Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0A08426g6.65ON29927811471e-159
Kwal_56.232426.65ON2561696122e-78
Suva_8.2276.65ON2871706144e-78
KLTH0G15444g6.65ON2631646107e-78
ZYRO0D14190g6.65ON2951716101e-77
AGR270W6.65ON2941706075e-77
Kpol_1042.116.65ON2921716013e-76
Smik_15.3526.65ON2882256013e-76
YOR174W (MED4)6.65ON2841705925e-75
NCAS0F003306.65ON2811705926e-75
Skud_15.3366.65ON2861715919e-75
KNAG0M010206.65ON2791715901e-74
CAGL0L04620g6.65ON2641715776e-73
KAFR0G025006.65ON2891705789e-73
TBLA0G005506.65ON3181705687e-71
KLLA0F20185g6.65ON2852255596e-70
NDAI0J013206.65ON3341705637e-70
Ecym_31246.65ON2741695542e-69
TPHA0F025906.65ON3061705312e-65
TDEL0G040606.65ON2201644546e-55
SAKL0C02222g1.66ON115390750.83
TPHA0D037406.311ON231733731.3
TPHA0B018704.300ON41772702.5
KLLA0A06402g1.162ON65565668.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0A08426g
         (299 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {O...   446   e-159
Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W...   240   2e-78
Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W (...   241   4e-78
KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa] ...   239   7e-78
ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} simil...   239   1e-77
AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic h...   238   5e-77
Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON} (21260.....   236   3e-76
Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W...   236   3e-76
YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subuni...   232   5e-75
NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65 Y...   232   6e-75
Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W...   232   9e-75
KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {O...   231   1e-74
CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} simila...   226   6e-73
KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON...   227   9e-73
TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65...   223   7e-71
KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa] ...   219   6e-70
NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {...   221   7e-70
Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON} ...   218   2e-69
TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65...   209   2e-65
TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON...   179   6e-55
SAKL0C02222g Chr3 (197312..200773) [3462 bp, 1153 aa] {ON} weakl...    33   0.83 
TPHA0D03740 Chr4 complement(784729..791682) [6954 bp, 2317 aa] {...    33   1.3  
TPHA0B01870 Chr2 (417669..418922) [1254 bp, 417 aa] {ON} Anc_4.3...    32   2.5  
KLLA0A06402g Chr1 complement(578090..580057) [1968 bp, 655 aa] {...    30   8.7  

>SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {ON}
           similar to gnl|GLV|KLLA0F20185g Kluyveromyces lactis
           KLLA0F20185g and weakly similar to YOR174W
           uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 299

 Score =  446 bits (1147), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 228/278 (82%), Positives = 228/278 (82%)

Query: 1   MSSRPNSKTSPVLATPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVEVYADICEYEETL 60
           MSSRPNSKTSPVLATP                             RVEVYADICEYEETL
Sbjct: 1   MSSRPNSKTSPVLATPLSSQQQQISSYSSSSSLPHQHDQDQDLLSRVEVYADICEYEETL 60

Query: 61  GKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRLNDLEKQSQEVDKKTSK 120
           GKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRLNDLEKQSQEVDKKTSK
Sbjct: 61  GKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRLNDLEKQSQEVDKKTSK 120

Query: 121 ILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDYAMKLAKFTRVPPTFDKG 180
           ILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDYAMKLAKFTRVPPTFDKG
Sbjct: 121 ILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDYAMKLAKFTRVPPTFDKG 180

Query: 181 MVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPGQXXXXXXXXXXXXXXXXXXXXXTKP 240
           MVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPGQ                     TKP
Sbjct: 181 MVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPGQENEEYEESEENRENEENGEKETKP 240

Query: 241 ETKSTLTENESETVAAREEIPRRSSFEFTADDSHKKDQ 278
           ETKSTLTENESETVAAREEIPRRSSFEFTADDSHKKDQ
Sbjct: 241 ETKSTLTENESETVAAREEIPRRSSFEFTADDSHKKDQ 278

>Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W
           (MED4) - Stoichiometric member of mediator complex
           [contig 183] FULL
          Length = 256

 Score =  240 bits (612), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 136/169 (80%)

Query: 46  RVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRLN 105
           + ++Y+DICE+EETLGKLV+SVDKF PDLK+A+ LIE DK+L K LE  P+YD+ID R  
Sbjct: 24  KAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLESLPRYDEIDLRAK 83

