLALNKALLDN 339

Query: 259 KIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFILWGPKTRHNFIANAI 318
           K DK    G  M+RYKFF   F   F++ W P ++   L+ FN++ W   +  N     I
Sbjct: 340 KQDK----GNGMSRYKFFFITFSAMFIYNWFPTYIINILNTFNWMTW--ISPQNLKLALI 393

Query: 319 FGVESGLGAIPI-TFDYTQISQAMTGSVFATPFWVSANTYASXXXXXXXXXXXXYFTNTW 377
            G  SGLG  P  +FD+  +S     S    PF+ +   +              YFTN  
Sbjct: 394 TGGVSGLGFNPFPSFDWNVVSNV---SPLIIPFYSNMTQFCGAFFAALVIIAV-YFTNYK 449

Query: 378 YAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYS------------------- 418
             +Y+P+ +   + N+   Y +T ILN DF I+ +KY+ YS                   
Sbjct: 450 DCQYLPMFTNPLFTNKATVYEITNILNSDFKIDEKKYQEYSAPYYTAGNLVAYGSFIALY 509

Query: 419 PLYVPFSYLLSYALNFAA----VTAVFVHCALYHGKDIISKLRNSNHGGSDIHMRLYSKN 474
           PL + +S++  + L   A    + +++   +    K   SK  ++     D H  +  KN
Sbjct: 510 PLLIVYSFITDWELLSGAFGLWINSLWSFRSWNQWKKTFSKQYSAMDSYDDAHSNMM-KN 568

Query: 475 YKDCPDWWYGALQVVTLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAMTNQH 534
           Y + PDWWY  + + ++ +       + T+ P WA  +++  +FA ++P  ILEA T   
Sbjct: 569 YAEVPDWWYFIILICSIIVAICVCEKYQTNTPIWALFVSIGFNFAFLIPLTILEATTGFS 628

Query: 535 VGLNIITELVCGYMLPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQ 594
            GLN++ E++ GY LP  P+A +L K +G+ +     +   +LK+  Y K+ P  +F  Q
Sbjct: 629 FGLNLLIEMIIGYALPGNPLALMLVKAFGYNIDGQADNYVSNLKMGHYSKIPPVALFRGQ 688

Query: 595 IYASLISGLVNVGIQEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSL--PQYLFSP 652
           +    I   VN+G+  W   NI G C++TQ   F C + +T +NAS++W    P+ +F+ 
Sbjct: 689 LIMVFIQIFVNLGVLNWSISNIKGFCTRTQSAKFTCPDAQTYYNASVVWGALGPKKIFN- 747

Query: 653 GRIYNPLMWFFLIGLVVPFIVFFLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTPYNYSLF 712
             +Y  L W +LIG ++  + F + ++F S  +  + +  +F  G  N+ P  PY   ++
Sbjct: 748 -EVYPILRWCWLIGALIG-LFFGIWRRFGSKYYPNWFNPVLFVGGMSNLSP--PYGL-MY 802

Query: 713 FATSFLLN-----EIRKRWPRWFGKYNFVMGSGVEAGVALSVTIIFLCVQYPGGKVNWWG 767
           F    ++N      +++   R + KYN+++ SG  +G+ LS  IIF  VQ+   +++WWG
Sbjct: 803 FIPGIVVNWFSQYYMKRNHLRLWSKYNYILDSGFTSGLVLSAIIIFFAVQFKDTELSWWG 862

Query: 768 NSVWKNTYD 776
           N+V  N  D
Sbjct: 863 NNVPYNGVD 871

>SAKL0D09350g Chr4 (775699..778362) [2664 bp, 887 aa] {ON} similar
           to uniprot|Q06593 Saccharomyces cerevisiae YPR194C OPT2
           Oligopeptide transporter member of the OPT family with
           potential orthologs in S. pombe and C. albicans
          Length = 887

 Score =  322 bits (824), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 232/725 (32%), Positives = 364/725 (50%), Gaps = 55/725 (7%)

Query: 82  NSPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFIVAQV 141
           +SPY EVRA V  +D+PTI +  +R +FL  V+ IV +G N+FFS R  S+SI+  V Q+
Sbjct: 151 HSPYAEVRAVVEPSDNPTIPVETFRAYFLALVWGIVGSGFNEFFSHRLVSISISTSVVQM 210

Query: 142 ICYPIGKILAT-LPDW----KCKRVPFFDLN-PGPFTKKEHAVVTIAVALTSSTAYAMNI 195
             Y  G + A  LP W    K KR   F LN   P+T KE    T+  A+ +   Y    
Sbjct: 211 FLYLCGTLWAKHLPCWGFTVKGKR---FALNIETPWTDKEQMFATLLFAICNGVFYTHYN 267

Query: 196 LIAQTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLISVSLFDAL 255
           ++ Q  +Y  K+  GYQ  L    Q +G+G AG+ RR+VV PA  +WP ++ +++L +AL
Sbjct: 268 ILTQKIYYGDKISFGYQFWLSICIQFIGFGFAGILRRFVVYPARTLWPTSMSTIALNNAL 327

Query: 256 HSGKIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFILWGPKTRHNFIA 315
            S   +K +  G  ++RY FF     F F++ W P +L   L+ FN++ W     +NF  
Sbjct: 328 LSR--EKDVSKG--LSRYSFFFIATTFMFLYTWFPTYLINILNTFNWMTW--IAPNNFDL 381

Query: 316 NAIFGVESGLGAIPIT-FDYTQISQAMTGSVFATPFWVSANTYASXXXXXXXXXXXXYFT 374
            AI G  SGLG  PI+ FD+  I+         TPF+  +  +A             Y+T
Sbjct: 382 AAITGGVSGLGINPISSFDWNVINFLYP---LVTPFFSYSVQFAGSFFAALVVIAV-YYT 437

Query: 375 NTWYAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSPLYVPFSYLLSYALNF 434
           N    +Y+PI S S + N    Y++ KILN D+ ++ EKY+ YSP +     L+SY    
Sbjct: 438 NYKDCQYLPIFSNSLFTNTGTPYSIKKILNSDYKVDEEKYQQYSPPFYSAGNLVSYGSFI 497

Query: 435 AAVTAVFVHCALYHGKDIISKLRNSNHG-----------------------GSDIHMRLY 471
           A    + ++  +   K ++   ++   G                        +D H  + 
Sbjct: 498 AVYPMLIIYAFITESKVLLGACKDWAKGIWSLRKWQSWTNMAKQEYHALDSFNDPHSNM- 556

Query: 472 SKNYKDCPDWWYGALQVVTLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAMT 531
            K YK+ PDWWY  + ++++ +    +  ++T+ P WA  ++L  +F  ++P  IL+A T
Sbjct: 557 MKKYKEVPDWWYFMILLISIVISIIVLEKYETNTPIWALFMSLGFNFVFLIPITILQATT 616

Query: 532 NQHVGLNIITELVCGYMLPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIF 591
              +GLN++ E++ GY LP  P A ++ K +G+ +     +   +LK+A Y K+ P  +F
Sbjct: 617 GFSIGLNLLIEMIIGYALPGNPYALMIVKAFGYNIDGQADNYVSNLKMAHYCKIPPVALF 676

Query: 592 AVQIYASLISGLVNVGIQEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSL--PQYL 649
             Q++   +  LVN+G+  W   NI   C   Q   F C + RT +NAS++W    P+ +
Sbjct: 677 RGQLFMVFVQVLVNLGVLNWQISNIKDFCQPNQASKFTCPDARTYYNASVMWGAMGPKKI 736

Query: 650 FSPGRIYNPLMWFFLIGLVVPFIVFFLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTPYNY 709
           F+   +Y  L W +LIG  +   VFF   K    ++     +P+ F G G I    PY  
Sbjct: 737 FN--DVYPILRWCWLIGACLG--VFFGLWKVYGRRYYPTWFNPILFVG-GMINMGPPYGL 791

Query: 710 SL----FFATSFLLNEIRKRWPRWFGKYNFVMGSGVEAGVALSVTIIFLCVQYPGGKVNW 765
                 FF + F    ++K   R + KYN+V  +   AG+  S  +IF  VQY    +NW
Sbjct: 792 MYVVPGFFVSFFSQFYLKKYHLRLWEKYNYVCDAAFSAGLVFSSIVIFFAVQYKQKDLNW 851

Query: 766 WGNSV 770
           WGN+V
Sbjct: 852 WGNTV 856

>Kpol_455.13 s455 (24582..27260) [2679 bp, 892 aa] {ON}
           (24582..27260) [2679 nt, 893 aa]
          Length = 892

 Score =  317 bits (812), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 230/771 (29%), Positives = 384/771 (49%), Gaps = 62/771 (8%)

Query: 34  VPNPEFEQERQIVKTLSATIDLEDPSEKGSLLQDQDDAIWEGDPTYLPNSPYPEVRATVP 93
           +P+ E+E+ + +    +  ID +    +  +L                +SPY EVRA V 
Sbjct: 119 IPSDEYEEIKYLSNPENIDIDDKKQCYEARILASMIKF----------HSPYKEVRAVVD 168

Query: 94  NTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFIVAQVICYPIGKILAT- 152
            TDDPTI +  +R++     + IV +G N+FFS R  ++SIN  V Q+  YP G + A  
Sbjct: 169 PTDDPTIPVETFRSYLFALFWAIVGSGFNEFFSHRQVTISINTSVVQMFLYPSGLLWAKY 228

Query: 153 LPDWKCK-RVPFFDLN-PGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFYNMKLGAG 210
           +P W    +   + +N   P+++KE    T+  ++ S T Y    ++ Q  +Y+  +  G
Sbjct: 229 VPCWGISIKGRKYAINIDKPWSQKEQMFSTLLFSICSGTFYTHYNILTQKVYYHDNVSFG 288

Query: 211 YQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLISVSLFDALHSGKIDKTIVNGWSM 270
           YQ LL  + Q LG+G AG+ R++VV P   +WP +  +++L  AL S K + T  NG  M
Sbjct: 289 YQFLLSLSIQFLGFGFAGILRKFVVYPTKALWPTSFPTIALNKALLSRKEENT--NG--M 344

Query: 271 TRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFILWGPKTRHNFIANAIFGVESGLGAIPI 330
           TRYKFF   F   F++ W P ++    + FN++ W   + +NF    I G  SG+G  PI
Sbjct: 345 TRYKFFFLTFFAMFIYNWFPTYIINIFNTFNWMTW--ISPNNFNLAMITGGVSGIGFNPI 402

