Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0A08206g6.69ON64564532520.0
Kwal_56.232566.69ON5672482162e-17
KLTH0G15334g6.69ON5821802055e-16
ZYRO0B01936gsingletonON8242001922e-14
ZYRO0A11132gsingletonON6982341565e-10
Kpol_1008.29singletonON5381761521e-09
ZYRO0E04708gsingletonON6111721234e-06
Ecym_31196.69ON3781111181e-05
AGR274C6.69ON375441143e-05
TDEL0G045606.69ON4821401144e-05
TPHA0K011506.69ON324126890.029
TDEL0H03270singletonON741122870.071
CAGL0C05577g2.16ON61980761.6
Suva_8.2336.69ON465126751.7
Skud_15.3446.69ON465132742.3
YOR177C (MPC54)6.69ON464117733.1
KAFR0L008107.230ON51164733.6
KAFR0G033104.268ON676138733.7
NDAI0B019708.259ON1415207725.4
Kwal_27.125303.330ON1087168707.6
ABR081C2.590ON841177707.9
TDEL0H025107.196ON418144698.7
Ecym_64762.16ON850123699.4
Kpol_463.171.257ON142736610.0
NOTE: 1 genes in the same pillar as SAKL0A08206g were not hit in these BLAST results
LIST: Smik_15.362

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0A08206g
         (645 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conser...  1257   0.0  
Kwal_56.23256 s56 complement(468118..469821) [1704 bp, 567 aa] {...    88   2e-17
KLTH0G15334g Chr7 (1343754..1345502) [1749 bp, 582 aa] {ON} cons...    84   5e-16
ZYRO0B01936g Chr2 complement(156676..159150) [2475 bp, 824 aa] {...    79   2e-14
ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {...    65   5e-10
Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {O...    63   1e-09
ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {...    52   4e-06
Ecym_3119 Chr3 (221707..222843) [1137 bp, 378 aa] {ON} similar t...    50   1e-05
AGR274C Chr7 complement(1252837..1253964) [1128 bp, 375 aa] {ON}...    49   3e-05
TDEL0G04560 Chr7 (831920..833368) [1449 bp, 482 aa] {ON} Anc_6.6...    49   4e-05
TPHA0K01150 Chr11 (241560..242534) [975 bp, 324 aa] {ON} Anc_6.6...    39   0.029
TDEL0H03270 Chr8 complement(546044..548269) [2226 bp, 741 aa] {O...    38   0.071
CAGL0C05577g Chr3 (536419..538278) [1860 bp, 619 aa] {ON} weakly...    34   1.6  
Suva_8.233 Chr8 complement(415017..416414) [1398 bp, 465 aa] {ON...    33   1.7  
Skud_15.344 Chr15 complement(616669..618066) [1398 bp, 465 aa] {...    33   2.3  
YOR177C Chr15 complement(665785..667179) [1395 bp, 464 aa] {ON} ...    33   3.1  
KAFR0L00810 Chr12 complement(151407..152942) [1536 bp, 511 aa] {...    33   3.6  
KAFR0G03310 Chr7 (682336..684366) [2031 bp, 676 aa] {ON} Anc_4.2...    33   3.7  
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....    32   5.4  
Kwal_27.12530 s27 complement(1261137..1264400) [3264 bp, 1087 aa...    32   7.6  
ABR081C Chr2 complement(534374..536899) [2526 bp, 841 aa] {ON} S...    32   7.9  
TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.1...    31   8.7  
Ecym_6476 Chr6 (921068..923620) [2553 bp, 850 aa] {ON} similar t...    31   9.4  
Kpol_463.17 s463 complement(45852..46280) [429 bp, 142 aa] {ON} ...    30   10.0 

>SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conserved
           hypothetical protein
          Length = 645

 Score = 1257 bits (3252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/645 (96%), Positives = 624/645 (96%)

Query: 1   MDGSIVTDAFMANDTRPLDASYTSVAPRIPPKLCFSELPSTLDLGSKLDQKSSNHLADCM 60
           MDGSIVTDAFMANDTRPLDASYTSVAPRIPPKLCFSELPSTLDLGSKLDQKSSNHLADCM
Sbjct: 1   MDGSIVTDAFMANDTRPLDASYTSVAPRIPPKLCFSELPSTLDLGSKLDQKSSNHLADCM 60

Query: 61  PTTGKSSVEMGTTSNNTISSPVQDNSDGSNDGEYNSDEDIALNKVLVTPVYTIKNSNPFL 120
           PTTGKSSVEMGTTSNNTISSPVQDNSDGSNDGEYNSDEDIALNKVLVTPVYTIKNSNPFL
Sbjct: 61  PTTGKSSVEMGTTSNNTISSPVQDNSDGSNDGEYNSDEDIALNKVLVTPVYTIKNSNPFL 120