Query: 106 DLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDYAM 165
           +L+++  E D++  +ILE L  C   LN+LP LEQV  ER TMLKQREK+++ VLLDYAM
Sbjct: 84  ELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQREKVFTNVLLDYAM 143

Query: 166 KLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIP 214
           KLAKFT VPPTFDKG VGPNNF+WPAEDAMRRGMLA+ASL++ E  + P
Sbjct: 144 KLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIASLQASEDAKKP 192

>Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W
           (REAL)
          Length = 287

 Score =  241 bits (614), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 110/170 (64%), Positives = 139/170 (81%)

Query: 46  RVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRLN 105
           +V++Y D+C YE+ LGKLV SVD+FKP+L++A++LI+TD+ LF  ++    YDKID  L 
Sbjct: 39  KVQLYEDLCRYEDILGKLVESVDRFKPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNLR 98

Query: 106 DLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDYAM 165
            ++K S+E+D KT KILE+LN CH +L++LP LEQV  E+ T+L+QR KI S  LLDYA 
Sbjct: 99  KIDKDSEELDSKTRKILEILNECHDELSALPMLEQVEFEKKTILQQRSKINSTALLDYAT 158

Query: 166 KLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPG 215
           KL+KFTR+PPTFDKG VGPNNFIWPAEDA+RRGMLAMASL SKELTRIPG
Sbjct: 159 KLSKFTRIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRIPG 208

>KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa]
           {ON} some similarities with uniprot|Q12343 Saccharomyces
           cerevisiae YOR174W MED4 Member of RNA Polymerase II
           transcriptional regulation mediator Stoichiometric
           member of mediator complex
          Length = 263

 Score =  239 bits (610), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 108/164 (65%), Positives = 139/164 (84%)

Query: 46  RVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRLN 105
           +++VY DICE+E+TLGKLV+SVD+F PDL++A+ LIE DK+L+K+LE  PKYD+ID R  
Sbjct: 24  KLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEIDTRAK 83

Query: 106 DLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDYAM 165
            L+++ ++ D+KT +ILE L  C + LN+LP LEQV  ER+TMLKQREK+++ VLLDYAM
Sbjct: 84  TLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVFTDVLLDYAM 143

Query: 166 KLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKE 209
           KLAKFT VPPTFDKG VGPNNF+WPAEDAMRRGMLA+ASL++ E
Sbjct: 144 KLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLRASE 187

>ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 295

 Score =  239 bits (610), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 139/171 (81%)

Query: 46  RVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRLN 105
           +V++YAD+ +YEE L  LV SVD FKPD+K+  ELIE DK L+K+L+ F +YD+ID  LN
Sbjct: 45  KVQIYADLTQYEEKLAALVESVDNFKPDVKIVHELIEVDKSLYKSLDSFAEYDRIDSELN 104

Query: 106 DLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDYAM 165
            L+K+S E+D+KT ++LE L+ C+  LN LP LEQV  E+ ++LKQR K+ S VLL+YA 
Sbjct: 105 RLDKESNELDRKTKEVLETLSECYEMLNGLPMLEQVEFEKQSILKQRSKVNSSVLLNYAT 164

Query: 166 KLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPGQ 216
           KL+KFT++PPTFDKG +GPNNF+WPAEDA+RRGMLA+ASL SKE+TRIPG+
Sbjct: 165 KLSKFTKIPPTFDKGTIGPNNFVWPAEDALRRGMLAIASLHSKEMTRIPGE 215

>AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR174W (MED4)
          Length = 294

 Score =  238 bits (607), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 140/170 (82%)

Query: 47  VEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRLND 106
           V +Y D+C+YEE+L +LV+SVDKF+PDL+ AQELIE D KL+  L + PKYD ID +L  
Sbjct: 50  VAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLIDSQLKK 109

Query: 107 LEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDYAMK 166
           LE++S+++D++T+KIL +L  C+  LNSLP +EQV  E  TM KQ++K+ S VLL+YAMK
Sbjct: 110 LEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVLLEYAMK 169

Query: 167 LAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPGQ 216
           L+KFTRVPPTF+K  +GPNNFIWPAEDA+RRGMLAMASLKSKELT +PGQ
Sbjct: 170 LSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPGQ 219

>Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON}
           (21260..22138) [879 nt, 293 aa]
          Length = 292

 Score =  236 bits (601), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 139/171 (81%)