Query: 331 -TFDYTQISQAMTGSVFATPFWVSANTYASXXXXXXXXXXXXYFTNTWYAKYMPIISTST 389
            +FD+   S     +    PF+ +   Y              Y+TN    +Y+P+ S + 
Sbjct: 403 ASFDWNVASYI---NPLRIPFFSNMTQYCGAVFAALVVIAV-YWTNYMDCQYLPLFSNTL 458

Query: 390 YDNQQNSYNVTKILNPDFSINLEKYKGYSPLYVPFSYLLSYALNFAAVTAVFVHCALYHG 449
           Y N+   Y VT++L+ D+ ++  KY+ YS  Y     L++Y    A    + V+  L   
Sbjct: 459 YTNRATRYQVTEVLDSDWKLDNAKYQEYSAPYYSAGNLVAYGSFIATYPMLIVYSMLTET 518

Query: 450 KDIISKLRN---------SNHGGS--------------DIHMRLYSKNYKDCPDWWYGAL 486
           K + S ++            H  +              D H R+  KNYK+ PDWWY  +
Sbjct: 519 KLLWSAMKQWTLSLWSLTKKHTWTNLLTQESCALDEFDDPHSRM-MKNYKEVPDWWYFVV 577

Query: 487 QVVTLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAMTNQHVGLNIITELVCG 546
            +  +G+G A +  + T+ P W+  +++  + A ++P  +L+A     +GLN++ E++ G
Sbjct: 578 LLAAIGVGIAVIEAYHTNTPVWSLFVSIGFNVAFLIPLTMLQATAGFSLGLNLLIEMIVG 637

Query: 547 YMLPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIYASLISGLVNV 606
           Y LP  P A ++ K +G+ +     +   +LK+A Y K+ P  +F  Q+    +   VN+
Sbjct: 638 YALPGNPFALMIIKAFGYNIDGQADNYVSNLKMAHYTKIPPIALFRGQMIMVFLQIFVNL 697

Query: 607 GIQEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSL--PQYLFSPGRIYNPLMWFFL 664
           G+  W   NI G C+  QK  F C +  T +NAS++W    P+ +F+   +Y  L W +L
Sbjct: 698 GVLNWQISNIKGFCTHDQKAKFTCPDATTYYNASVVWGALGPKKIFN--DVYPILRWCWL 755

Query: 665 IGLVVPFIVFFLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTPYNYSLFFATSFLLN---- 720
           IG  +  + F + K+F   +F     +P+ F G G I  + PY   ++F    +++    
Sbjct: 756 IGACIG-LFFGVWKRF--GKFYPTWFNPILFVG-GMINMAPPYGL-MYFTPGIIVSYLSQ 810

Query: 721 -EIRKRWPRWFGKYNFVMGSGVEAGVALSVTIIFLCVQYPGGKVNWWGNSV 770
              +K   R + KYN+++ +G  +G+ LS  IIF  VQY G   +WWGN+V
Sbjct: 811 YHFKKYHLRLWEKYNYILDAGFTSGLVLSAIIIFFAVQYEGTNFSWWGNNV 861

>Skud_16.498 Chr16 complement(866362..868995) [2634 bp, 877 aa] {ON}
           YPR194C (REAL)
          Length = 877

 Score =  316 bits (809), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 231/770 (30%), Positives = 385/770 (50%), Gaps = 58/770 (7%)

Query: 34  VPNPEFEQERQIVKTLSATIDLEDPSEKGSLLQDQDDAIWEGDPTYLPNSPYPEVRATVP 93
           +P+ ++E+ +++V       +LE+   K  + +     I         +SPY EVRA V 
Sbjct: 102 LPHDQYEEWKRLV-------ELENSYSKEGVDEYDSFDIRAFASAIKFHSPYQEVRAVVD 154

Query: 94  NTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFIVAQVICYPIGKILA-T 152
             DDPTI +  +R +FL  ++ I+ +G N+FFS R  ++S+   + Q+  Y  GK  A T
Sbjct: 155 PDDDPTIPVETFRAYFLAVIWSIIGSGFNEFFSHRVVTISLETPIIQMFLYLCGKAWAKT 214

Query: 153 LPDWKCK-RVPFFDLNPG-PFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFYNMKLGAG 210
           +P +    R   + +N   P+T+KE    T+  A+   T Y    ++ Q  FY+     G
Sbjct: 215 VPCYGITVRGTKYGININRPWTQKEQMFATLLYAICQGTFYTHYNILTQKLFYHSAFSFG 274

Query: 211 YQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLISVSLFDALHSGKIDKTIVNGWSM 270
           YQ LL  + Q +G+G AG+ R++VV PA  +WP  + ++++  AL   + +++      M
Sbjct: 275 YQFLLSLSVQFIGFGFAGILRKFVVYPARALWPTVMPTIAINKALLGKEKNES-----GM 329

Query: 271 TRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFILWGPKTRHNFIANAIFGVESGLGAIPI 330
           +RYKFF   F   F++ W P ++   L+ FN++ W   +  N +AN   GV +GLG  PI
Sbjct: 330 SRYKFFFLTFFIMFIYNWFPTYIINILNTFNWMTWIKPSNIN-LANITGGV-TGLGINPI 387

Query: 331 T-FDYTQISQAMTGSVFATPFWVSANTYASXXXXXXXXXXXXYFTNTWYAKYMPIISTST 389
           + FD+  IS   + S    PFW     Y              Y++N    +Y+P+ + S 
Sbjct: 388 SSFDWNVIS---SNSPLVYPFWSYLTQYLGSVLAALIVVAI-YYSNYMNCQYLPMFTNSL 443

Query: 390 YDNQQNSYNVTKILNPDFSINLEKYKGYSPLYVPFSYLLSYALNFAAVTAVFVHCALYHG 449
           Y N  +S+ VT IL+    ++L+KY+ YSP Y     L++Y     A   +     + H 
Sbjct: 444 YTNTGDSFKVTNILDSSNKLDLKKYQSYSPPYYSAGNLVTYGAFICAYPLMIAWSFIVHS 503

Query: 450 KDIISKLRN-------------------SNHGGSDIHMRLYS---KNYKDCPDWWYGALQ 487
           K + S  ++                   S++   D +   +S   +NYK+ P+WWY A+ 
Sbjct: 504 KILFSAFKDWALSLWALRKLKAWVIMYKSDYKALDDYDDPHSIAMRNYKEVPEWWYFAIL 563

Query: 488 VVTLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAMTNQHVGLNIITELVCGY 547
           + +L +G A V  + T+ P W   ++L  +F  ++P  IL+A T    GLN++ E+V GY
Sbjct: 564 IASLIVGIAVVEHYPTNTPVWGLFVSLGFNFVFLIPTTILQATTGFSFGLNLLIEMVMGY 623

Query: 548 MLPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIYASLISGLVNVG 607
            LP  P+A ++ K +G+ +         +LK+A Y K+ P  +F  Q    LI   VN+G
Sbjct: 624 ALPGNPVAIMILKAFGYNIDGQADSYVSNLKIAHYCKIPPMALFRGQCVIVLIQIFVNLG 683

Query: 608 IQEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSL--PQYLFSPGRIYNPLMWFFLI 665
           +  W   NI   C+  Q   F C +  T +NAS++W    P+ +F+   IY    W +LI
Sbjct: 684 VLNWQISNIKNFCTPHQDAKFTCPDAVTYYNASVVWGAIGPKRIFN--HIYPIFKWCWLI 741

Query: 666 GLVVPFIVFFLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTPYNYSLFFATSFLLNEIRKR 725
           G  +  ++F + K++   +F      P+ F G G +  S PYN  +++    +++ I + 
Sbjct: 742 GACIG-VLFGVWKRW--GRFYPRNFDPMLFVG-GMLNMSPPYNL-MYYTPGMIVSYISQY 796

Query: 726 WPR-----WFGKYNFVMGSGVEAGVALSVTIIFLCVQYPGGKVNWWGNSV 770
           + +      + KYN+V+ +G   G+ LS  IIF  VQY     NWWGN+V
Sbjct: 797 YMKRHHLNLWEKYNYVLSAGFSTGLVLSAIIIFFAVQYRDTSFNWWGNTV 846

>KLLA0D15378g Chr4 complement(1303787..1306396) [2610 bp, 869 aa]
           {ON} similar to uniprot|Q06593 Saccharomyces cerevisiae
           YPR194C OPT2 Oligopeptide transporter member of the OPT
           family with potential orthologs in S. pombe and C.
           albicans
          Length = 869

 Score =  315 bits (808), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 239/780 (30%), Positives = 377/780 (48%), Gaps = 68/780 (8%)

Query: 40  EQERQIVKTLSATIDL----EDPSEKGSLLQDQDDAIWEGDPTYL-------------PN 82
           E  + + KTL    D     ED  E+   L D+DD + +G   +               +
Sbjct: 76  ESLKILEKTLKEHEDDANLPEDLIERTRSLLDRDDYLKQGHSEFEWFEQCKIDAAMIHYH 135

Query: 83  SPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFIVAQVI 142
           SPYPEVR      DD TI +  +R +FL   + I+ AGVN+FF  R P +S+   V Q++
Sbjct: 136 SPYPEVRTVTSPIDDETIPIETFRAYFLGFFWTILGAGVNEFFVHRKPKISLTAPVMQIL 195

Query: 143 CYPIGKILA-TLPD--WKCKRVPFFDLNPGPFTKKEHAVVTIAVALTSSTAY-AMNILIA 198
            YP GK+    +P+  +K  ++   + NPGP++ KE    TI   + +S  Y + NI + 
Sbjct: 196 LYPCGKLFERVMPNHTFKLGKISV-NFNPGPWSFKEQMFSTIIFNVATSYTYVSHNIYVQ 254

Query: 199 QTN-FYNMK-LGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLISVSLFDALH 256
           +   FYN K L  GY+VLL+  SQ+LG+G AG+ R++V+    C+WP    +++L  AL 
Sbjct: 255 RLEIFYNNKWLDFGYEVLLMLCSQLLGFGYAGILRKFVIYNEKCIWPTLFPTLALNGALL 314

Query: 257 SGKIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFILW-GPKTRHNFIA 315
                K  +NGW MTRYKFFL  F+  F++ W+P +LF GLS F+++ W  PK   NF  
Sbjct: 315 KPD-SKENINGWRMTRYKFFLTFFVIMFIYNWIPTYLFEGLSTFSWLTWCSPK---NFDL 370

Query: 316 NAIFGVESGLGAIPI-TFDYTQISQAMTGSVFATPFWVSANTYASXXXXXXXXXXXXYFT 374
             + G + GLG  P+ TFD+  I      ++   PF+   N Y              Y  
Sbjct: 371 AVVTGSQYGLGLNPVPTFDWNIIDYNYALTI---PFFSQLNQYIGTFIGFFAILGIYYSN 427