Query: 121 EDAIASAICPLEVTNHTPKIRFGENSVKMFYSDSLIGNGLEENPPRKPNGNLKHDSVKSV 180
           EDAIASAICPLEVTNHTPKIRFGENSVKMFYSDSLIGNGLEENPPRKPNGNLKHDSVKSV
Sbjct: 121 EDAIASAICPLEVTNHTPKIRFGENSVKMFYSDSLIGNGLEENPPRKPNGNLKHDSVKSV 180

Query: 181 LVEKNSDNACPLKSKDSDTADQDWEVNVPIENTVALEAITRCFNLCNVPXXXXXXXXXVM 240
           LVEKNSDNACPLKSKDSDTADQDWEVNVPIENTVALEAITRCFNLCNVP         VM
Sbjct: 181 LVEKNSDNACPLKSKDSDTADQDWEVNVPIENTVALEAITRCFNLCNVPLEDLDEDDLVM 240

Query: 241 SLQRLSFGIVSAFKTQEMCYKYLGKKEKEEILGSLNHLGEKVICLEEDNEQLTLKVKQLS 300
           SLQRLSFGIVSAFKTQEMCYKYLGKKEKEEILGSLNHLGEKVICLEEDNEQLTLKVKQLS
Sbjct: 241 SLQRLSFGIVSAFKTQEMCYKYLGKKEKEEILGSLNHLGEKVICLEEDNEQLTLKVKQLS 300

Query: 301 LENQQLFQNSKPDNLKDELAEKLKGKIMQLEGKISTKDKEYHKVLTQLNSLKNNSHDDSS 360
           LENQQLFQNSKPDNLKDELAEKLKGKIMQLEGKISTKDKEYHKVLTQLNSLKNNSHDDSS
Sbjct: 301 LENQQLFQNSKPDNLKDELAEKLKGKIMQLEGKISTKDKEYHKVLTQLNSLKNNSHDDSS 360

Query: 361 QQSIVLKQLAEKTREAEILRRRLTEQNDRIVXXXXXXXXXXXXYREVKSQYDLLAKEKER 420
           QQSIVLKQLAEKTREAEILRRRLTEQNDRIV            YREVKSQYDLLAKEKER
Sbjct: 361 QQSIVLKQLAEKTREAEILRRRLTEQNDRIVNNSNELENLKLEYREVKSQYDLLAKEKER 420

Query: 421 TDFKCKEFQESWYEATERTKTIQAELLKLEKEKDQILTESKKTEKELIKEHQNDQKLFLS 480
           TDFKCKEFQESWYEATERTKTIQAELLKLEKEKDQILTESKKTEKELIKEHQNDQKLFLS
Sbjct: 421 TDFKCKEFQESWYEATERTKTIQAELLKLEKEKDQILTESKKTEKELIKEHQNDQKLFLS 480

Query: 481 SKETYDNLSKKVQEQIVARNTQQRKMNVLSQKIVKLSEELNKVKEERTALNESLSSVTEE 540
           SKETYDNLSKKVQEQIVARNTQQRKMNVLSQKIVKLSEELNKVKEERTALNESLSSVTEE
Sbjct: 481 SKETYDNLSKKVQEQIVARNTQQRKMNVLSQKIVKLSEELNKVKEERTALNESLSSVTEE 540

Query: 541 NNKSKALTEKLEVKLTNQKKRFKELVKWNEKLLKMDGNMRKEIYKTVEDYESKASELERV 600
           NNKSKALTEKLEVKLTNQKKRFKELVKWNEKLLKMDGNMRKEIYKTVEDYESKASELERV
Sbjct: 541 NNKSKALTEKLEVKLTNQKKRFKELVKWNEKLLKMDGNMRKEIYKTVEDYESKASELERV 600

Query: 601 NLELKRLKDVLYDTRMEIYSKNNKKDSLTLNRNVLTVISNKYTTV 645
           NLELKRLKDVLYDTRMEIYSKNNKKDSLTLNRNVLTVISNKYTTV
Sbjct: 601 NLELKRLKDVLYDTRMEIYSKNNKKDSLTLNRNVLTVISNKYTTV 645

>Kwal_56.23256 s56 complement(468118..469821) [1704 bp, 567 aa] {ON}
           YDL058W (USO1) - Integrin analogue gene [contig 183]
           FULL
          Length = 567

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 77/248 (31%), Positives = 119/248 (47%), Gaps = 41/248 (16%)

Query: 95  NSDEDIALNKVLVTPVYTIKNSNPFLEDAIASAICPLEVTNHTPKIRFGENSVKMFYSDS 154
           +S  D+ L + +V+ VY +KN NP +E  +A  +      N    +RFG N  K+F  +S
Sbjct: 52  SSSADLGLQEDIVSDVYDVKNVNPLVEKFVAKRMKIKSRLNSM--VRFGSNRTKIFDKES 109