Query: 46  RVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRLN 105
           +V++Y DI EYE TL KLV SVDKFKPD+K+A +LI+ D++LFK+L+ F +YDKI  +L 
Sbjct: 44  KVQIYNDISEYENTLFKLVESVDKFKPDVKLAHQLIDVDERLFKSLDSFVEYDKISTKLE 103

Query: 106 DLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDYAM 165
           + +K++ E+D KT +IL  LN CH  LNSLP LEQV  E+D +LKQR KI S +LLDYA 
Sbjct: 104 ECDKEAAELDTKTKEILGTLNECHGLLNSLPMLEQVEFEKDIILKQRSKINSKLLLDYAT 163

Query: 166 KLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPGQ 216
           KL+KFT++PPTF+KG +GPNNFIWPAEDA+RRGMLAMASL SKELT++P +
Sbjct: 164 KLSKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAMASLHSKELTKLPNE 214

>Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W
           (REAL)
          Length = 288

 Score =  236 bits (601), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 116/225 (51%), Positives = 154/225 (68%), Gaps = 12/225 (5%)

Query: 46  RVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRLN 105
           +V++Y D+C YE+TL KLV SVD+FKPD+ VA++LI+ D+ LF  ++   +YD ID  L 
Sbjct: 39  KVQLYEDLCRYEDTLKKLVESVDRFKPDIDVARDLIKIDESLFNNVDLLSEYDNIDRNLR 98

Query: 106 DLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDYAM 165
            ++K S+E+D KT +ILE++N CH +L +LP LEQV  E++T+L+QR KI S  LLDYA 
Sbjct: 99  KIDKDSEELDSKTKRILEIMNECHDELGALPMLEQVEFEKNTILQQRSKINSTALLDYAT 158

Query: 166 KLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPGQXXXXXXXXX 225
           KL+KFTR+PPTFDKG +GPNNFIWPAEDA+RRGMLAMASL SKELTR+PG+         
Sbjct: 159 KLSKFTRIPPTFDKGSIGPNNFIWPAEDALRRGMLAMASLHSKELTRVPGE--------E 210

Query: 226 XXXXXXXXXXXXTKPETKSTLTENESETVAAREEIPRRSSFEFTA 270
                       + P       +NE +T  A+EE+P   SF F  
Sbjct: 211 AEEAAETEEVLVSSPSQNG--LDNEHKT--AKEEVPSTDSFIFNG 251

>YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subunit
           of the RNA polymerase II mediator complex; associates
           with core polymerase subunits to form the RNA polymerase
           II holoenzyme; essential for transcriptional regulation
          Length = 284

 Score =  232 bits (592), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 107/170 (62%), Positives = 137/170 (80%)

Query: 46  RVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRLN 105
           +V++Y D+C YE+TL KLV SVD+FKP+L +A++LI TD+ LF+ ++   +YD I   L 
Sbjct: 39  KVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNLQ 98

Query: 106 DLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDYAM 165
            ++K S+E+D KT KILE+LN CH +L +LP LEQV  E++T+L+QR KI S  LLDYA 
Sbjct: 99  KIDKDSEELDSKTRKILEILNECHDELKALPMLEQVEFEKNTILQQRSKINSTELLDYAT 158

Query: 166 KLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPG 215
           KL+KFT++PPTFDKG VGPNNFIWPAEDA+RRGMLAMASL SKELTRIPG
Sbjct: 159 KLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRGMLAMASLHSKELTRIPG 208

>NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65
           YOR174W
          Length = 281

 Score =  232 bits (592), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 103/170 (60%), Positives = 135/170 (79%)

Query: 46  RVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRLN 105
           +V++Y+D+C YE+ L  LV+SVDKFKPD+  A+ELIE D+ LF+ L+ F +YDKID  L 
Sbjct: 43  KVQIYSDLCSYEQKLANLVNSVDKFKPDMNAARELIEVDRHLFQTLDSFEEYDKIDNSLK 102

Query: 106 DLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDYAM 165
            L  +S E+D +T +IL +LN CH +LN+LP L+QV  E +T+L+QR KI S VLLDYA 
Sbjct: 103 KLNAESIELDARTKEILGILNECHDELNALPMLKQVEFEMETILQQRSKINSSVLLDYAT 162

Query: 166 KLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPG 215
           KL+KFT++PPTFDKG +GPNNFIWPAEDA+RRGMLA+ASL + ELT+ PG
Sbjct: 163 KLSKFTKIPPTFDKGSIGPNNFIWPAEDALRRGMLALASLHADELTKAPG 212

>Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W
           (REAL)
          Length = 286

 Score =  232 bits (591), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 106/171 (61%), Positives = 134/171 (78%)

Query: 46  RVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRLN 105
           +V++Y D+C YE  L KLV SVD+FKPDL VA++LI  D+ LF  ++    YD ID  L 
Sbjct: 39  KVQLYEDLCRYEGVLSKLVESVDRFKPDLDVARDLISADESLFNNVKLLADYDNIDRNLQ 98

Query: 106 DLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDYAM 165
            ++K S+E+D K+ KILE+LN CH +L+ LP LEQV  E++T+L+QR KI S  LLDYA 
Sbjct: 99  KIDKDSEELDSKSRKILEILNECHDELSGLPTLEQVEFEKNTILQQRSKINSTALLDYAT 158

Query: 166 KLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPGQ 216
           KL+KFT++PPTFDKG VGPNNFIWPAEDA+RRGMLAMASL SKELTR+PG+
Sbjct: 159 KLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRVPGE 209

>KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {ON}
           Anc_6.65 YOR174W
          Length = 279

 Score =  231 bits (590), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 107/171 (62%), Positives = 136/171 (79%)

Query: 46  RVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRLN 105
           +V +Y+ I EYE+TL  LV SVD +KPD+ VAQ L++ DK+LF +L++F +YD+I  RL 
Sbjct: 42  KVRIYSGIVEYEDTLAALVESVDSYKPDMAVAQRLVDADKELFASLDKFKEYDEISTRLG 101

Query: 106 DLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDYAM 165
           +L+ +S  +D KT  ILE LN CH +LN LP LEQV  E DT+L+QREKI S  LLDYA 
Sbjct: 102 ELKGKSTALDTKTRDILEKLNECHDELNKLPYLEQVQFEMDTILEQREKINSSELLDYAT 161

Query: 166 KLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPGQ 216
           KL+KFTR+PPTFDKG +GPNNFIWPAEDA+R+GMLA+A+L S+ELTRIPGQ
Sbjct: 162 KLSKFTRIPPTFDKGSIGPNNFIWPAEDALRKGMLAIAALHSRELTRIPGQ 212

>CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174w MED4
          Length = 264

 Score =  226 bits (577), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 134/171 (78%)

Query: 46  RVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRLN 105
           +V++Y+D+C YEE L KLV SVD FKP L++ ++LIE DKKL+  L+  P+YD +  RL 
Sbjct: 19  KVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKLYSTLDLLPQYDSVFTRLR 78

Query: 106 DLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDYAM 165
            L+ +  +VD++T  IL +LN CH  LN+LP LE+V  E+  +LKQREKI S VLL+YA 
Sbjct: 79  TLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKMILKQREKIKSNVLLEYAT 138

Query: 166 KLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPGQ 216
           KLAKFT++PPTFDKG +GPNNFIWPAEDA+R+GMLAMASL  KELT++PGQ
Sbjct: 139 KLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHGKELTKLPGQ 189

>KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON}
           Anc_6.65 YOR174W
          Length = 289

 Score =  227 bits (578), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 133/170 (78%)

Query: 46  RVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRLN 105
           +V +Y+D+ +YEETL +L+ S+D +KPD K+AQELI+ D KLF +L+ F +YD+I  RL 
Sbjct: 43  KVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSRLK 102

Query: 106 DLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDYAM 165
           D EKQ +E   KT +ILE LN CH  LN LP ++QV  E +TML+QR+KI S VLLDYA 
Sbjct: 103 DFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDYAT 162

Query: 166 KLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPG 215
           KL+KFT++PPTFDKG +GPNNF+WPAEDA+RRGMLA+A+  + ELT+I G
Sbjct: 163 KLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELTKIAG 212

>TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65
           YOR174W
          Length = 318

 Score =  223 bits (568), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 134/170 (78%)

Query: 46  RVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRLN 105
           +++ Y D+ +YEETL KL SSVDK+KPDL+ A +LI+ D+KL+  L+ F KYD+I  +L 
Sbjct: 39  KIQTYNDLIQYEETLSKLSSSVDKYKPDLQYAYDLIDIDRKLYSTLDSFVKYDEISTKLK 98

Query: 106 DLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDYAM 165
            LE  ++ +D+KT  +L+ LN CH  LN+LP LEQV  E++TMLKQREKI S VLLDYA 
Sbjct: 99  KLEIDTKALDEKTKSVLDSLNDCHELLNTLPMLEQVEFEKNTMLKQREKINSKVLLDYAT 158