Query: 375 NTWYAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSPLYVPFSYLLSYALNF 434
             W A ++P+ S   + N+  SY V  IL+ +  +   KY+ YSP Y     LL Y   F
Sbjct: 428 YKWTA-FLPLNSNDIFTNRGESYVVQDILDENSMLVESKYQEYSPPYYSAGNLLVYGGIF 486

Query: 435 AAVTAVFVHCALYHGKDIIS---------------KLRNSNHGGSDIHMRLYSKNYKDCP 479
           A     F++        I+                 +++S + G D       K YKD P
Sbjct: 487 AQYPFAFLYVFFTEWASILQCFKQMYRQIKNFRNVSIKSSTYDGFDDPQTRLMKKYKDVP 546

Query: 480 DWWYGALQVVTLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAMTNQHVGLNI 539
           DWW+  + VV L LG   +  + T  P W     L I+F  ++P   + +MT  ++ + +
Sbjct: 547 DWWFLVVLVVALVLGILCIKLYPTQTPVWGLFFILGINFVFLIPICFIFSMTGFNMTMGV 606

Query: 540 ITELVCGYMLPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIYASL 599
           ITE++ GY LP   +A +  K  G+ +         D KLA Y K+  R +F  Q+   L
Sbjct: 607 ITEIIIGYALPGNGLALMTLKSLGYTIDNQAESYIADQKLAHYAKIPQRAVFKGQLVGVL 666

Query: 600 ISGLVNVGIQEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSLPQYLFSPGRIYNP- 658
           I   V++G+  W   N+  IC+   ++ F C      +++S+ W     +  P R++N  
Sbjct: 667 IQCFVSLGVISWQIVNVKDICTSKAENKFTCPKEVNFYSSSVFWG----VIGPKRVFNGL 722

Query: 659 ---LMWFFLIGLVVPFIVFFLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTPYNYS----- 710
              L + FLIG ++  +   ++  FP     +  H  +     G +    PYN S     
Sbjct: 723 YPILKYTFLIGFLLCLLCCAIKYFFPRQT--RLFHPTILI---GGMQQFAPYNLSYVTAG 777

Query: 711 LFFATSFLLNEIRKRWPRWFGKYNFVMGSGVEAGVALSVTIIFLCVQYPGGKVNWWGNSV 770
           L+F+  F+   I++ + +W+ KYN+V+ +   + VA S  IIF  V+Y    ++WWGN++
Sbjct: 778 LYFSFGFMF-YIKRYYTKWWEKYNYVLAAAFSSAVAFSAIIIFFSVKYKPKPIDWWGNNI 836

>ZYRO0D13332g Chr4 complement(1121064..1123733) [2670 bp, 889 aa]
           {ON} similar to uniprot|Q06593 Saccharomyces cerevisiae
           YPR194C OPT2 Oligopeptide transporter member of the OPT
           family with potential orthologs in S. pombe and C.
           albicans
          Length = 889

 Score =  314 bits (805), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 230/799 (28%), Positives = 380/799 (47%), Gaps = 68/799 (8%)

Query: 14  RTSTSSLEQTVP-LDTGKVSYVPNPEFEQER--QIVKTLSATIDLEDPSEKGSLLQDQDD 70
           + +T SLE  V  +    V +  +P   Q+   + V+       L +P E     QD  D
Sbjct: 86  KIATMSLEDAVAVMKESAVYHKDDPNIPQDELDEYVRLSELDPALLEPHE-----QDYYD 140

Query: 71  AIWEGDPTYLPNSPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLRYP 130
            +      +  +SPY  VRA V   DDP   +  +R++ L  ++ I+ +G N+FF+ R  
Sbjct: 141 LMAMAGLLHW-HSPYRSVRACVDPRDDPDAPIETFRSYTLALIWAIIGSGFNEFFAHRLL 199

Query: 131 SLSINFIVAQVICYPIGKILA------TLPDWKCKRVPFFDLN-PGPFTKKEHAVVTIAV 183
           +++IN  + Q++ +P+G + A      + P WK KR+    +N P P+ +KE    TI  
Sbjct: 200 TITINSAMVQMLLFPMGNLWAKFMPYWSFPIWKGKRI---HINYPQPWNQKEQMFSTILF 256

Query: 184 ALTSSTAYAMNILIAQTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWP 243
           A+ S+T Y    ++ Q  +Y+  +  GYQ  L    Q LG G AG  RR+V+ P+  +WP
Sbjct: 257 AICSTTFYTHYNILTQKMYYHEAVSFGYQFFLSIGVQYLGLGFAGSLRRFVIYPSKAIWP 316

Query: 244 QTLISVSLFDALHSGKIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFI 303
             L +++L  AL S + +K   N   +TR  FF     F F + W+P +LF  LS FN++
Sbjct: 317 SQLQTMALNKALFSRREEK---NSKGLTRQTFFFICTGFIFFYQWIPTYLFQALSTFNWM 373

Query: 304 LWGPKTRHNFIANAIFGVESGLGAIPI-TFDYTQISQAMTGSVFATPFWVSANTYASXXX 362
            W      NF    + G   G+G  PI +FD+  I+         TP + S         
Sbjct: 374 TW--IKPDNFDLAMVTGSVGGVGFNPIASFDWNVINNYF---CLVTPLF-SYMCQMIGAL 427

Query: 363 XXXXXXXXXYFTNTWYAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSPLYV 422
                    Y++N +  +++P+ S + + N  +S+ +  ILN  + ++++KY+ YSP Y 
Sbjct: 428 IAAICVLAMYYSNQYDCQFLPMFSNALFTNTGDSFEINAILNKKYEVDVKKYQNYSPPYY 487

Query: 423 PFSYLLSYALNFAAVTAVFVHC--------------------ALYHGKDIISKLRNSNHG 462
               +  Y    A+   +F +                     AL      +   ++  H 
Sbjct: 488 SAGNIFCYGAFIASYPLLFAYYFISEWKIMYGAFKEWALAIWALTKKHTWLQAWKDDAHA 547

Query: 463 GS---DIHMRLYSKNYKDCPDWWYGALQVVTLGLGFATVCGWDTHFPAWAFVIALLISFA 519
                D H R+  + YK+ PDWWY  + +  +G+G  T+ G+ T+ P W+  +++ ++ A
Sbjct: 548 LEEFHDPHSRM-MRRYKEVPDWWYYMVLICAVGVGIGTIEGYHTNTPVWSLFMSIGLNAA 606

Query: 520 NIVPQGILEAMTNQHVGLNIITELVCGYMLPLKPMANVLFKLYGFIVMRHGLDLSRDLKL 579
            ++P  ILEA +   +GLN++ E++ GY LP  P A ++ K +G+ +         +LKL
Sbjct: 607 FLIPITILEATSALQMGLNVLIEVIMGYALPGNPHALMIIKAFGYNIDGQADSFVGNLKL 666

Query: 580 ALYMKVSPRLIFAVQIYASLISGLVNVGIQEWMRHNIDGICSKTQKDGFICSNGRTIFNA 639
             Y K+ P+ +F  Q+   L+   V +G+  W   NI   C   Q   F C +  T +N+
Sbjct: 667 GHYAKIPPKALFRGQMLMILVQTFVCLGVLNWSMSNIKDYCKPHQASKFTCPDAVTYYNS 726

Query: 640 SIIWSLPQYLFSPGRIYN---PLM-WFFLIGLVVPFIVFFLQKKFPSNQFLKYCHSPVFF 695
           S++W        P RI+    P+M W +LIG ++   V F   K    +F     +PV  
Sbjct: 727 SVLWG----AIGPKRIFEGVYPIMKWCWLIGALIG--VGFGLYKLLLPRFYPTWFNPVIV 780

Query: 696 TGPGNIPPSTPYNYSLF----FATSFLLNEIRKRWPRWFGKYNFVMGSGVEAGVALSVTI 751
            G G +  + PYN +       A  F    +R+   R + KYN+V+ +G  AG+ +S  I
Sbjct: 781 IG-GMLNMAPPYNLTYMTPGAIANFFSQFYMRRYRVRLWEKYNYVLSAGFSAGLVVSSII 839

Query: 752 IFLCVQYPGGKVNWWGNSV 770
           IF  VQY    +NWWGN V
Sbjct: 840 IFFSVQYKNKPINWWGNDV 858

>Kwal_55.19561 s55 complement(25934..28582) [2649 bp, 882 aa] {ON}
           YPR194C (OPT2) - oligopeptide transporter [contig 159]
           FULL
          Length = 882

 Score =  313 bits (803), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 221/726 (30%), Positives = 361/726 (49%), Gaps = 56/726 (7%)

Query: 82  NSPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFIVAQV 141
           +SPY EVRATV   DDP I +  +R++FL  V+ I+ +G N+FFS R  S+S++  V Q+
Sbjct: 145 HSPYKEVRATVDPRDDPNIPVETFRSYFLALVWAIIGSGFNEFFSHRLVSISLSTSVIQM 204

Query: 142 ICYPIGKILAT------LPDWKCKRVPFFDLN-PGPFTKKEHAVVTIAVALTSSTAYAMN 194
              P GK           P WK KR+   +LN   P++ KE    T+  A+   T Y   
Sbjct: 205 FLLPCGKFWEKYVPKVGFPIWKGKRI---NLNIDSPWSAKEQMFSTLLFAICMGTFYTHY 261

Query: 195 ILIAQTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLISVSLFDA 254
            ++    +YN  +  GYQ  L    Q +G+G AGL R++VV PA  +WP +L +++L  A
Sbjct: 262 NILTLKVYYNDDVDFGYQFWLSMGVQFMGFGFAGLLRKYVVYPARAIWPGSLQTLALNKA 321

Query: 255 LHSGKIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFILWGPKTRHNFI 314
           L     D     G  +    FF     F F + W+P +L   LS FN++ W      NF 
Sbjct: 322 LFK---DSGSKKGKGLASQTFFFLSVAFMFFYTWIPTYLMNFLSMFNWMTW--IAPDNFN 376

Query: 315 ANAIFGVESGLGAIPIT-FDYTQISQAMTGSVFATPFWVSANTYASXXXXXXXXXXXXYF 373
              + G  SGLG  PI+ FD+  I     G++  TPF+ S  T  +            Y+
Sbjct: 377 LAMVTGSVSGLGFNPISSFDWNVID--FLGAL-TTPFF-SYFTQLAGGILSALIVIAIYW 432

Query: 374 TNTWYAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSPLYVPFSYLLSYALN 433
           +N +  +Y+PI S S + N    + +TKILN ++ ++ +KY+ YSP Y     +++Y   
Sbjct: 433 SNYYDCQYLPIFSNSLFTNTGERFKITKILNSEWKLDPQKYQEYSPPYFSAGNIVTYG-T 491