Query: 155 LIGNGLEENPPRKPNGNLKHDSVKSVLVEKNSDNACPLKSKDSDTADQDWEVNVPIENTV 214
           ++    +E P   P          S+LV K   N   L+ +DS +   DWE ++PI N V
Sbjct: 110 ILQVPKKEPPRLTPRD--------SILVVKEQ-NPQYLE-EDSQS---DWEQDIPISNPV 156

Query: 215 ALEAITRCFNLCNVPXXXXXXXXXVMSLQRLSFGIVSAFKTQEMCYKYLGKKEKEEILGS 274
            LE + RC++ C +P         +M++Q+LS+GI+ AF  Q                G+
Sbjct: 157 VLEGLLRCWDACGIPESEFDDEDLIMTVQKLSYGILQAFNNQ----------------GT 200

Query: 275 LNHL--GEKVICLEEDNEQLTLKVKQLSLENQQLFQ--NSKPDNLKDELA--EKLKGKIM 328
           +N L   ++V  L ED EQ  L +    LE  QL    N   DNL  +++   K + +I 
Sbjct: 201 INRLVKYQQVSKLTEDFEQCWLDL----LEALQLGDTVNELKDNLTTQVSINAKNEDRIH 256

Query: 329 QLEGKIST 336
            LE +I T
Sbjct: 257 SLEDQIKT 264

>KLTH0G15334g Chr7 (1343754..1345502) [1749 bp, 582 aa] {ON}
           conserved hypothetical protein
          Length = 582

 Score = 83.6 bits (205), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 89/180 (49%), Gaps = 17/180 (9%)

Query: 94  YNSDEDIALN-KVLVTPVYTIKNSNPFLEDAIASAICPLEVTNH-TPKIRFGENSVKMFY 151
           Y+ D D  L  +  V+ VY ++N+NP +E+ +      + V    +  +RFG N  K+F 
Sbjct: 64  YSIDRDNDLRPETYVSDVYEVRNTNPIVEEFVTEQ---MRVKGRPSSLLRFGCNQTKLFD 120

Query: 152 SDSLIGNGLEENPPRKPNGNLKHDSVKSVLVEKNSDNACPLKSKDSDTADQDWEVNVPIE 211
             + IGN       RKP+G +K +S+  V      D       +DS +   DW+ ++PI+
Sbjct: 121 MHASIGNS----HIRKPSGAIKPESILIV-----KDQEPRYLEEDSHS---DWDQDIPID 168

Query: 212 NTVALEAITRCFNLCNVPXXXXXXXXXVMSLQRLSFGIVSAFKTQEMCYKYLGKKEKEEI 271
           N V LE   RC+  C +P         +M++Q+LS+GI+ A   Q    + +  ++  EI
Sbjct: 169 NPVVLEGFLRCWEACGIPDFEFDAEDMIMTVQKLSYGILQALANQGTVNRLVKAQQFSEI 228

>ZYRO0B01936g Chr2 complement(156676..159150) [2475 bp, 824 aa] {ON}
           weakly similar to uniprot|P25386 Saccharomyces
           cerevisiae YDL058W USO1 involved intracellular protein
           transport, coiled-coil protein necessary for protein
           transport from ER to Golgi; Integrin analogue gene
          Length = 824

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 97/200 (48%), Gaps = 30/200 (15%)

Query: 101 ALNKVLVTPVYTIKNSNPFLEDAIAS-AICPLEVTNHTPKIRFGENSVKMFYSDSLIG-- 157
           A+ K++VTP Y +KNSNP +++AI + +    E  + + KI+FGE+    F  D  +   
Sbjct: 36  AVKKLVVTPAYGVKNSNPIIDEAIDNFSFLYSEPKSKSNKIQFGESRTITFDVDEEVDRL 95

Query: 158 --------NGLEENPPRK----PNGNLKHDSVKSVLVEKNSDNACPLKSKDSDTADQ-DW 204
                   N  +++ P K    P     HDS               L+++D    D+ D 
Sbjct: 96  ASKTKNTENQSKDSKPLKTILKPGPVFVHDSE-------------LLETEDFAYLDESDE 142

Query: 205 EVNVPIENTVALEAITRCFNLCNVPXXXXXXXXXVMSLQRLSFGIVSAFKTQEMCYKYLG 264
           E  V   N   +  + R F L  +P         + +LQRL+ G+V++FK +E CYKY+G
Sbjct: 143 ETQVKTSNQDVITLLQRIFTLHGIPPCEIKEDL-LGTLQRLARGVVASFKQREQCYKYVG 201