Query: 166 KLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPG 215
           KLAKFT++PPTF+K  +GPNNFIWPAEDA+RRGMLA+AS  ++ELT +PG
Sbjct: 159 KLAKFTKIPPTFNKNTLGPNNFIWPAEDALRRGMLAVASAHTEELTALPG 208

>KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa]
           {ON} similar to uniprot|Q12343 Saccharomyces cerevisiae
           YOR174W MED4 Member of RNA Polymerase II transcriptional
           regulation mediator Stoichiometric member of mediator
           complex
          Length = 285

 Score =  219 bits (559), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 115/225 (51%), Positives = 146/225 (64%), Gaps = 3/225 (1%)

Query: 47  VEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRLND 106
           V +Y D+  YEET+ +L  SVD FKPDL +  ++IE DKKL++ LEEF +Y KI+  L+ 
Sbjct: 35  VGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLEEFDEYYKIEEELSR 94

Query: 107 LEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDYAMK 166
           L+K+ + +D KT +ILE LN C+  LN LP LEQV  E+  MLKQREKI+S V+LDYAMK
Sbjct: 95  LDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKVVLDYAMK 154

Query: 167 LAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPGQXXXXXXXXXX 226
           LAKFTR PPTFDK M+GPNNFIWPAED++R+GMLAMASLK KEL                
Sbjct: 155 LAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMASLKKKELLL---DALDEDNVNND 211

Query: 227 XXXXXXXXXXXTKPETKSTLTENESETVAAREEIPRRSSFEFTAD 271
                      T  ++      N+ +   A E+  RR SFEFTA+
Sbjct: 212 NNTSKIDEMRNTNEDSVDDRFNNKEQVQDATEDTERRGSFEFTAN 256

>NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {ON}
           Anc_6.65 YOR174W
          Length = 334

 Score =  221 bits (563), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 100/170 (58%), Positives = 127/170 (74%)

Query: 47  VEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRLND 106
           V +Y DI  YE+ L +L+ SVDKFKP+L +AQELI+ DK LF  L  F +YD+ID  L  
Sbjct: 79  VRIYDDIITYEKALSRLIDSVDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLHLKA 138

Query: 107 LEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDYAMK 166
           LE ++ ++D+ T   L+ LN CH  LN LP L Q+  E +T+L QR KI S +LLDYA K
Sbjct: 139 LETKASKIDELTQSTLQTLNECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDYATK 198

Query: 167 LAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPGQ 216
           L+KFT++PPTFDKG +GPNNFIWPAED++RRGMLAMASLK+ +LT IPGQ
Sbjct: 199 LSKFTKIPPTFDKGSIGPNNFIWPAEDSLRRGMLAMASLKADQLTYIPGQ 248

>Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON}
           similar to Ashbya gossypii AGR270W
          Length = 274

 Score =  218 bits (554), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 135/169 (79%)

Query: 46  RVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRLN 105
           +V +Y D+C++EE L KLV SVDKF PDL+ AQ+LI +D KL+  LE+ P YD ID +L 
Sbjct: 24  QVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSIDIQLK 83

Query: 106 DLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDYAM 165
            L+ +SQE+D++T KIL +L+ C+  LN LP +EQV  E   M KQ+EKI SGVLL+YAM
Sbjct: 84  QLDNESQEIDERTGKILSILDKCYNNLNKLPMVEQVEFEMKMMKKQKEKIKSGVLLEYAM 143

Query: 166 KLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIP 214
           KLAKFTRVPPTF+K  +GPNNFIWPAEDA+RRGMLAMASLKS+ELTRIP
Sbjct: 144 KLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIP 192

>TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65
           YOR174W
          Length = 306

 Score =  209 bits (531), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 132/170 (77%)

Query: 46  RVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRLN 105
            V +Y DI  YE+TL KLVSS+D F+PD++VA+ LIE DK+L+K L  F +YD+ID +++
Sbjct: 59  NVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYKNLGSFKEYDEIDTKIS 118

Query: 106 DLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDYAM 165
            ++  S+++D +T  IL++LN     LNSLP LE++  ERD M ++++KI S +LLDYA 
Sbjct: 119 KIKDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFERDVMHEKQKKINSKILLDYAT 178