Query: 434 FAAVTAVFVHCALYHGKDII-----------------SKLRNSNHGGS------DIHMRL 470
           F A+  + +  AL+   +++                    RN N   +      D H R+
Sbjct: 492 FIAIYPLLIVYALFSETNVLFGAVKGWFSDIFSLFKKDTWRNWNAETNKLDEFDDAHSRM 551

Query: 471 YSKNYKDCPDWWYGALQVVTLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAM 530
             K YK+ PDWWY  + +V+L +G   +  + T+ P WA ++++  +F  ++P   L+++
Sbjct: 552 M-KQYKEVPDWWYFVIFLVSLIIGICFIERYHTNTPVWALLMSIGFNFVFLIPLTTLQSV 610

Query: 531 TNQHVGLNIITELVCGYMLPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLI 590
           T   +GLN++ E++ GY LP  P A ++ K +G+ +     +   +LK+  Y KV P  +
Sbjct: 611 TTFSLGLNVLIEMIVGYALPGNPQALMIIKAFGYNIDGQADNYVSNLKMGHYAKVPPVAL 670

Query: 591 FAVQIYASLISGLVNVGIQEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSLPQYLF 650
           F  Q+    +   VN+G+  W   NI   C  TQ   F C +  T +N+S++W       
Sbjct: 671 FRGQLIMVFVQIFVNLGVLNWSISNIKDFCMPTQSAKFTCPDATTYYNSSVMWG----AL 726

Query: 651 SPGRIYN---PLM-WFFLIGLVVPFIVFFLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTP 706
            P +I+N   P+M W +LIG  +  + F + +KF    +  + +  +   G  N+ P   
Sbjct: 727 GPKKIFNDVYPIMRWSWLIGACIG-LFFGVWRKFFRRYYPTWLNPVLIAGGMLNVSPPYG 785

Query: 707 YNYSLFFATSFLLNEI--RKRWPRWFGKYNFVMGSGVEAGVALSVTIIFLCVQYPGGKVN 764
             Y +  A +   ++   ++R  R + K+N+V+ +G  AG+  S  +IF  VQY    +N
Sbjct: 786 LTYVIPGAIANFFSQFYYKRRHVRLWSKFNYVLSAGFSAGLVFSSIVIFFAVQYKNYDLN 845

Query: 765 WWGNSV 770
           WWGN+V
Sbjct: 846 WWGNTV 851

>ZYRO0D09922g Chr4 (837954..840722) [2769 bp, 922 aa] {ON} similar
           to uniprot|Q06593 Saccharomyces cerevisiae YPR194C OPT2
           Oligopeptide transporter member of the OPT family with
           potential orthologs in S. pombe and C. albicans
          Length = 922

 Score =  314 bits (804), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 237/808 (29%), Positives = 388/808 (48%), Gaps = 74/808 (9%)

Query: 24  VPLDTGKV-SYVPNPEFEQERQIVKTLSATIDLEDPSEKGSLLQD--------------- 67
           +P D   V S + N   E+  +++K L A    +DP+       D               
Sbjct: 109 IPADLKYVASQIVNMSLEEAAEVLK-LGAEYHADDPNLSSDEYNDFVKLSELNPVTLHPF 167

Query: 68  QDDAIWEGDPTYLPN--SPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQFF 125
           ++DA+       L +  SPY  VRA V   DD    +  +R++FL  V+ I+ +G N+FF
Sbjct: 168 EEDALELKAVAGLLHFHSPYKAVRACVSPQDDYESPVETFRSYFLALVWAIIGSGFNEFF 227

Query: 126 SLRYPSLSINFIVAQVICYPIGKILA------TLPDWKCKRVPFFDLN-PGPFTKKEHAV 178
           + R   ++I+  + Q++ +P+G + A      + P WK KR+    LN P P+++KE   
Sbjct: 228 AHRLMVITISSSMVQLLLFPMGSLWAKIMPYWSFPIWKGKRI---HLNIPQPWSQKEQMF 284

Query: 179 VTIAVALTSSTAYAMNILIAQTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPA 238
            T+  ++  S+ Y  ++++    FY  K+  GYQ       Q LG+G AG  RR+V+ P+
Sbjct: 285 STVLFSIAVSSFYMDSVILTLKMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVIYPS 344

Query: 239 SCVWPQTLISVSLFDALHSGKIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLS 298
             +WP  L +++L  AL S K +K    G  +T   FF     F+F + WLP +LF  LS
Sbjct: 345 HAIWPSQLQTMALNKALFSKKTEK---GGRGLTSQTFFYICVAFTFFYEWLPTYLFQILS 401

Query: 299 YFNFILWGPKTRHNFIANAIFGVESGLGAIPI-TFDYTQISQAMTGSVFATPFWVSANTY 357
            FN++ W      NF    + G   G+G  PI +FD+  I+     S   TP +  AN  
Sbjct: 402 TFNWMTW--IKPDNFNLAMVTGSMGGVGINPIASFDWNVINYY---SALVTPLFSYANQM 456

Query: 358 ASXXXXXXXXXXXXYFTNTWYAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGY 417
           A             Y++N +  +Y+P+ S + + N    Y+VT I+N    +++ KY+ Y
Sbjct: 457 AGGLIAAICVLAI-YYSNQFDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQNY 515

Query: 418 SPLYVPFSYLLSYALNFAAVTAVFVHCALYHGKDIISKL--------------------R 457
           SP Y     L  Y +  A+   +F +  L   K ++                       R
Sbjct: 516 SPPYYSAGNLFCYGVFIASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWR 575

Query: 458 NSNHGGS---DIHMRLYSKNYKDCPDWWYGALQVVTLGLGFATVCGWDTHFPAWAFVIAL 514
            S+H      D H R+  + Y + PDWWY  + ++++ +G A + G+ T+ P W+  +A+
Sbjct: 576 ESSHALEEFHDPHSRMM-RRYNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAV 634

Query: 515 LISFANIVPQGILEAMTNQHVGLNIITELVCGYMLPLKPMANVLFKLYGFIVMRHGLDLS 574
            ++   ++P  ILEA T   +GLN++ E++ GY LP  P A +L K +G+ +        
Sbjct: 635 GLNAVFLIPITILEATTALQLGLNVLIEIIMGYALPGNPQALMLIKAFGYNIDGQADSYV 694

Query: 575 RDLKLALYMKVSPRLIFAVQIYASLISGLVNVGIQEWMRHNIDGICSKTQKDGFICSNGR 634
            +LKL  Y K+ P  +F  Q++  LI  LV++G+  W   NI   C   Q+  F C +  
Sbjct: 695 GNLKLGHYSKIPPMALFRGQMFMVLIQTLVSLGVLNWSISNIKDYCQPNQESKFTCPDAI 754

Query: 635 TIFNASIIWSL--PQYLFSPGRIYNPLMWFFLIGLVVPFIVFFLQKKFPSNQFLKYCHSP 692
           T +NAS++W    P+ +F    +Y  L W +LIG ++   +   +   P  +F     +P
Sbjct: 755 TYYNASVLWGAIGPKRIFE--GVYPILKWCWLIGAIIGIGLGLWKLLIP--RFYPLWFNP 810

Query: 693 VFFTGPGNIPPSTPYNYSLF----FATSFLLNEIRKRWPRWFGKYNFVMGSGVEAGVALS 748
           +   G G +  + PYN +       A  F    +RK   R + KYN+V+ +G + G+ +S
Sbjct: 811 LLVVG-GMLNMAPPYNLTYMTPGAIANFFSQFYMRKYHLRIWQKYNYVLVAGFQTGLVIS 869

Query: 749 VTIIFLCVQYPGGKVNWWGNSVWKNTYD 776
             IIF  VQY    ++WWGN V  N  D
Sbjct: 870 SIIIFFSVQYKEKPISWWGNDVINNGLD 897

>Suva_16.526 Chr16 complement(906594..909227) [2634 bp, 877 aa] {ON}
            YPR194C (REAL)
          Length = 877

 Score =  310 bits (794), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 234/769 (30%), Positives = 373/769 (48%), Gaps = 56/769 (7%)

Query: 34  VPNPEFEQERQIVKTLSATIDLEDPSEKGSLLQDQDDAIWEGDPTYLPNSPYPEVRATVP 93
           +P+ ++E+ +++        +LE P  K  L +     I         +SPY EVRA V 
Sbjct: 102 LPHDQYEEWKRLA-------ELESPDWKEQLDEYDSFNIRAFASAIKFHSPYQEVRAVVD 154

Query: 94  NTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFIVAQVICYPIGKILA-T 152
            +DDPT+ +  +R +FL  V+ IV +G N+FFS R  ++++   V Q+  Y  GK  A T
Sbjct: 155 PSDDPTVPVETFRAYFLAIVWSIVGSGFNEFFSHRVVTITLGTPVIQMFLYICGKAWAKT 214

Query: 153 LPDW--KCKRVPFFDLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFYNMKLGAG 210
           +P W    K   +      P+T+KE    T+   +     Y    ++ Q  FY+     G
Sbjct: 215 VPCWGFTVKGTKYGININTPWTQKEQMFATLLYGICQGAFYTHYNILTQKIFYHSSFSFG 274

Query: 211 YQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLISVSLFDALHSGKIDKTIVNGWSM 270
           YQ LL    Q +G+G AG+ RR+VV P+  +WP  + ++++  AL   +  ++      M
Sbjct: 275 YQFLLSLAVQFIGFGFAGILRRFVVYPSRALWPTVMPTIAINKALLGKEKYES-----GM 329

Query: 271 TRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFILWGPKTRHNFIANAIFGVESGLGAIPI 330
           +RY FF   F   F++ W P ++   L+ FN++ W   +  N +AN I G  +G+G  PI
Sbjct: 330 SRYNFFFLTFFIMFIYNWFPTYILNILNTFNWMTWIKPSNIN-LAN-ITGSVTGIGINPI 387

Query: 331 T-FDYTQISQAMTGSVFATPFWVSANTYASXXXXXXXXXXXXYFTNTWYAKYMPIISTST 389
           + FD+  +S     S    PFW     Y              Y++N    +++P+ + S 
Sbjct: 388 SSFDWNVLS---FNSPLVFPFWSYLTQYLGSILAALIVVAV-YYSNYMNCQFLPMFTNSL 443

Query: 390 YDNQQNSYNVTKILNPDFSINLEKYKGYSPLYVPFSYLLSYALNFAAVTAVFVHCALYHG 449
           Y N   S+ VTKIL+ +  ++L+KY+ YSP +     L+SY     A   +     + H 
Sbjct: 444 YTNTGESFKVTKILDSENKLDLKKYQSYSPPFYTAGNLVSYGSFICAYPLMITWSFIVHS 503