Query: 265 KKEKEEILGSLNHLGEKVIC 284
           +K+  E L  L ++ +K+ C
Sbjct: 202 RKQSIEELDELEYVNDKLKC 221

>ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {ON}
           some similarities with uniprot|Q22X91 Tetrahymena
           thermophila SB210 TTHERM_00561660 Viral A-type inclusion
           protein repeat containing protein
          Length = 698

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 96/234 (41%), Gaps = 34/234 (14%)

Query: 93  EYNSDEDIALNKVLVTPVYTIKNSNPFLEDAI--------------ASAICPLEV----- 133
           +Y    D  + + L+TP++ IKN N  +  A+                   P E      
Sbjct: 19  DYKPSRDELIKEPLITPIHEIKNQNKLINSAMLYFSKPSHRDHGFYPDPKIPYEAYFANE 78

Query: 134 TNHTPKIRFGENSVKMFYSDSLIGNGLEENPPRKPNGNLKHDSVKSVLVEKNSDNACPLK 193
           T    K+RFGEN    F  +  +G  + +    KP       S    L +KN+ N   LK
Sbjct: 79  TEEREKLRFGENETITFDINEEVGKLVMKEAEYKPA------SQHGALDQKNTKNKSILK 132

Query: 194 SKDSDTADQDWEVNVPIENTVALEAITRCFNLCNVPXXXXXXXXXVMSLQRLSFGIVSAF 253
           +            N  I+     E + +C+N+C +            SL +L FGI + F
Sbjct: 133 TNPRTVIPYRPHANPYID--ACQEVMIKCYNMCGISVDYLDIDKMFDSLGKLMFGISNEF 190

Query: 254 KTQEMCYKYL-------GKKEKEEILGSLNHLGEKVICLEEDNEQLTLKVKQLS 300
           K +E+C+ Y+         +EKE++  S+     + + L E N +L +K++Q S
Sbjct: 191 KMKELCFNYVLAAEKRKWFEEKEDLKASVEQFKTERLGLCELNVELGIKLQQES 244

>Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {ON}
           complement(62595..64211) [1617 nt, 539 aa]
          Length = 538

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 75/176 (42%), Gaps = 33/176 (18%)

Query: 103 NKVLVTPVYTIKNSNPFLEDAIASAICP------------LEVTNHTPKIRFGENSVKMF 150
           N ++VTP++ +K  N  LE+A A  I              + V    PKIRF  N + +F
Sbjct: 25  NDIIVTPIFEVKKENSDLEEAKADYIKKSMQRNSNKNLEKMVVKEKNPKIRFDCNRILIF 84

Query: 151 YSDSLIGNGLEENPPRKPNGNLKHDSVKSVLVEKNSDNACPLKSKDSDTADQDWEVNVPI 210
             D  +                    ++ +L + +S     LK ++ D  D+ +    P 
Sbjct: 85  DQDKEVSKS----------------GIQKILTKSSSSQKSILKKREDDIEDKLY----PQ 124

Query: 211 ENTVALEAITRCFNLCNVPXXXXXXXXXVMSLQRLSFGIVSAFKTQEMCYKYLGKK 266
           ++ +  + + R F LC V             L+RLS  I +AF T+EMC KY+ +K
Sbjct: 125 DDEIT-QIVKRMFTLCGVNLKHIEGISFKEQLERLSVSITNAFNTKEMCSKYIKQK 179

>ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {ON}
           conserved hypothetical protein
          Length = 611

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 77/172 (44%), Gaps = 17/172 (9%)

Query: 136 HTPK--IRFGENSVKMFYSDSLIGNGLEENPPRKPNGNLKHDSVKSVLVEKNSDNACPLK 193
             PK  ++FG+  + +F  D  IG+ +      K N ++ +  +   +++ +   A  +K
Sbjct: 72  QAPKGNVKFGDKEIVIFNEDERIGHSM------KANSSVDNVILPLPILKISQKGASDIK 125

Query: 194 SKDSDTADQDWEVNVPIENTVALEAITRCFNLCNVPXXXXXXXXXVMSLQRLSFGIVSAF 253
             + D         +  +     E   RC+ LCN+P           SL++L  GI  +F
Sbjct: 126 YMEPDNK-------MATQQERLFEVFRRCYTLCNLPMSQFDENNPFKSLKKLCEGIKKSF 178

Query: 254 KTQEMCYKYLGKKEKEEILGSLNHLGEKVICLEED--NEQLTLKVKQLSLEN 303
           K ++ CYKY+  +E   +   +  L + +  L++D  N  + L++ +L   N
Sbjct: 179 KAKDECYKYIRYEENRRLSQEIRKLKDTIQELKDDRHNSLVLLQINKLQKHN 230

>Ecym_3119 Chr3 (221707..222843) [1137 bp, 378 aa] {ON} similar to
           Ashbya gossypii AGR274C
          Length = 378

