Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0K029106.7ON1063106347400.0
NCAS0F001806.7ON1018106226540.0
KLLA0D00792g6.7ON1020107018620.0
KAFR0L003306.7ON102875618300.0
Skud_5.346.7ON101973917840.0
YEL055C (POL5)6.7ON102273917730.0
ZYRO0F00440g6.7ON103973517450.0
TDEL0G046406.7ON101773217220.0
Suva_5.136.7ON102373617190.0
Smik_5.326.7ON102073617000.0
TBLA0A072106.7ON1041108916620.0
Kpol_1045.806.7ON101972916440.0
KNAG0E009706.7ON100474316090.0
CAGL0B03553g6.7ON102173214400.0
SAKL0E00770g6.7ON104775214331e-180
TPHA0J002506.7ON102473613841e-173
ACR020C6.7ON100274413801e-173
Ecym_30096.7ON102775213141e-163
Kwal_56.223346.7ON100874912481e-154
KLTH0C11594g6.7ON100675011801e-144
Kwal_56.226293.104ON29394752.6
SAKL0G12694g5.211ON101266753.5
Ecym_20605.87ON47666753.5
Suva_10.1242.402ON105196728.5
TPHA0A037603.330ON1166116728.5
Kpol_1018.492.501ON419175718.9
TPHA0D005908.69ON208748728.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0K02910
         (1063 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa] ...  1830   0.0  
NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7 ...  1026   0.0  
KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar...   721   0.0  
KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {O...   709   0.0  
Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON} ...   691   0.0  
YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}  P...   687   0.0  
ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar...   676   0.0  
TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {...   667   0.0  
Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON} ...   666   0.0  
Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON} ...   659   0.0  
TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_...   644   0.0  
Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]...   637   0.0  
KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6....   624   0.0  
CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} simil...   559   0.0  
SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar...   556   e-180
TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7...   537   e-173
ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON} ...   536   e-173
Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to...   510   e-163
Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C...   485   e-154
KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] ...   459   e-144
Kwal_56.22629 s56 complement(211300..212181) [882 bp, 293 aa] {O...    33   2.6  
SAKL0G12694g Chr7 (1081452..1084490) [3039 bp, 1012 aa] {ON} som...    33   3.5  
Ecym_2060 Chr2 complement(98095..99525) [1431 bp, 476 aa] {ON} s...    33   3.5  
Suva_10.124 Chr10 complement(226980..230063,230067..230138) [315...    32   8.5  
TPHA0A03760 Chr1 (821355..824855) [3501 bp, 1166 aa] {ON} Anc_3....    32   8.5  
Kpol_1018.49 s1018 (156124..157383) [1260 bp, 419 aa] {ON} (1561...    32   8.9  
TPHA0D00590 Chr4 (103790..110053) [6264 bp, 2087 aa] {ON} Anc_8....    32   8.9  

>NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa] {ON}
            Anc_6.7 YEL055C
          Length = 1063

 Score = 1830 bits (4740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 927/1063 (87%), Positives = 927/1063 (87%)

Query: 1    MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRN 60
            MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRN
Sbjct: 1    MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRN 60

Query: 61   SARLGFSLCLTEAINLALGMGDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKKK 120
            SARLGFSLCLTEAINLALGMGDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKKK
Sbjct: 61   SARLGFSLCLTEAINLALGMGDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKKK 120

Query: 121  KGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWIR 180
            KGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWIR
Sbjct: 121  KGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWIR 180

Query: 181  ESCFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLEK 240
            ESCFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLEK
Sbjct: 181  ESCFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLEK 240

Query: 241  TLSDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPANWAPRL 300
            TLSDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPANWAPRL
Sbjct: 241  TLSDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPANWAPRL 300

Query: 301  HFVWDILLPILXXXXXXXXXNXXXXXXXXXXXXXXXNQDSNEFIRFPEFWQMAIDESFFN 360
            HFVWDILLPIL         N               NQDSNEFIRFPEFWQMAIDESFFN
Sbjct: 301  HFVWDILLPILTTTTTEEDTNSDDKHISKKRKKIKKNQDSNEFIRFPEFWQMAIDESFFN 360

Query: 361  EKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMSQIA 420
            EKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMSQIA
Sbjct: 361  EKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMSQIA 420

Query: 421  IDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVXXXXXXXXXXXXTLRQ 480
            IDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTV            TLRQ
Sbjct: 421  IDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVSKLISIKHLSSSTLRQ 480

Query: 481  LIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLVKLAFFS 540
            LIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLVKLAFFS
Sbjct: 481  LIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLVKLAFFS 540

Query: 541  KDNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELEKSGNQELVNKL 600
            KDNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELEKSGNQELVNKL
Sbjct: 541  KDNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELEKSGNQELVNKL 600

Query: 601  DADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDTESLSTIEELVE 660
            DADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDTESLSTIEELVE
Sbjct: 601  DADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDTESLSTIEELVE 660

Query: 661  FYSNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIGKNELNVLLAVLPV 720
            FYSNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIGKNELNVLLAVLPV
Sbjct: 661  FYSNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIGKNELNVLLAVLPV 720

Query: 721  RENKQGFAHLFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 780
            RENKQGFAHLF                                                 
Sbjct: 721  RENKQGFAHLFEGADEYEEDDDQEEGEGNEDEEENDDINSSNSESDSGSSSDSDSDDNDN 780

Query: 781  VIENGDIANIDKEATSALAKALNLPENIVNEKGEVDLAKLEXXXXXXXXXXXXXXXXXXX 840
            VIENGDIANIDKEATSALAKALNLPENIVNEKGEVDLAKLE                   
Sbjct: 781  VIENGDIANIDKEATSALAKALNLPENIVNEKGEVDLAKLENMSDNDLDNSINDDDDDES 840

Query: 841  XXXXXXXXXXXXXXXQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLM 900
                           QLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLM
Sbjct: 841  DEESMDDEKMMELDDQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLM 900

Query: 901  IYMKYVEGLTLTTENGEKFGNLLLFIEPMIKCVKQTLDKSXXXXXXXXXXXXXXXXXSSN 960
            IYMKYVEGLTLTTENGEKFGNLLLFIEPMIKCVKQTLDKS                 SSN
Sbjct: 901  IYMKYVEGLTLTTENGEKFGNLLLFIEPMIKCVKQTLDKSLADKVVKLVKTKLFKIKSSN 960

Query: 961  FQIESLNADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESNDKE 1020
            FQIESLNADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESNDKE
Sbjct: 961  FQIESLNADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESNDKE 1020

Query: 1021 IAYGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQRQIP 1063
            IAYGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQRQIP
Sbjct: 1021 IAYGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQRQIP 1063

>NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7
            YEL055C
          Length = 1018

 Score = 1026 bits (2654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/1062 (53%), Positives = 716/1062 (67%), Gaps = 46/1062 (4%)

Query: 1    MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRN 60
            M  KVNRDLFYKLASDL+EER Q+A+SL+KEL+ L +PD+ EEWTYV+NRLIKGLASDR+
Sbjct: 1    MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRS 60

Query: 61   SARLGFSLCLTEAINLALGMGDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKKK 120
            SARLGFSLCLTE INLAL M +NAP+G+Q+I++FL LLSKTL +D+N      K ALKKK
Sbjct: 61   SARLGFSLCLTEVINLALSMKENAPEGLQTIDDFLQLLSKTLSLDTN---ANEKGALKKK 117

Query: 121  KGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLF-IRYVDELFTLGSKKNWI 179
            KGRDERG+LFGK+F LQA+ NEP+FS++FL++   K + + F  ++++E+  L  KKNWI
Sbjct: 118  KGRDERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWI 177

Query: 180  RESCFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLE 239
            +ESC FTL+QTI+KLLPYA+ + Y  +L+LLD + L+L+ EGLA+YL I+Y   N  +L+
Sbjct: 178  KESCLFTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLD 237

Query: 240  KTLSDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPANWAPR 299
               S I+  N  WK+N+PL+RGNLP LT +LRDS+VT+  +  +    + KQ  +NW PR
Sbjct: 238  T--SSIEFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYE---NSKKQNASNWNPR 292

Query: 300  LHFVWDILLPILXXXXXXXXXNXXXXXXXXXXXXXXXNQDSNEFIRFPEFWQMAIDESFF 359
            LHFVWDILLPIL         N               N +  + I FPEFWQM +DESFF
Sbjct: 293  LHFVWDILLPILISGKHTTASN----TQHISKKRKKNNNELPKHIEFPEFWQMVVDESFF 348