Query: 450 KDIISKLRN-------------------SNHGGSDIHMRLYS---KNYKDCPDWWYGALQ 487
           K +++  ++                   S +   D     +S   K+YK+ PDWWY A+ 
Sbjct: 504 KLLLNAFKDWALNLWSLRKPKSWTAMFKSEYAALDEFDDPHSNAMKSYKEVPDWWYFAIL 563

Query: 488 VVTLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAMTNQHVGLNIITELVCGY 547
           + +L +G A V  + T+ P W   ++L  +F  ++P  IL+A T    GLN++ E+V GY
Sbjct: 564 LASLVVGIAVVEHYPTNTPVWGLFVSLGFNFVFLIPTTILQATTGFSFGLNLLIEMVMGY 623

Query: 548 MLPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIYASLISGLVNVG 607
            LP  P+A ++ K +G+ +     +   +LK+A Y K+ P  +F  Q    LI   VN+G
Sbjct: 624 ALPGNPVAIMILKAFGYNIDGQADNYVSNLKIAHYCKIPPMAVFRGQCVIVLIQIFVNLG 683

Query: 608 IQEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSL--PQYLFSPGRIYNPLMWFFLI 665
           +  W   NI   C+  Q   F C +  T +NAS++W    P+ +F+   IY    W +LI
Sbjct: 684 VLNWQISNIKDFCTPHQNAKFTCPDAVTYYNASVVWGAIGPKRIFN--HIYPIFKWCWLI 741

Query: 666 GLVVPFIVFFLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTPYNYSLF---FATSFLLNEI 722
           G  +  IVF + K++   +F      P+ F G G I    PYN   F      SF+    
Sbjct: 742 GACIG-IVFGVWKRW--GRFYPRDFDPMLFVG-GMINMGPPYNLMYFTPGMIVSFISQYY 797

Query: 723 RKRWP-RWFGKYNFVMGSGVEAGVALSVTIIFLCVQYPGGKVNWWGNSV 770
            KR     + KYN+V+ +G   G+ LS  IIF  VQY     NWWGN+V
Sbjct: 798 MKRHHLNLWEKYNYVLSAGFSTGLVLSAIIIFFAVQYKDTAFNWWGNTV 846

>Ecym_2739 Chr2 complement(1430077..1432680) [2604 bp, 867 aa] {ON}
           similar to Ashbya gossypii ADL399C /ACL205C /AGL027W
          Length = 867

 Score =  305 bits (780), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 229/733 (31%), Positives = 370/733 (50%), Gaps = 55/733 (7%)

Query: 82  NSPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFIVAQV 141
           +SPY EVR+ V  TDDP+I +  +R +F+ T + +V +G N+FF  R   +SI     Q+
Sbjct: 133 HSPYTEVRSMVSPTDDPSIPIETFRAYFIATFWSVVGSGFNEFFRHRQVPISIETAAVQL 192

Query: 142 ICYPIGKILAT-LPDWK-CKRVPFFDLN-PGPFTKKEHAVVTIAVALTSSTAYAMNILIA 198
           +  PIGK+ A  +P W    R   F +N P P+++KE    T+  ++T  + Y+   ++ 
Sbjct: 193 LICPIGKLWANKVPLWGFTVRGRRFAINVPEPWSEKEQMFATLLYSITLGSFYSSFNILT 252

Query: 199 QTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLISVSLFDALHSG 258
              +YN  +   +Q+LL  + Q +G+G AG+ RR+VV PA  VWP  L S+++  AL S 
Sbjct: 253 MKKYYNDDVSYLFQLLLSISLQFMGFGFAGVLRRFVVYPAKAVWPSCLPSIAVNKALLSR 312

Query: 259 KIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFILWGPKTRHNFIANAI 318
           K DK+   G S+    FF       F + W+P  L   L+ FN++ W     +NF   AI
Sbjct: 313 K-DKS--GGLSIQ--NFFYISLGVLFAYNWIPTVLAGFLANFNWMTW--LAPNNFNLAAI 365

Query: 319 FGVESGLGAIPI-TFDYTQISQAMTGSVFATPFWVSANTYASXXXXXXXXXXXXYFTNTW 377
            G  +GL   P+ +FD   I+     +   TPF+  ++ Y              Y++N  
Sbjct: 366 TGGSTGLAYNPLPSFDLNAIAYF---TPLVTPFFAYSHIYIGAVIASLVVIAL-YYSNYM 421

Query: 378 YAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSPLYVPFSYLLSYALNFAAV 437
            ++Y+P+ S S Y N+   YN+++IL  D+ ++  KY+ YSP Y     L+SY       
Sbjct: 422 ESQYLPVFSQSLYTNKATKYNISEIL-VDYKVDEAKYQTYSPPYYSAGVLVSYGSFLCFY 480

Query: 438 TAVF--------------------VHCALYHGKDIISKLRNSNHGGS---DIHMRLYSKN 474
           T VF                       +L H K  I    +  H  S   D H RL  +N
Sbjct: 481 TMVFGFAIIDEFRVLYEAFRDWFFALLSLRHKKSWIDMWASDYHVLSEFDDAHSRL-MRN 539

Query: 475 YKDCPDWWYGALQVVTLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAMTNQH 534
           YK+ PDWW+  + VV +      +  +++  P W   +++ ++F  ++P   L A T   
Sbjct: 540 YKEVPDWWFFVVLVVAIAFAIIVIECFNSQTPLWLLFLSIGLNFIFLIPLTTLHARTTFT 599

Query: 535 VGLNIITELVCGYMLPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQ 594
            GLN++ E++ GY+LP  P A +L K +G+ +     +   ++K+A Y K+SP  +F  Q
Sbjct: 600 AGLNLLVEMIVGYILPGNPYALMLIKAFGYNIDGQADNYISNMKVAHYCKISPVALFRGQ 659

Query: 595 IYASLISGLVNVGIQEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSL--PQYLFSP 652
           +    I   VN+ +  W   NI G C + Q   F C + RT +NAS++W    PQ +F+ 
Sbjct: 660 LVMVFIQIFVNLFVVNWQFSNISGFCDEHQPAKFSCPDIRTYYNASVMWGAMGPQKIFT- 718

Query: 653 GRIYNPLMWFFLIGLVVPFIVFFLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTPYNYSLF 712
            ++Y  L W + IG V+  +   L KK+   +F     +P+     G +  S PYN  ++
Sbjct: 719 -KVYPQLKWCWAIGAVIG-VGCALWKKY--GKFYPRSFNPILII-IGMLSFSPPYN-MVY 772

Query: 713 FATSFLLNEIR----KRWP-RWFGKYNFVMGSGVEAGVALSVTIIFLCVQYPGGKVNWWG 767
           F   F++N I     KR+  R + KYN+V+   ++ G+  S  +IF  +QY   ++NWWG
Sbjct: 773 FTPGFIVNFISQFYMKRYRLRIWEKYNYVLEGALKCGLVFSSLVIFAAIQYNDYQLNWWG 832

Query: 768 NSVWKNT-YDHQY 779
           NSV + + Y+  Y
Sbjct: 833 NSVPETSVYERTY 845

>ADL399C Chr4 complement(3872..6529) [2658 bp, 885 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR194C
           (OPT2)
          Length = 885

 Score =  295 bits (755), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 224/748 (29%), Positives = 367/748 (49%), Gaps = 64/748 (8%)

Query: 83  SPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFIVAQVI 142
           SPY EVRA     DDPTI +  +R +FL T++V++ +G N FF+ R P++S+     Q++
Sbjct: 148 SPYVEVRAVASPVDDPTIPVETFRAYFLATLWVVIGSGFNMFFAQRQPAISLGVFAVQML 207

Query: 143 CYPIGKI-LATLPDWKCK---RVPFFDLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIA 198
            YP   + +  +P W  K   R    ++    +++KE   VT+  ++T+   Y+   ++ 
Sbjct: 208 VYPCAVLWVRVMPCWGFKVFGRRIALNIE-SQWSEKEQMFVTLLYSITNGAFYSEYNIVT 266

Query: 199 QTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLISVSLFDALHSG 258
           Q   Y   +   YQ LL ++ Q LG+G AG+ RR+VV P+  +WP ++ +++L  AL S 
Sbjct: 267 QQIHYKSPMSYAYQFLLSFSLQFLGFGLAGIMRRYVVYPSIALWPSSMTTIALNKALLSS 326

Query: 259 KIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFILWGPKTRHNFIANAI 318
                I       R K F       FV+ W P +LF  LS FN++ W      NF    +
Sbjct: 327 DHSNGI------GRKKMFYITATAIFVYNWFPTYLFEALSTFNWMTW--IKPDNFSLATV 378

Query: 319 FGVESGLGAIPI-TFDYTQISQAMTGSVFATPFWVSANTYASXXXXXXXXXXXXYFTNTW 377
            G  +G+G  PI TFD+T I    T S++  PF V+  TY              Y+ N  
Sbjct: 379 TGGINGVGLNPISTFDWTNIG---TSSLY-LPFRVTLTTYLGGLLAALVTLGV-YYMNYR 433

Query: 378 YAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSPLYVPFSYLLSYALNFAAV 437
             +++PI + S Y+N+  SY V +IL  D  ++ +K++ Y   Y     +++Y       
Sbjct: 434 ECQFLPIFTQSLYNNRATSYRVEEILTEDRKLDEQKFQKYGFPYYTAGNIVAYGCFMCVY 493

Query: 438 TAVFVHCALYHG-----------------------KDIISKLRNSNHGGSDIHMRLYSKN 474
           TA+ V   L  G                       + + S  ++      D H R+  K 
Sbjct: 494 TALVVTSILQQGAFYGRVYKTWILDLWSLRKPSSWRAVFSNDKHVLDDFHDSHSRMMRK- 552

Query: 475 YKDCPDWWYGALQVVTLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAMTNQH 534
           YK+ P+WWY  + +V++ +G   V  + T+ P W   +A+ ++F  ++P  +L+A     
Sbjct: 553 YKEVPEWWYMTIFIVSIVIGIIVVKVFKTNTPVWGLFLAVALNFVLLLPITLLQATRGVT 612

Query: 535 VGLNIITELVCGYMLPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQ 594
           +GLN++ +++ G  LP  P A +  K +G+ +     +   ++KLA Y K+ P  +F  Q
Sbjct: 613 IGLNLLLQMISGLALPGNPYALMFIKAFGYNIDGQADNYLGNMKLAHYAKIPPVPLFRGQ 672

Query: 595 IYASLISGLVNVGIQEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSL--PQYLFSP 652
           +   LI   VN+G+  W  HNI+  C   Q+  F C   RT FNAS++W    P+ +F  
Sbjct: 673 LLMVLIQIFVNLGVINWQLHNIENYCDPKQRFKFTCPGIRTYFNASVMWGAIGPKRIFE- 731

Query: 653 GRIYNPLMWFFLIGLVVPFIVFFLQKKFPSNQFLKYCH----SPVFFTGPGNIPPSTPYN 708
             +Y  + W +LIG  V  + F L KK  S  + K  +    SPV F   G +    PYN
Sbjct: 732 -HVYPIMKWCWLIGACVG-LFFGLWKKL-SIMYKKIPYPDRFSPVIFI-IGMLSFGPPYN 787

Query: 709 YSLFFATSFL------LNEIRKRWPRWFGKYNFVMGSGVEAGVALSVTIIFLCVQYPGGK 762
             L + TS L      +  +++   R + +YN+V+ +G+  G+  S  ++F  VQ+ G +
Sbjct: 788 --LQYTTSGLYVGFISMCYMKRYHLRVWERYNYVVAAGISCGLVFSAIVMFFTVQWKGVE 845

Query: 763 VNWWGNSVWKNTYDHQYKKFYHLNKGET 790
           ++WWGN+V     D  Y +   LN  ET
Sbjct: 846 ISWWGNTVSYAGLD--YARVPLLNVTET 871

>ACL205C Chr3 complement(1169..3841) [2673 bp, 890 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR194C
           (OPT2)
          Length = 890

 Score =  288 bits (737), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 224/751 (29%), Positives = 358/751 (47%), Gaps = 70/751 (9%)

Query: 83  SPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFIVAQVI 142
           SPY EVRA     DDPTI +  +R +FL T +V+V + +  FFS R PS++++    Q++
Sbjct: 141 SPYVEVRAVASPVDDPTIPVETFRAYFLATFWVVVGSALTMFFSERQPSIALSISAVQML 200

Query: 143 CYPIGKILATL-PDWK----CKRVPFFDLN-PGPFTKKEHAVVTIAVALTSSTAYAMNIL 196
            YP G + A L P W      +R+    LN   P+T+KE   VT+   +T+ + YA   +
Sbjct: 201 VYPCGLLWARLMPCWGFNVYGRRIA---LNIDSPWTEKEQMFVTLLYGITTGSFYANYNI 257

Query: 197 IAQTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLISVSLFDALH 256
           + Q   Y   +   YQ+LL    Q LG+G AG+ R++VV PA+ +WP  + +++L  A+ 
Sbjct: 258 LTQHIHYRSPMPYAYQLLLSIPLQFLGFGLAGIMRKYVVYPATAMWPSIMTTIALNKAMM 317

Query: 257 SGKIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFILWGPKTRHNFIAN 316
           S +      +     R K F   F   FV+ W P +LF  LS FN+I W      NF   
Sbjct: 318 SDE------HSGGFGRKKMFYLTFAIIFVYNWFPTYLFEALSTFNWITW--IKPDNFNLA 369

Query: 317 AIFGVESGLGAIPI-TFDYTQISQAMTGSVFATPFWVSANTYASXXXXXXXXXXXXYFTN 375
            + G  +G+G  P+ T D+T I        F  PF V+   Y              Y+ N
Sbjct: 370 TVTGGINGVGLNPLSTLDWTNIGVGG----FYLPFRVTLTMYMG-GLLAALITLGVYYMN 424

Query: 376 TWYAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSPLYVPFSYLLSYALNFA 435
               +++PI + S Y+N+   Y V +IL  D  ++ +K++ Y   Y     +++Y     
Sbjct: 425 YSECQFLPIFTQSLYNNKAKVYQVEEILTEDRLLDEQKFQKYGFPYYTAGNMVAYGCFMC 484

Query: 436 AVTAVFVHCALYHG-----------------------KDIISKLRNSNHGGSDIHMRLYS 472
             TA+ V   L  G                       ++  S  ++      D H R+  
Sbjct: 485 VYTALVVSSILQQGAFYMRVYKAWILDLWSLRTRSGLREAFSNEKHVLDEFHDPHCRMMR 544

Query: 473 KNYKDCPDWWYGALQVVTLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAMTN 532
           K YK+ P+WWY ++ VV++ +G   V  + T+ P W   +A+ ++F  ++P  +L+A   
Sbjct: 545 K-YKEVPEWWYMSIFVVSIVIGVIVVTTFKTNTPVWGLFLAVGLNFILLLPITLLQATRG 603

Query: 533 QHVGLNIITELVCGYMLPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFA 592
             +GLN++ +++ G  LP  P A +  K +G+ +     +   ++K+A Y K+ P  +F 
Sbjct: 604 VTIGLNLLLQMISGLALPGNPYALMFIKAFGYNIDGQTDNYLSNMKMAHYAKIPPIPLFR 663

Query: 593 VQIYASLISGLVNVGIQEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSL--PQYLF 650
            Q+   LI   VN+G+  W  HN++  C   Q+  F C   RT FNAS++W    P+ +F
Sbjct: 664 GQLLMVLIQVFVNLGVINWQLHNVENYCDPKQRFKFTCPGVRTYFNASVMWGAIGPRRIF 723

Query: 651 SPGRIYNPLMWFFLIGLVVPFIVFFLQKKFPSNQFLKYCH----SPVFFT-------GPG 699
               +Y  + W +LIG  V   +FF   K  S  + K  +    SPV F         P 
Sbjct: 724 E--HVYPIMKWCWLIGACVG--LFFGIWKRLSIMYDKIPYPRRFSPVIFIIGMLSFGPPY 779

Query: 700 NIPPSTPYNYSLFFATSFLLNEIRKRWPRWFGKYNFVMGSGVEAGVALSVTIIFLCVQYP 759
           N+  ST   Y  F +  +L     + W R    YN+V+ + +  GV  S  ++F  VQ+ 
Sbjct: 780 NLQYSTSGLYVGFISMFYLKRYHLRIWER----YNYVIAAAITCGVVFSAILMFFSVQWK 835

Query: 760 GGKVNWWGNSVWKNTYDHQYKKFYHLNKGET 790
             ++NWWGNS+     D  Y +   LN  ET
Sbjct: 836 DIELNWWGNSISYAGLD--YARVPLLNVTET 864

>AGL027W Chr7 (657958..660591) [2634 bp, 877 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPR194C (OPT2)
          Length = 877

 Score =  273 bits (698), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 208/731 (28%), Positives = 358/731 (48%), Gaps = 67/731 (9%)

Query: 82  NSPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFIVAQV 141
           +SPYPEVRA V   DDPTI +  +R +FLTT   I+  G+  FF  RYP +  + + AQ 
Sbjct: 141 HSPYPEVRAVVGPGDDPTIPVETFRCYFLTTTITIIGCGLTTFFQSRYPLIEFSSMAAQF 200

Query: 142 ICYPIGKILATLPDWKCKRVPFFDLNPG---------PFTKKEHAVVTIAVALTSSTAYA 192
           + + +G + +        R+P F   PG          ++KKE    T+  ++T+   Y+
Sbjct: 201 LFFILGTLWSKF--MPAVRIPIF---PGYGFQLNLQTSWSKKEQMFATLLYSITTGVFYS 255

Query: 193 MNILIAQTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLISVSLF 252
              ++ Q  FYN     G+Q++L  + Q +G+G AGL R +VV PA  +WP ++ +++L 
Sbjct: 256 YFNILTQDMFYNDPTSLGFQIILSLSLQFMGFGLAGLLRPFVVFPARALWPLSMPTIALN 315

Query: 253 DALHSGKIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFILWGPKTRHN 312
           +AL +  + K    G S+   K F Y  +  F++ W P      LS  N++ W     +N
Sbjct: 316 NALLAQDVGK----GTSIR--KVFFYFGIGMFIYNWFPTVFADVLSNLNWLTW--IKPNN 367

Query: 313 FIANAIFGVESGLGAIPI-TFDYTQISQAMTGSVFATPFWVSANTYASXXXXXXXXXXXX 371
           F   AI G   G+   P+ T D+  I    T    A PF+     Y              
Sbjct: 368 FNLAAITGGRYGIATNPLPTLDWNYI----THWALALPFYTVFLQYLGSLLSVVIIIAV- 422

Query: 372 YFTNTWYAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSPLYVPFSYLLSYA 431
           Y+TN    +Y+PI     Y N+   ++ +K+L  DF ++ +KY+ YS  Y     ++ Y 
Sbjct: 423 YYTNYMECQYLPIFGQPLYSNEGKFFDASKVLT-DFKLDWQKYQQYSLPYYSAGNIVGYG 481

Query: 432 LNFAAVTAVFVHCALYHGKDII--------------SKL---RNSN-------HGGSDIH 467
            +F ++  +    ++    +I+              +KL   RN +        G  D H
Sbjct: 482 -SFISLYTLLAAYSIITEYEILGGACKRLGVGLWSLTKLDTWRNLHKNDSSILEGYDDAH 540

Query: 468 MRLYSKNYKDCPDWWYGALQVVTLGLGFATVCGWDTHFPAWAFVIALLISFANIVPQGIL 527
            R   K Y + P+WW+ A+ +++L L    V  + T+ P W   +A+ ++ A ++P   L
Sbjct: 541 CREMRK-YPEVPEWWFFAIFLISLVLAIILVTTYKTNTPVWGIFLAVGLNVAFLLPLTTL 599

Query: 528 EAMTNQHVGLNIITELVCGYMLPLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSP 587
           ++ T   +GLN++ +++ GY+LP  P A ++ K +G+ +     +   +LK+A Y K+ P
Sbjct: 600 QSTTGASLGLNLLVQMITGYLLPGNPYALMIIKAFGYNIDGQADNYLSNLKMAHYCKIPP 659

Query: 588 RLIFAVQIYASLISGLVNVGIQEWMRHNIDGICSKTQKDGFICSNGRTIFNASIIWSL-- 645
             +F  Q+   L+  +V++ +  W  HN+   C+   + GFIC   RT +NASI+W +  
Sbjct: 660 VPLFRGQLSMVLLQVIVSLAVINWQIHNVPDFCNPKNRSGFICQGPRTYYNASIVWGIIG 719

Query: 646 PQYLFSPGRIYNPLMWFFLIGLVVPFIVFFLQKKFPSNQFLKYCHS--PVFFTGPGNIPP 703
           P+ +FS   +Y  + W +LIG ++  ++F    +      L Y  S  PV F   G I  
Sbjct: 720 PKKVFS--YLYPMMKWCWLIGALLG-VLFGGWCRLSRKYKLYYPRSFNPVVFVT-GMISL 775