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 48/111 (43%), Gaps = 21/111 (18%)

Query: 169 NGNLKHDSVKSVLVEKNSDNACPLKSKDS-----------------DTADQDWEVNVPIE 211
           NG L  D+V  V   K   N CP+  K +                 +T D   E  +P E
Sbjct: 38  NGILDQDTV--VAQRKIKFNDCPMGPKLTKNEVPAIPKKSILVNRENTTDTPTEQEIPNE 95

Query: 212 NTVALEAITRCFNLCNVPXXXXXXXXXVMSLQRLSFGIVSAFKTQEMCYKY 262
             + L  + RCFN CN+            +L+ +S+GI+S F+  E CYKY
Sbjct: 96  EVLLL--LRRCFNFCNLDTDGIEKRSIEENLESISYGIISTFRFHECCYKY 144

>AGR274C Chr7 complement(1252837..1253964) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR177C
           (MPC54)
          Length = 375

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 26/44 (59%)

Query: 219 ITRCFNLCNVPXXXXXXXXXVMSLQRLSFGIVSAFKTQEMCYKY 262
           + RCFN CN+          V +L+ +S+GI+S F+  E CYKY
Sbjct: 103 LHRCFNFCNLDTDGVAERPLVENLELISYGIISTFRFHECCYKY 146

>TDEL0G04560 Chr7 (831920..833368) [1449 bp, 482 aa] {ON} Anc_6.69
           YOR177C
          Length = 482

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 65/140 (46%), Gaps = 24/140 (17%)

Query: 139 KIRFGENSVKMFYSDSLIGNGLEENPPRKPNGNLKHDSVKSVLVEKNSDNACPLKSKDSD 198
           K+ FG +SV  F    ++       P +   G ++  S+              LK    +
Sbjct: 106 KVTFGLSSVVHFEESDIV-------PKKSVGGPIRGKSI--------------LKRSSFN 144

Query: 199 TADQDWEVNVPIENTVALEAITRCFNLCNVPXXXXXXXXXVMSLQRLSFGIVSAFKTQEM 258
           +   D+E    I       AI R +NLC++P         ++SL+ L+ G+ +AFK+ E+
Sbjct: 145 SPSTDYE---KIGRRELQNAIARIYNLCDLPFTLFRKDDPLLSLELLARGVCNAFKSHEI 201

Query: 259 CYKYLGKKEKEEILGSLNHL 278
           C+K +G++E  E+   +N+L
Sbjct: 202 CWKKVGEEELLELKEKINNL 221

>TPHA0K01150 Chr11 (241560..242534) [975 bp, 324 aa] {ON} Anc_6.69
           YOR177C
          Length = 324

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 55/126 (43%), Gaps = 24/126 (19%)

Query: 140 IRFGENSVKMFYSDSLIGNGLEENPPRKPNGNLKHDSVKSVL--VEKNSDNACPLKSKDS 197
           ++FG+  VKMF S   I N  +   P K N N    ++K ++  VEK S           
Sbjct: 50  VQFGKEEVKMFDSREDISN--KNIQPFKTNSN--RGALKPIIKAVEKIS----------- 94

Query: 198 DTADQDWEVNVPIENTVALEAITRCFNLCNVPXXXXXXXXXVMSLQRLSFGIVSAFKTQE 257
                D  VN  +E     E +  CF+LC+V             L+RL   I SAFK +E
Sbjct: 95  ----MDNNVNEELE---VKECLAACFSLCSVDEEKFTDLSISKKLRRLYISIGSAFKVKE 147

Query: 258 MCYKYL 263
           + + ++
Sbjct: 148 LFFYWV 153

>TDEL0H03270 Chr8 complement(546044..548269) [2226 bp, 741 aa] {ON} 
          Length = 741

 Score = 38.1 bits (87), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 55/122 (45%), Gaps = 19/122 (15%)

Query: 139 KIRFGENSVKMFYSDSLIGNGLEENPPRKPNGNLKHDS-VKSVLVEKNSDNACPLKSKDS 197
           KI FGE  +K +    ++    +E  P KP    KH +  KS+L  KN++       K  
Sbjct: 276 KIGFGETRIKTYNVGEVV---TKEEHPVKP----KHGAPGKSIL--KNTN------VKKF 320

Query: 198 DTADQDWEVNVPIENTVALEAITRCFNLCNVPXXXXXXXXXVMSLQRLSFGIVSAFKTQE 257
            T   D+ +   +   +   AI R FNL ++P         + SL   + GI +AF  +E
Sbjct: 321 QTPKGDYNL---VGTDLLANAIARLFNLSDMPLKFFDKDDPISSLTWAAHGIANAFGLKE 377