Query: 360  NEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMSQI 419
            NEKASSERKYLGFLIF KTI+ + +     ++ CF+ NFMRSLINQS+D+KRLLHKMSQ 
Sbjct: 349  NEKASSERKYLGFLIFIKTIKVVSQTQ---LNNCFSHNFMRSLINQSTDSKRLLHKMSQN 405

Query: 420  AIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVXXXXXXXXXXXXTLR 479
            A++TI++VC++D SNKL+ C++A++F     GSINFDKLTKSKT+            TL 
Sbjct: 406  ALNTIIEVCQEDSSNKLVKCVNAMVFGP--SGSINFDKLTKSKTISKLISIHPLDVKTLA 463

Query: 480  QLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLVKLAFF 539
             L  LF S I+  S  K+    N++ LDT+LH+VR+HK+  +YD++V PLL+PL++ AFF
Sbjct: 464  DLFDLFTSNISEKSENKQ---KNRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFF 520

Query: 540  SKDNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELEKSGNQELVNK 599
            +K+NE LNELAKER  SIL+ELT     PK  +  HSW YY L +IL+ E++G  ELVNK
Sbjct: 521  AKENEPLNELAKERFSSILAELTSVI--PKEPH--HSWQYYALDIILKKERTGKFELVNK 576

Query: 600  LDADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDTESLSTIEELV 659
            LD +L  IKN+   V+ +I  +     + Q  GLE LLSMC+LQLFSG+TESLSTIEEL+
Sbjct: 577  LDENLGKIKNDACDVIVKIIKS---PQSPQLNGLESLLSMCLLQLFSGETESLSTIEELI 633

Query: 660  EFYSNSKQE-ESTSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIGKNELNVLLAVL 718
            EFY   K + ESTSLVGITEILLSLLAQKKA+LRKLSL VWE FI+++GK ELN+LL VL
Sbjct: 634  EFYKEHKGDTESTSLVGITEILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDVL 693

Query: 719  PVRENKQGFAHLFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 778
              RENKQGFAHLF                                               
Sbjct: 694  KARENKQGFAHLF------EGADEYEEIEDEQEGESNQSEEKDVSGEESEESEESEIDDE 747

Query: 779  XXVIENGDIANIDKEATSALAKALNLPENIVNEKGEVDLAKLEXXXXXXXXXXXXXXXXX 838
               ++  ++ NIDKEATSALAKALNLPENIVN+KGEVD+AKLE                 
Sbjct: 748  DDSLDTAEVNNIDKEATSALAKALNLPENIVNDKGEVDVAKLE-----ALSDSDMDDDDD 802

Query: 839  XXXXXXXXXXXXXXXXXQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDM 898
                             QLSEIFKRRKEALS  STGNQRKIE KESRENVIAFK RV+D+
Sbjct: 803  DSDEESMDDEKMMLLDDQLSEIFKRRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDL 862

Query: 899  LMIYMKYVEGLTLTTENGEKFGNLLLFIEPMIKCVKQTLDKSXXXXXXXXXXXXXXXXXS 958
            L +Y+KYVE L  T ++ +KF NL+ F+EPM+ CV++TLDKS                 S
Sbjct: 863  LTVYVKYVEKLQ-TADHSQKFVNLISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKS 921

Query: 959  SNFQIESLNADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESND 1018
            S F+    +A+   V+E L++ HE LLT K GQ P LYY+L S+ S+F  KI V   S D
Sbjct: 922  STFKN---SANPVEVLEYLKKLHEKLLTEKPGQHPQLYYTLSSSASLFFSKIYV-ASSTD 977

Query: 1019 KEIAYGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQR 1060
            +  AY KLID Y  TTKSW MSK KFG N F DF+NWL+S++
Sbjct: 978  ETNAYNKLIDQYSNTTKSW-MSKSKFGPNFFADFFNWLASRK 1018

>KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar to
            uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1020

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/1070 (40%), Positives = 614/1070 (57%), Gaps = 67/1070 (6%)

Query: 1    MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNV---PDDIEEWTYVLNRLIKGLAS 57
            +  +VNRDLF+K+AS+LE+ERL++A+ LI E+S+++     D + EW YV+ RL+KGLAS
Sbjct: 6    VVSRVNRDLFFKVASELEKERLEAAIQLINEISRVDTRESEDGVREWEYVIGRLVKGLAS 65

Query: 58   DRNSARLGFSLCLTEAINLALGMGDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTAL 117
            +R  ARLGFS+CLTE I LAL   D  P    SI  FL+ L +TLP           TA 
Sbjct: 66   NRGGARLGFSMCLTEVIALALERRDILP----SIYAFLNQLEQTLPAG---------TAF 112