Query: 704 STPYNYSLFFATSFL--LNE--IRKRWPRWFGKYNFVMGSGVEAGVALSVTIIFLCVQYP 759
             PYN  ++ +  ++  + +  +R+   R + KYN+V+ +    GV  S   IF  +QYP
Sbjct: 776 MPPYNLRVYTSKLYVAFIGQYWLRRYHLRIWEKYNYVVAAAFNCGVIFSAITIFFAIQYP 835

Query: 760 GGKVNWWGNSV 770
             +++W  N++
Sbjct: 836 EIRLDWILNTI 846

>Smik_16.458 Chr16
           complement(787205..789133,789181..789306,789322..789348,
           789352..789837) [2568 bp, 855 aa] {ON} YPR194C (REAL)
          Length = 855

 Score =  272 bits (696), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 198/637 (31%), Positives = 317/637 (49%), Gaps = 52/637 (8%)

Query: 166 LNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFYNMKLGAGYQVLLVWTSQMLGYG 225
           L P   T+K+    T+  A+     Y    ++ Q  FY+     GYQ LL  + Q +G+G
Sbjct: 208 LCPTGLTQKKQMFSTLLYAICQGAFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFG 267

Query: 226 AAGLSRRWVVNPASCVWPQTLISVSLFDALHSGKIDKTIVNGWSMTRYKFFLYVFLFSFV 285
            AG+ R++VV PA  +WP  + ++++  AL   +  ++      M+RYKFF   F   FV
Sbjct: 268 FAGILRKFVVYPARALWPTVMPTIAINKALLGKEEHES-----GMSRYKFFFLTFFVMFV 322

Query: 286 WYWLPGFLFTGLSYFNFILWGPKTRHNFIANAIFGVESGLGAIPIT-FDYTQISQAMTGS 344
           + W P F+   L+ FN++ W   T  N +AN   GV +GLG  PI+ FD+  IS     S
Sbjct: 323 YNWFPTFIINILNTFNWMTWIKPTSIN-LANITGGV-TGLGINPISSFDWNVIS---FNS 377

Query: 345 VFATPFWVSANTYASXXXXXXXXXXXXYFTNTWYAKYMPIISTSTYDNQQNSYNVTKILN 404
               PFW     Y              Y++N    +Y+PI + S Y N  NS+ VTKIL+
Sbjct: 378 PLVYPFWSYLTQYLGCILAALIVIAV-YYSNYMICQYLPIFTNSLYTNTGNSFKVTKILD 436

Query: 405 PDFSINLEKYKGYSPLYVPFSYLLSYALNFAAVTAVFVHCALYHGKDIISKLRN------ 458
            D  ++++KY+ YSP Y     L++Y     A   +     + H K + +  ++      
Sbjct: 437 SDNKLDVKKYQSYSPPYYTAGNLVTYGAFICAYPLMITWSFIVHSKLLFNAFKDWTLNLW 496

Query: 459 -------------SNHGGSDIHMRLYS---KNYKDCPDWWYGALQVVTLGLGFATVCGWD 502
                        +N+   D +   +S   KNY++ PDWWY A+ + +L +G A V  + 
Sbjct: 497 ALRKLTTWAIMFKNNYRLLDDYDDPHSNAMKNYREVPDWWYFAILIASLIVGIAVVEHYP 556

Query: 503 THFPAWAFVIALLISFANIVPQGILEAMTNQHVGLNIITELVCGYMLPLKPMANVLFKLY 562
           T+ P W   ++L  +F  ++P  IL+A T    GLN++ E+V GY LP  P+A ++ K +
Sbjct: 557 TNTPVWGLFVSLGFNFVFLIPTTILQATTGYSFGLNLLIEMVMGYALPGNPVAIMILKAF 616

Query: 563 GFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIYASLISGLVNVGIQEWMRHNIDGICSK 622
           G+ +     +   +LK+A Y K+ P  +F  Q    LI   VN+G+  W   NI   C+ 
Sbjct: 617 GYNIDGQADNYVSNLKIAHYCKIPPMALFRGQCIIVLIQIFVNLGVLNWQISNIKDFCTP 676

Query: 623 TQKDGFICSNGRTIFNASIIWSLPQYLFSPGRIYN---PLM-WFFLIGLVVPFIVFFLQK 678
            Q   F C +  T +NAS++W        P RI+N   P++ W +LIG  +  I+F + K
Sbjct: 677 HQNAKFTCPDAVTYYNASVVWG----AIGPKRIFNYIYPIIKWCWLIGACIG-ILFGVWK 731

Query: 679 KFPSNQFLKYCHSPVFFTGPGNIPPSTPYNYSLFFATSFLLNEIRKRWPR-----WFGKY 733
           ++   +F      P+ F G G +  S PYN  +++ +  +++ I + + +      + KY
Sbjct: 732 RW--GKFYPKYFDPMLFVG-GMLNMSPPYNL-MYYTSGMIVSYISQYYMKRHHLNLWEKY 787

Query: 734 NFVMGSGVEAGVALSVTIIFLCVQYPGGKVNWWGNSV 770
           N+V+ +G   G+ LS  IIF  VQY     NWWGN+V
Sbjct: 788 NYVLSAGFSTGLVLSAIIIFFAVQYKDTAFNWWGNTV 824

>ZYRO0D17974g Chr4 complement(1492455..1494785) [2331 bp, 776 aa]
           {ON} weakly similar to uniprot|Q06593 Saccharomyces
           cerevisiae YPR194C OPT2 Oligopeptide transporter member
           of the OPT family
          Length = 776

 Score =  172 bits (437), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 195/791 (24%), Positives = 347/791 (43%), Gaps = 74/791 (9%)

Query: 24  VPLDTGKVSYVPNPEFEQERQIVKTLSATIDLEDPSEKGSLLQDQDDAIWEGDPTYLPNS 83
           + +D  K SYV + E + E   ++  S+  D+ D +   +   D+D    E  P  L + 
Sbjct: 2   MAVDETKPSYV-SEEVQIETDSLQ--SSKKDVVDITVSKASENDEDTTEKEL-PDDLKDI 57

Query: 84  PYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFIVAQVIC 143
           P   V+  V   DDP      +R   L+ +F++  A ++   S R  S + +    Q+  
Sbjct: 58  P-SIVKGVVTLEDDPQEPCFTFRMVILSIIFILPGAFLDTMNSYRTTSAAYSIFFVQICS 116

Query: 144 YPIGKILAT-LPDWKCKRVPF-FDLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTN 201
           Y +GK LA  LP  +     + F LNPGP++ KE+ ++T+A A  ++       +     
Sbjct: 117 YWVGKWLAKILPSKQIGIGKYKFSLNPGPWSIKENVLITLAAASGATGNQGTTPVSLAEV 176

Query: 202 FYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLISVSLFDALHSGKID 261
           +Y  K+     +  +W     GY  + ++R +++     VWP+ L+  +LF+++   K D
Sbjct: 177 YYKTKVNPAVAIFFMWCINFSGYAMSYIARNFLIYDPQFVWPRALMQTNLFNSMK--KAD 234

Query: 262 KTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFILWGPKTRHNFIANAIFGV 321
                  S  + K F  + +   VW + P ++F  LS  +F+ W     +N+ AN I G 
Sbjct: 235 LPNHQRQSSRKMKVFFMLIIGMTVWEFFPEYVFPMLSSLSFLCW--VAPNNYTANFIGGG 292

Query: 322 ESGLGAIPITFDYTQISQAMTGSVFATPFWVSANTYASXXXXXXXXXXXXYFTN-TWYAK 380
             G+G +  + D+  I    T SV  +P+W +   +A+             + N + Y K
Sbjct: 293 MGGMGFLNHSLDWANI----TSSVMLSPYWTTCVQFAAFFFSCWVLIPAAKWGNMSSYKK 348

Query: 381 YMPIISTSTYDNQQNSYNVTKIL--------NPDFSINLEKYKGYSPLYVPFSYLLSYAL 432
              ++S          Y  + ++        N   S N + Y+ + P+Y+      +   
Sbjct: 349 --GLMSNKLLTRNGTVYPSSSLIIYDEGASKNGKVSFNEKAYQLHGPIYIGAQKAWNMFF 406

Query: 433 NFAAVTAVFVHCALYHGKDI---ISKLRNSNHGGSDIHM----RL--YSKNYKDCPDWWY 483
           ++AA T+      L+  KDI     KL+       +I++    RL     NY++ P WW+
Sbjct: 407 DYAAFTSAISWMLLFGRKDIAKNFKKLKQRLFHNKNINLLYNDRLNKIQSNYEEVPVWWF 466

Query: 484 GALQVVTLGLGFATVCGWDTHF-PAWAFVIALLISFANIVPQGILEAMTNQHVGLNIITE 542
             L ++TL + F T+   +T F P W + +A+ +SF  I+P   L A++N  + +    E
Sbjct: 467 ALLFLITL-VVFVTIFATNTMFIPWWTYFVAVGVSFIIIIPLAYLYAISNFQLAIGTFDE 525

Query: 543 LVCGYML------PLKPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIY 596
           L+ G M+           A+    L G +  R    L +D K+  YM + P+ +F  Q+ 
Sbjct: 526 LLYGVMVQNLSTHKHPASASTYGALSGDLWYRAQYML-QDQKIGHYMHIPPKAVFLSQVL 584

Query: 597 ASLISGLVNVGIQEWMRHNIDGICSKTQKDGFICSNGRTI--FNASIIWSL---PQYLFS 651
             LI   +N G   W+          T KD      G+++  +N + +  +   P   FS
Sbjct: 585 GQLIGVPMNYGTVRWVLDTKMDYLRGTAKDPLHQWTGQSLTSYNTNAVLYVLLGPTRFFS 644

Query: 652 PGRIYNPLMWF-FLIGLVVPFIVFFLQKKFPSNQF-----LKYCHSPVFFTGPGNIPPST 705
            G  +N ++ F  L+G   PF+++ L K FP  +F       +C +   F G        
Sbjct: 645 SG--HNKIIPFGLLVGFFAPFLIYALYKLFPRRKFNLWNVTIFCSTMSTFYG-------- 694

Query: 706 PYNYSLFFATSFLLNEIRKRW-----PRWFGKYNFVMGSGVEAGVALSVTIIFLCV--QY 758
             N S  +AT F++      +     P+++  YN++  +  + G  L+V +IF+      
Sbjct: 695 --NLSTGYATQFVVGTFSMYYLYNHKPKFWRNYNYLTAAAFDTGYNLAVLLIFIIFSSHK 752