Query: 258 MC 259
           +C
Sbjct: 378 LC 379

>CAGL0C05577g Chr3 (536419..538278) [1860 bp, 619 aa] {ON} weakly
           similar to uniprot|Q07732 Saccharomyces cerevisiae
           YDL239c
          Length = 619

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 50/80 (62%), Gaps = 3/80 (3%)

Query: 504 RKMNVLSQKIVKLSEELNKVKEERTALNESLSSVTEENNKSKALTEKLEVKLTNQKKRFK 563
           +K+N+L ++   L++++  VKE + +L ++  ++ EEN+  K   E L+ K   Q+K  +
Sbjct: 364 KKINLLQKENDSLTKDIKLVKEAQKSLTDTNKNLKEENDLLKGRMELLKQK---QEKEIQ 420

Query: 564 ELVKWNEKLLKMDGNMRKEI 583
           EL K N++LL M+  + KE+
Sbjct: 421 ELKKENKRLLTMNVGLTKEL 440

>Suva_8.233 Chr8 complement(415017..416414) [1398 bp, 465 aa] {ON}
           YOR177C (REAL)
          Length = 465

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 54/126 (42%), Gaps = 25/126 (19%)

Query: 115 NSNPFLEDAIASAICPLEVTNHTPKIRFGENSVKMFYSDSLIGNGLEENPPRKPNGNLKH 174
           NSNP +      +    EVT   P +RFG++ V +F            +  +K N   K 
Sbjct: 16  NSNPNMVSPYKDSFFK-EVTPSKPNVRFGDDDVNIF------------DQRKKVNEINKS 62

Query: 175 DSVKSVLVEKNSDNACP----LKSKDSDTADQ---DW----EVNVPIENTVALEAITRCF 223
             +K  +    + N+ P    LKS  SD+  +   D+    E N      V  +A+ RC+
Sbjct: 63  SYIKKSIPLSTNTNSTPNKSSLKSPRSDSTSKPGFDYIDQLESNDETFKDVN-DAVNRCY 121

Query: 224 NLCNVP 229
            LCN+P
Sbjct: 122 ALCNIP 127

>Skud_15.344 Chr15 complement(616669..618066) [1398 bp, 465 aa] {ON}
           YOR177C (REAL)
          Length = 465

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 58/132 (43%), Gaps = 24/132 (18%)

Query: 113 IKNSNPFLE--DAIASAICPL------EVTNHTPKIRFGENSVKMFYSDSLIGNGLEENP 164
           I  + PF E  +  +  I P       ++T   P +RFG++ V +F     +    + + 
Sbjct: 5   ISYTGPFEEFSNNNSHGISPFKDSYFKDMTPSKPNVRFGDDDVNIFDQRKKVNEINKNSS 64

Query: 165 PRK---PNGNLKHDSVKSVLVEKNSDNA--CPLK-SKDSDTADQDW-EVNVPIENTVALE 217
            R+   P+ N+ +   KS L    S+N   C     +  +T D  + EVN         +
Sbjct: 65  IRRGIPPSININNTPNKSSLKSPKSNNLSDCGFDYERRFETRDDTFKEVN---------D 115

Query: 218 AITRCFNLCNVP 229
           A+ RC+ LCN+P
Sbjct: 116 AVNRCYALCNIP 127

>YOR177C Chr15 complement(665785..667179) [1395 bp, 464 aa] {ON}
           MPC54Component of the meiotic outer plaque, a
           membrane-organizing center which is assembled on the
           cytoplasmic face of the spindle pole body during meiosis
           II and triggers the formation of the prospore membrane;
           potential Cdc28p substrate
          Length = 464

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 49/117 (41%), Gaps = 20/117 (17%)

Query: 125 ASAICPL------EVTNHTPKIRFGENSVKMFYSDSLIGNGLEENPPRKPNGNLKHDSVK 178
           + AI P       E+T   P +RFG++ V +F     +    + N  ++        S+ 
Sbjct: 18  SHAISPYKDSFYKEMTPSKPNVRFGDDDVNIFDQRKKVNEINKNNTVKR--------SIP 69

Query: 179 SVLVEKNSDNACPLKSKDSDTADQ---DWEVNVPIENTVALE---AITRCFNLCNVP 229
           S +    + N   LKS     A +   D E  +  +N    E   A+ RC+ LCN+P
Sbjct: 70  SSISTTITPNKSSLKSPRGKRASKNSFDNETKLESKNETLKEVNDAVNRCYALCNIP 126

>KAFR0L00810 Chr12 complement(151407..152942) [1536 bp, 511 aa] {ON}
           Anc_7.230 YER054C
          Length = 511

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 37/64 (57%), Gaps = 6/64 (9%)