Query: 118  KKKKGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKN 177
            K   G++ERG+LFG++FALQ+LLNEP+FS +FLS D   I+    + Y+++L  L   K 
Sbjct: 113  KN--GKEERGVLFGQMFALQSLLNEPVFSKLFLSTDDNSINMEFLLTYLNKLIQLALSKT 170

Query: 178  WIRESCFFTLYQTIEKLLP--YADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANK 235
            W+RE C +++YQTI+K     + D     L+L LLD+ +LTL+ EGL+IYL+        
Sbjct: 171  WLREPCLYSVYQTIQKCETRLFNDPTAINLILGLLDEKKLTLTNEGLSIYLMF------N 224

Query: 236  KQLEKTLSDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPAN 295
             Q +   S + + NS WK+N+PL++GN+  L ++L+D           P  K++ +    
Sbjct: 225  AQRDTYSSSLVIHNSGWKNNDPLSKGNVQLLASVLKDV---------VPVEKSDLKQKGT 275

Query: 296  WAPRLHFVWDILLPILXXXXXXXXXNXXXXXXXXXXXXXXXNQDSNEFIRFPEFWQMAID 355
            WAPRLH+VWDILLP+L                         + +    I+FP+FWQ  +D
Sbjct: 276  WAPRLHYVWDILLPLLEDDGSFGQSMESHISKKRKKNTASMSSERTGRIQFPDFWQAVVD 335

Query: 356  ESFFNEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHK 415
            ESFFNEK+S+ERKYLGFLI ++ I+     + KLI    ++N +R +INQS D++R+L+K
Sbjct: 336  ESFFNEKSSNERKYLGFLILEEAIKVC---SPKLIQVLLSQNLLRCIINQSQDSQRMLNK 392

Query: 416  MSQIAIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVXXXXXXXXXXX 475
            +S  A+ +IV  CE  P+ K++P ++   F  N  GSINFDKL KSK V           
Sbjct: 393  ISTQALKSIVAECERSPA-KVVPLVEVFWFGRN--GSINFDKLIKSKLVNSLISTSSLEK 449

Query: 476  XTLRQLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLVK 535
              L  L+ L ISQ+    + K+   + +F  DT LH+ R+HK+  +    V+PLL+ ++K
Sbjct: 450  EHLVDLVNLLISQLPQDQSTKDSFNLTRFIFDTFLHITRAHKTRLE-SHWVKPLLSAIIK 508

Query: 536  LAFFSK-DNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELEKSGNQ 594
             AFF++ DN  L+ELAKERLYSIL EL    S  KSS    +W Y  LQ+IL++E SG+ 
Sbjct: 509  AAFFNESDNSKLSELAKERLYSILGELISEPS--KSSGDISTWPYIALQIILKIEGSGST 566

Query: 595  ELVNKLDADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDTESLST 654
              ++ LD DLE+++ + +K L +    N +    +  GLELLLS+ ILQL++GD ES+S 
Sbjct: 567  LSID-LDEDLESVRKSAIKSLKQNHSDNKNNTNPKLNGLELLLSVAILQLYAGDEESVSI 625

Query: 655  IEELVEFYSNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIGKNELNVL 714
            +++L+ FY    +E ST LVGITEILLSL+AQ+K++L+KLSL VWE F+ DIG+ ELNVL
Sbjct: 626  LQDLISFYEECDKE-STDLVGITEILLSLVAQRKSLLKKLSLIVWESFVHDIGEPELNVL 684

Query: 715  LAVLPVRENKQGFAHLFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 774
            L  L  RENKQGFA LF                                           
Sbjct: 685  LQTLTARENKQGFADLFEGDEEEDDEDAVERGTDDDDDEDDEDNDDDDEPSAEDSEDDVS 744

Query: 775  XXXXXXVIENGDIANIDKEATSALAKALNLPENIVNEKGEVDLAKLEXXXXXXXXXXXXX 834
                   +E      I+KEATSALAKALNLP++IV E G+V L                 
Sbjct: 745  EEDKDAALE-----KIEKEATSALAKALNLPDSIVGEHGDVQLGN---NEEEDSDEDSDE 796