Query: 166 KLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPG 215
           K++KFT++PPTF+KG +GPNNFIWPAEDA+RRGMLA+AS+   ELT++P 
Sbjct: 179 KISKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVASIHRSELTKLPN 228

>TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON}
           Anc_6.65 YOR174W
          Length = 220

 Score =  179 bits (454), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 122/164 (74%), Gaps = 3/164 (1%)

Query: 48  EVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRLNDL 107
           +VY D+  YEE LG+LV SVD+F+PDL  A+EL+E D+ L K+L++F  YD++D  L  L
Sbjct: 3   QVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRL 62

Query: 108 EKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDYAMKL 167
           +++S+ +++ T++ LE L+ C+  L++LP LEQV  E+  +L+QR ++ S VLL+YA KL
Sbjct: 63  DRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKL 122

Query: 168 AKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELT 211
           +KFT+ P       VGPNNF+WPAEDA+RRG LA+A+L S+E+T
Sbjct: 123 SKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163

>SAKL0C02222g Chr3 (197312..200773) [3462 bp, 1153 aa] {ON} weakly
           similar to Saccharomyces cerevisiae YLR187W SKG3 Protein
           of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cell periphery,
           cytoplasm, bud, and bud neck; potential Cdc28p substrate
           And to YNL278W uniprot|P53836 Saccharomyces cerevisiae
           YNL278W CAF120 Part of the evolutionarily- conserved
           CCR4-NOT transcriptional regulatory complex involved in
           controlling mRNA initiation, elongation, and degradation
          Length = 1153

 Score = 33.5 bits (75), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 8/90 (8%)

Query: 70  FKPDLKVAQELIETDKKLFKALEEFPKY--DKIDGRLNDLEKQSQ-----EVDKKTSKIL 122
           F PD     +++E++ + + A E   +Y  D++ G  N L ++       + D+ TS + 
Sbjct: 805 FDPDFMEENQMLESESR-YTAEENKFQYANDRLAGSANHLGERENTQPFYKTDQSTSSLY 863

Query: 123 EVLNGCHAQLNSLPALEQVLLERDTMLKQR 152
             L+G     NSLP    +     +M KQR
Sbjct: 864 SPLDGAGGSSNSLPKTGGLGYAPQSMPKQR 893

>TPHA0D03740 Chr4 complement(784729..791682) [6954 bp, 2317 aa] {ON}
            Anc_6.311 YMR207C
          Length = 2317

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 23/33 (69%)

Query: 62   KLVSSVDKFKPDLKVAQELIETDKKLFKALEEF 94
            K ++++D  +PDLK+ +ELIE D  +F +L  F
Sbjct: 1139 KFLNNIDHPQPDLKILEELIECDFAIFDSLFPF 1171

>TPHA0B01870 Chr2 (417669..418922) [1254 bp, 417 aa] {ON} Anc_4.300
           YLR423C
          Length = 417

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 12/72 (16%)

Query: 48  EVYADICEYEETL------GKLVSSVDKFKPDLKVAQELIETDKK----LFKALEEFPKY 97
           E+  DI  Y  +L       +L+  +D+F PD K   E+I+ D      + ++LEE  K 
Sbjct: 205 ELECDIVNYLSSLTHHYEQCQLLCDIDEFSPDFKELSEIIKADNNELHIISESLEETVK- 263

Query: 98  DKIDGRLNDLEK 109
             I+GR+N + K
Sbjct: 264 -NINGRINSVSK 274

>KLLA0A06402g Chr1 complement(578090..580057) [1968 bp, 655 aa] {ON}
           similar to uniprot|P34237 Saccharomyces cerevisiae
           YKL179C
          Length = 655

 Score = 30.0 bits (66), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 34/65 (52%)

Query: 47  VEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRLND 106
           +E+Y  + E  +  G L S V++ K D     ++   ++KL   + +   YD +  RL+D
Sbjct: 91  IELYEKLIEQPDPTGILESIVEELKKDGTNVDDIKAENQKLAAIVSKCADYDTLKKRLSD 150

Query: 107 LEKQS 111
           LE+ S
Sbjct: 151 LEQNS 155

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,098,614
Number of extensions: 847538
Number of successful extensions: 3317
Number of sequences better than 10.0: 95
Number of HSP's gapped: 3465
Number of HSP's successfully gapped: 100
Length of query: 299
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 190
Effective length of database: 40,982,805
Effective search space: 7786732950
Effective search space used: 7786732950
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 65 (29.6 bits)