Query: 433 YEATERTKTIQAELLKLEKEKDQILTESKKTEKELIKEHQNDQKLFLSSKETYDNLSKKV 492
           +  TE + T Q + L ++ E D+ L +SK+ +K +IKE++      L  K++ DN++   
Sbjct: 242 FFTTENSMTFQMDNLTMKDESDKSLRKSKRFQKFIIKENR------LEPKQSEDNVTTSN 295

Query: 493 QEQI 496
            EQI
Sbjct: 296 DEQI 299

>KAFR0G03310 Chr7 (682336..684366) [2031 bp, 676 aa] {ON} Anc_4.268
           YDL074C
          Length = 676

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 72/138 (52%), Gaps = 16/138 (11%)

Query: 437 ERTKTIQAELLKLEKEKDQILTESKKTEK------ELIKEHQNDQKLFLSSKETYDNLSK 490
           E+TK  Q     + + KD IL E+K   K      ELI   ++++KL LS  E   NL K
Sbjct: 455 EKTKADQKYFAAM-RSKDSILIENKNYAKTLAKSNELILNLKDNEKLLLSKIE---NLQK 510

Query: 491 KVQEQIVARNTQQRKMN---VLSQKIVKLSEELNKVKEERTALNESLSSVTEENNKSKAL 547
           ++    +++N ++R ++     S K+++L+ ++NK+ + RT L+     +  + NK K L
Sbjct: 511 QLA---LSQNNEKRLIDSNKSESLKLIELNSQINKINKTRTTLSSENLKLVNDLNKLKTL 567

Query: 548 TEKLEVKLTNQKKRFKEL 565
              L + + + + R K L
Sbjct: 568 NNDLSITIKSNESRLKSL 585

>NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8.259
           YLR086W
          Length = 1415

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 103/207 (49%), Gaps = 27/207 (13%)

Query: 425 CKEFQESWYEATERTK-----TIQAELLKLEKEKDQILTESKKTEKELIKEHQ----NDQ 475
           C E +E+ +E  ER K     +  A L  ++KE+   L++SK  +  ++KEH+      Q
Sbjct: 351 CIE-KENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQ 409

Query: 476 KLFLSSKETYDNLSKKVQEQIVARNTQQRKMNVLSQKIVKLSEEL-NKVKEERTALNESL 534
           KL +  +E Y N S K +      N  +     +++KIV + E++ N   ++R       
Sbjct: 410 KLSVLQEE-YQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKR------- 461

Query: 535 SSVTEENNKSKALTEKLEVKLTNQKKRFKELVKWNEKLLKMDGNMRKEIYKTVEDYESKA 594
               E  NK  +L EK++   T +K++  + +  ++KLLK   N R EI     D + + 
Sbjct: 462 ----ELQNKKASLEEKIK-SYTRKKEKASKSIAQSKKLLK---NYRNEIETLNVDQQERE 513

Query: 595 SELERVNLELKRLKDVLYDTRMEIYSK 621
           S L+ +  ELK+ K+VL + ++ +  K
Sbjct: 514 SNLQSLLSELKKEKNVLEEIKLSLKDK 540

>Kwal_27.12530 s27 complement(1261137..1264400) [3264 bp, 1087 aa]
           {ON} YPR049C (CVT9) - Oligomeric, coiled-coil,
           peripheral membrane protein [contig 260] FULL
          Length = 1087

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 80/168 (47%), Gaps = 9/168 (5%)

Query: 454 DQILTESKKTEKELIKEHQNDQKLFL-SSKETYDNLSKKVQEQIVARNTQQRKMNVLSQK 512
           +++++E +K + EL       QKL L SS+E    L  +V +    RN  Q  +  L+Q+
Sbjct: 632 EEVISEVQKLKYEL-----EQQKLELASSREECKQLRSRVVDFEDERNAYQETLVNLNQE 686

Query: 513 IVKLSEELNKVKEERTALNESLSSVTEENNKSKALTEKLEVKLTNQKKRFKELVKWNEKL 572
           + +L+ E    +++  A N+S S++  E N    L   L  +L   K + ++L K  + L
Sbjct: 687 LSRLTAE---REQQMLAKNDSFSTLKAEMNTIGKLNSSLLNELDEWKDKHEKLDKLKDGL 743

Query: 573 LKMDGNMRKEIYKTVEDYESKASELERVNLELKRLKDVLYDTRMEIYS 620
           L        +  K     +++  EL+R  L LK   D L + +M + S
Sbjct: 744 LANMAKFENDFVKERSSLQNEIDELQREILSLKAANDELVNNQMALAS 791

>ABR081C Chr2 complement(534374..536899) [2526 bp, 841 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR031C and
           YKL050C
          Length = 841

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 88/177 (49%), Gaps = 21/177 (11%)