Query: 835  XXXXXXXXXXXXXXXXXXXXXQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHR 894
                                 QLSEIFKRRKEAL ++ TGN+RK+EV+ESRENVI+FKHR
Sbjct: 797  DDDFSGEDESMDDEAMMQLDDQLSEIFKRRKEALGSVPTGNKRKVEVQESRENVISFKHR 856

Query: 895  VIDMLMIYMKYVEGLTLTTENG----EKFGNLLLFIEPMIKCVKQTLDKSXXXXXXXXXX 950
            V+DML IY+K  +             E++ NL   I P++KC++ TLDK+          
Sbjct: 857  VVDMLEIYVKSFDRAVARNNTSIITVEEWNNLSSIILPLLKCLQHTLDKALADKCAKLMK 916

Query: 951  XXXXXXXSSNFQIESLNADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKI 1010
                   ++  + E     +  +  LL++ H+ ++T+K GQF  L++S CS  S+FL K+
Sbjct: 917  LRLCKVKATIAKEEKTVTSE--IFHLLEKVHKLIMTAKPGQFQQLFFSTCSLASLFLSKL 974

Query: 1011 LVHVESNDKEIAYGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQR 1060
             +         ++  LIDLY +T+K+W M  GK  +N F DF NWL ++R
Sbjct: 975  YLSSGG-----SHENLIDLYADTSKAW-MKDGKCTVNFFIDFSNWLQTKR 1018

>KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {ON}
           Anc_6.7 YEL055C
          Length = 1028

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/756 (52%), Positives = 514/756 (67%), Gaps = 59/756 (7%)

Query: 1   MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRN 60
           M+GKVNRDLFYKLAS+L EERLQ+AVS+I+ELS L +PD  EEW YVL RLIKGL+SDR 
Sbjct: 4   MSGKVNRDLFYKLASELGEERLQAAVSIIQELSALKLPDHTEEWNYVLGRLIKGLSSDRT 63

Query: 61  SARLGFSLCLTEAINLALGMGDNAPQGVQ-----SINEFLDLLSKTLPIDSNTVATENKT 115
            ARLGFSLCLTE INLA+   D A +GV+     +I+++L +LS+TL ID+      NK 
Sbjct: 64  GARLGFSLCLTEVINLAI---DLAGKGVELDSLSNIDQYLTILSETLSIDAG-----NKQ 115

Query: 116 ALKKKKGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSK 175
             KK KG+DERG+LFGK+F L+ALLNEPLFS  FL    KK+ S+   R++ EL  L S+
Sbjct: 116 NNKKMKGKDERGLLFGKMFGLKALLNEPLFSKTFLP--NKKVASNFCERFMVELLDLASR 173

Query: 176 KNWIRESCFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANK 235
           KNWIRE C FTL+QT+EKLLP+AD EF ++VL LLD ++ TL+ EGLAIYLL++++   K
Sbjct: 174 KNWIREPCLFTLFQTVEKLLPFADFEFIKIVLGLLDDHKFTLTNEGLAIYLLLLHKGPEK 233

Query: 236 -KQLEKTLSDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPA 294
            K+    +  + L NS WK N+PLARGNLP LT +LR+S++   +       K  +   A
Sbjct: 234 GKEFNDKIKLLVLKNSSWKLNDPLARGNLPRLTQVLRESSLASEE-------KKVEVMSA 286

Query: 295 NWAPRLHFVWDILLPILXXXXXXXXXNXXXXXXXXXXXXXXXNQDSNEFIRFPEFWQMAI 354
           NW PRLHFVWDILLP +         +                 ++N +IRFPEFWQM +
Sbjct: 287 NWQPRLHFVWDILLPTV-----STIESNSDEKHMSKRRKKNKGPETNTYIRFPEFWQMTV 341

Query: 355 DESFFNEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLH 414
           DESFFNEKASSERKYLGF IF++ I  +   N     TCF++NFMRSLINQSSD  RLLH
Sbjct: 342 DESFFNEKASSERKYLGFSIFERAISIV--QNPLHSETCFSQNFMRSLINQSSDASRLLH 399

Query: 415 KMSQIAIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVXXXXXXXXXX 474
           K+S   ++TIVK CE+ PS KLIP + ++LF TN  GS NFDKLTKSKTV          
Sbjct: 400 KISTRVMNTIVKACEESPSTKLIPVIHSILFATN--GSTNFDKLTKSKTVSKLISITGLT 457