Query: 759 PGGKVNWWGNS 769
           P    NWWGN+
Sbjct: 753 PIKMPNWWGNN 763

>CAGL0G00352g Chr7 (35994..36869) [876 bp, 291 aa] {ON} similar to
           uniprot|P53332 Saccharomyces cerevisiae YGR277c
          Length = 291

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 53/132 (40%), Gaps = 9/132 (6%)

Query: 70  DAIWEGDPTYLPNSPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLRY 129
           D + +G    L  + Y   +  +    D  + +N     FL   F     GVN+F  L  
Sbjct: 149 DHLHDGHKILLSVASYLTSQRLIVGVTDEELLVNKKYQEFLED-FEERCNGVNKFLQLLK 207

Query: 130 PSLSINFIVAQVICYPIGKILATLPDWKCKRVPFFDLNPGPFTKKEHAVVTIAVALTSST 189
           PSL +  +  + +C P G    T+P+ +C  V    +  G    K  A    +  ++   
Sbjct: 208 PSLKMEVVAIRDVCGPTG----TVPEIECLIVSRETIGGGEVVNKTRA----SKGMSQLD 259

Query: 190 AYAMNILIAQTN 201
            Y +N+L  Q +
Sbjct: 260 IYVVNVLGGQED 271

>KLTH0C02046g Chr3 complement(180744..186761) [6018 bp, 2005 aa]
           {ON} similar to uniprot|P50077 Saccharomyces cerevisiae
           YGR217W CCH1 Voltage-gated calcium channel involved in
           calcium influx in response to mating pheromones
          Length = 2005

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 43/100 (43%), Gaps = 5/100 (5%)

Query: 7   KNFEKFERTSTSSLEQTVPLDTGKVSYVPNPEFEQERQIVKTLSATIDLEDPSEKGSLLQ 66
           +NF    RT  S  E +   D G +SY      E   +    +S TID  D S+   L  
Sbjct: 93  RNFISPTRTEQSDTEGSGSADEGPISYTSALSDEDNLRSAAVIS-TIDEGDLSDFKDLQD 151

Query: 67  DQDDAIWEGDPTYLP----NSPYPEVRATVPNTDDPTIEL 102
           +  +A+ EG+ T+LP    NS  P+         +P + L
Sbjct: 152 EFKNAMKEGNSTWLPKSRRNSKVPDAETQEAPRREPHLSL 191

>NDAI0I01490 Chr9 complement(351987..354206) [2220 bp, 739 aa] {ON}
           Anc_6.137
          Length = 739

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 48/100 (48%), Gaps = 6/100 (6%)

Query: 505 FPAWAFVIALLIS-FANIVP-QGILEAMTNQHVGLNIITELVCGYMLPLKPMANVLFKLY 562
            P +A V AL+IS F +I+  + + E   N   G+  +++L+   ++P   + +VL  L 
Sbjct: 484 IPVYAMVSALVISVFLSILAVRALGETDLNPVSGIGKLSQLIFALIIPRDHLGSVLINLV 543

Query: 563 GFIVMRHGL----DLSRDLKLALYMKVSPRLIFAVQIYAS 598
              V   G     DL +DLK    +  SPR  F  Q+  +
Sbjct: 544 AGGVAEAGSQQAGDLMQDLKTGHLLGASPRAQFVAQLIGA 583

>ZYRO0C14630g Chr3 (1139589..1141742) [2154 bp, 717 aa] {ON} similar
           to uniprot|P53134 Saccharomyces cerevisiae YGL114W
           Putative member of the oligopeptide transporter (OPT)
           family of membrane transporters
          Length = 717

 Score = 35.4 bits (80), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 46/101 (45%), Gaps = 6/101 (5%)

Query: 505 FPAWAFVIALLIS-FANIVP-QGILEAMTNQHVGLNIITELVCGYMLPLKPMANVLFKLY 562
            P +A V AL I+ F +I+  + + E   N   G+  I++L+   ++P      VL  L 
Sbjct: 464 IPVYAMVTALFIALFLSILGIRALGETDLNPVSGIGKISQLIFALVVPRDRKGAVLLNLV 523

Query: 563 GFIVMRHGL----DLSRDLKLALYMKVSPRLIFAVQIYASL 599
              V   G     DL +DLK    +  SPR  F  QI  ++
Sbjct: 524 AGGVAESGAQQAGDLMQDLKTGHLLGASPRAQFIAQIVGAI 564

>Smik_4.87 Chr4 complement(165012..167444) [2433 bp, 810 aa] {ON}
           YDL148C (REAL)
          Length = 810

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 13/81 (16%)

Query: 22  QTVPLDTGKVSYVPNPE-----FEQERQIVKTLSATIDLEDPSEKGSLLQDQDDAIWEGD 76
           +  P D  K     N E      E E+Q +  ++  I+LE+  EKG  ++D DD  WE +
Sbjct: 282 RAAPTDRTKTEEEKNAEAEIKKRELEQQRLDRMNGMIELEEGEEKG--VEDLDDGFWENE 339

Query: 77  PTYLPNSPYPEVRATVPNTDD 97
             Y  ++        + N+DD
Sbjct: 340 EDYDDDN------GGIANSDD 354

>ZYRO0G16236g Chr7 complement(1332425..1333948) [1524 bp, 507 aa]
           {ON} similar to uniprot|P38778 Saccharomyces cerevisiae
           YHR050W SMF2 Divalent metal ion transporter
          Length = 507

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 37/83 (44%), Gaps = 2/83 (2%)

Query: 117 VFAGVNQFFSLRYPSLSINFIVA--QVICYPIGKILATLPDWKCKRVPFFDLNPGPFTKK 174
           V AG    + L +  L  NF+ A  Q +C  +G +        CKR     LN   +   
Sbjct: 60  VAAGSAHKYKLLFSVLVANFMAAFWQCLCARLGAVTGLDLAQNCKRHLTPQLNVALYILA 119

Query: 175 EHAVVTIAVALTSSTAYAMNILI 197
           E A++   +A    TA ++NIL+
Sbjct: 120 EIAIIATDLAEVVGTAISLNILL 142

>TDEL0A01710 Chr1 complement(306168..308315) [2148 bp, 715 aa] {ON}
           Anc_6.137 YGL114W
          Length = 715

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 40/94 (42%), Gaps = 6/94 (6%)

Query: 509 AFVIALLISFANIVPQGILEAMTNQHVGLNIITELVCGYMLPLKPMANVLFKLYGFIVMR 568
           A +IAL +S   I   G  E   N   G+  +++L+   + P     +VL  L    V  
Sbjct: 470 ALIIALFLSILGIRALG--ETDLNPVSGIGKLSQLIFAVIAPRNQPGSVLLNLVAGGVAE 527

Query: 569 HGL----DLSRDLKLALYMKVSPRLIFAVQIYAS 598
            G     DL +DLK    +  SPR  F  Q+  +
Sbjct: 528 AGAQQAGDLMQDLKTGHLLGASPRAQFVAQLLGA 561

>NCAS0D03350 Chr4 (626765..628960) [2196 bp, 731 aa] {ON} Anc_6.137
          Length = 731

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 40/94 (42%), Gaps = 6/94 (6%)

Query: 509 AFVIALLISFANIVPQGILEAMTNQHVGLNIITELVCGYMLPLKPMANVLFKLYGFIVMR 568
           A +IAL +S   I   G  E   N   G+  +++L+   ++P      +L  L    V  
Sbjct: 484 ALIIALFLSILGIRALG--ETDLNPVSGIGKLSQLIFALIIPRNHPGAILVNLVAGGVAE 541

Query: 569 HGL----DLSRDLKLALYMKVSPRLIFAVQIYAS 598
            G     DL +DLK    +  SPR  F  QI  +
Sbjct: 542 AGAQQAGDLMQDLKTGHLLGASPRAQFVAQIIGA 575

>SAKL0A06468g Chr1 complement(580333..582531) [2199 bp, 732 aa] {ON}
           similar to uniprot|P53134 Saccharomyces cerevisiae
           YGL114W Putative member of the oligopeptide transporter
           (OPT) family of membrane transporters
          Length = 732

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 47/100 (47%), Gaps = 6/100 (6%)

Query: 505 FPAWAFVIALLIS-FANIVP-QGILEAMTNQHVGLNIITELVCGYMLPLKPMANVLFKLY 562
            P ++ +IAL+++ F +I+  + + E   N   G+  +++L+   ++P      VL  L 
Sbjct: 479 IPLYSMIIALILALFLSILGVRALGETDLNPVSGIGKLSQLIFAVIIPRDHKGGVLLNLV 538

Query: 563 GFIVMRHGL----DLSRDLKLALYMKVSPRLIFAVQIYAS 598
              V   G     DL +DLK    +  SPR  F  Q+  +
Sbjct: 539 AGGVAEAGAQQAGDLMQDLKTGHLLGASPRAQFVAQLIGA 578

>ADL080W Chr4 (542121..544712) [2592 bp, 863 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL047C (SYG1)
          Length = 863

 Score = 32.7 bits (73), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 43/104 (41%), Gaps = 24/104 (23%)

Query: 251 LFDALHSGKIDKTIVNGWSMTRYKFFLYVFLFSFV-----------------WYWLPGFL 293
           +F  +HS K +    N +S T+    LY+   +F+                 W WL   L
Sbjct: 419 MFGEIHSRKGNTVFNNDFSTTKISGHLYMVSLAFITVGAVSLCSMVRATLAPWLWLCALL 478

Query: 294 FT-GLSYFNFIL--WGP--KTRHNFIANAIFGVESGLGAIPITF 332
           F  G S  +FIL  W    KTR   I  AI  V S  GA P+ F
Sbjct: 479 FALGFSMSSFILPYWRELRKTRQWLIVTAIRLVFS--GAYPVQF 520

>NDAI0G04830 Chr7 (1162561..1165101) [2541 bp, 846 aa] {ON}
           Anc_1.462
          Length = 846

 Score = 32.0 bits (71), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 3/50 (6%)

Query: 662 FFLIGLVVPFIVF---FLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTPYN 708
           FFL G+VV   +F    L  +FP   + K C+ P+ F     I P T  N
Sbjct: 567 FFLFGVVVALAIFNSTILDLQFPRTFYKKLCNEPLTFDDYREIYPVTAQN 616

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.456 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 88,166,387
Number of extensions: 3968966
Number of successful extensions: 12667
Number of sequences better than 10.0: 57
Number of HSP's gapped: 12735
Number of HSP's successfully gapped: 57
Length of query: 797
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 679
Effective length of database: 39,950,811
Effective search space: 27126600669
Effective search space used: 27126600669
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 70 (31.6 bits)