Query: 441 TIQAELLKLEKEKDQILTESKKTE-KELIKEH----QNDQKLFLSSKETYD-NLSKKVQE 494
           T+Q + ++L +E   ++ E KK E  EL ++H    Q    L+   +   D  LSK+ QE
Sbjct: 398 TLQKKTVELAQE-HAVIIEGKKLELNELKRQHAALLQQSTALYEQERAHIDAELSKQRQE 456

Query: 495 QIV----ARNTQQRKMNVLSQKIVKLSEELNKVKEERTALNESLSSVTEENNKSKALTEK 550
             V    AR  +++ +  +  ++ +  EE  ++ EER  L  SLS+V  E ++ K    +
Sbjct: 457 NAVSLELAREEEEKALEPVIGELCETEEEHARLVEERAKLETSLSTVLSELDEYKKTVLE 516

Query: 551 LEVKLTN-------QKKRFKELVKWNEKLLKMD--GNMRKEIYKTVEDYESKASELE 598
           LE +L +       Q+K  + L+  +EK L+ D   N+   +  + E+  S A EL+
Sbjct: 517 LESQLLSTTASLEEQQKGLRALIS-SEKELEDDINNNLSTLVISSREEASSTARELQ 572

>TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.196
           YIL022W
          Length = 418

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 69/144 (47%), Gaps = 22/144 (15%)

Query: 481 SKETYDNLSKKVQEQIVARNTQQRKMNVLSQKIVKLSEELNKVKEERTALNESLSSVTEE 540
           + ET +N++ K  +  +ARNT++      S+   K+ E    V++  T + + +S V ++
Sbjct: 99  TGETVENIASKAWDSEIARNTRE----AASKTAKKIDEGFEPVRQ--TKIYKDVSEVMDD 152

Query: 541 NNKSK--ALTEKLEVKLTNQK-----KRFKELVKWNE----KLLKMDGNMRKEIYKTVED 589
            N S+      K + +L  ++     KR K  VK NE     L+  D   ++   K VED
Sbjct: 153 GNSSRYGGFITKEQRRLKREQDMLSGKRAK-AVKGNEDAGTALVATDIEAKQSFGKKVED 211

Query: 590 YESKASELERVNLELKRLKDVLYD 613
           ++ K      +   L RLK+ L+D
Sbjct: 212 FKEKTV----LGRTLHRLKNSLWD 231

>Ecym_6476 Chr6 (921068..923620) [2553 bp, 850 aa] {ON} similar to
           Ashbya gossypii ABL193C
          Length = 850

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 66/123 (53%), Gaps = 15/123 (12%)

Query: 282 VICLEEDNEQLTLKVKQLSLENQQLFQNS-----KPDNLKDELAEKLKGK---IMQLEGK 333
           VI L ++ EQ+TL+ K+  +E +     +     K ++L  EL E +KGK   + QL  K
Sbjct: 297 VIKLNKELEQVTLEYKKYKIEAKLRLDETESLLVKSNDLNQELQESVKGKTDELTQLSKK 356

Query: 334 ISTKDKEYHKV---LTQLNSL--KNNSHDDSSQQSIVLKQ--LAEKTREAEILRRRLTEQ 386
           + TK+ E   +   LT+ N++  K  + +DS    +  ++  LAE  +E E+L++ L E 
Sbjct: 357 LVTKENEVSDLNSSLTKSNTIISKLQTENDSLSGEVRSEKEKLAESEKEVEVLKKSLDEL 416

Query: 387 NDR 389
            D+
Sbjct: 417 QDK 419

>Kpol_463.17 s463 complement(45852..46280) [429 bp, 142 aa] {ON}
           complement(45852..46280) [429 nt, 143 aa]
          Length = 142

 Score = 30.0 bits (66), Expect = 10.0,   Method: Composition-based stats.
 Identities = 21/73 (28%), Positives = 36/73 (49%)

Query: 527 RTALNESLSSVTEENNKSKALTEKLEVKLTNQKKRFKELVKWNEKLLKMDGNMRKEIYKT 586
           RT+  E      +E+ K   L E  ++ L N  KRFK L   N+K +     ++ +IY+ 
Sbjct: 44  RTSSAEYGGITLDESCKILNLEEDKDINLENVNKRFKYLFDVNDKEIGGSFYLQSKIYRA 103

Query: 587 VEDYESKASELER 599
            E  + + +E E+
Sbjct: 104 AERLKWEIAEREK 116

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.126    0.338 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,974,730
Number of extensions: 3328529
Number of successful extensions: 29111
Number of sequences better than 10.0: 2074
Number of HSP's gapped: 26833
Number of HSP's successfully gapped: 3541
Length of query: 645
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 529
Effective length of database: 40,180,143
Effective search space: 21255295647
Effective search space used: 21255295647
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 69 (31.2 bits)