Query: 475 XXTLRQLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDS---------V 525
             TL QL  +  SQI   ++E       QF LD++LH+VRSHK +  +DS         +
Sbjct: 458 LHTLLQLFDMLTSQIKVGTSED--FKKTQFILDSLLHIVRSHKQDI-FDSCTGSTETELI 514

Query: 526 VEPLLNPLVKLAFFS------KDNEA---LNELAKERLYSILSELTGATSSPKSSNAAHS 576
           ++  + PLV+LAFF+      K++E+   ++ELAKERL+S+LSELT  T     +   HS
Sbjct: 515 IKHAIAPLVRLAFFAQTDIAKKEDESDNQVDELAKERLFSVLSELTTTT-----NKQLHS 569

Query: 577 WHYYTLQLILELEKSGNQELVNKLDADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELL 636
           W YYTL  I++ E      L+NK+D DL+T+++N +KV+  I+  N    +   +GLE L
Sbjct: 570 WQYYTLLEIIDRENENPNSLINKMDDDLKTVRDNAIKVIKGIASKNEKTTSSGERGLESL 629

Query: 637 LSMCILQLFSGDTESLSTIEELVEFYSNSKQ-EESTSLVGITEILLSLLAQKKAILRKLS 695
           LSMC+LQL+SGD +S++TIEEL+ FY+ S+  EE  ++VGITEILLSLLAQKKA+L+KLS
Sbjct: 630 LSMCLLQLYSGDADSVATIEELITFYNASRDVEEKRTMVGITEILLSLLAQKKAVLKKLS 689

Query: 696 LSVWEHFISDIGKNELNVLLAVLPVRENKQGFAHLF 731
           L VWE F+S+I ++ LN+LL VLP RENKQGFA LF
Sbjct: 690 LLVWEQFVSEIDEDVLNLLLDVLPARENKQGFAELF 725

 Score =  246 bits (629), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 139/277 (50%), Positives = 173/277 (62%), Gaps = 23/277 (8%)

Query: 784  NGDIANIDKEATSALAKALNLPENIVNEKGEVDLAKLEXXXXXXXXXXXXXXXXXXXXXX 843
            N  IA IDKEATSALAKALNLP++I+NE GEV+   L                       
Sbjct: 772  NEAIAKIDKEATSALAKALNLPDDIINENGEVNFDDL------------SDGSDISSDEE 819

Query: 844  XXXXXXXXXXXXQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYM 903
                        QL+EIFKRRKEALS++STGNQRKIEVKESRE+VIAFKHRV D+L IY+
Sbjct: 820  SLDDEKMMELDDQLAEIFKRRKEALSSVSTGNQRKIEVKESRESVIAFKHRVFDLLSIYI 879

Query: 904  KYVEGLTLTTENGEKFGNLLLFIEPMIKCVKQTLDKSXXXXXXXXXXXXXXXXXSSNFQI 963
            K+ E   L  +        +LFIEPM+KCV+QTLDKS                 + N  +
Sbjct: 880  KHAEDSELPAKYA------ILFIEPMMKCVQQTLDKSLADKISKLLKTKVYKLKTKN--M 931

Query: 964  ESLNADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESNDKEIAY 1023
            E + A  ++V + +   HE+LLTSK GQ+   +YSLCS+ SIFL K+L+ V SNDKE AY
Sbjct: 932  EEITA--EQVFDHMTSVHETLLTSKPGQYQPTFYSLCSSTSIFLSKLLLLV-SNDKEEAY 988

Query: 1024 GKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQR 1060
            GK++D+Y ETTK WV+   KFG N F DFYNWLSS++
Sbjct: 989  GKIVDIYSETTKKWVLKDSKFGSNIFIDFYNWLSSKK 1025

>Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON}
           YEL055C (REAL)
          Length = 1019

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/739 (51%), Positives = 494/739 (66%), Gaps = 45/739 (6%)

Query: 1   MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRN 60
           M GKVNRDLF+KLASDL+EERL +AV+LIK+LS L +P D EEW+YVLNRLIKGLASDRN
Sbjct: 1   MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRN 60

Query: 61  SARLGFSLCLTEAINLALGM-GDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKK 119
           SARLGFSLCLTE +NL + M     P+G++S NEFLD LS  L I        N  + K 
Sbjct: 61  SARLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDI------YVNDGSKKP 114

Query: 120 KKGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWI 179
            KG+DERGILFGKLF L++LLNEPLFS IF+ +D KK ++   IR++++L  L  +KNWI
Sbjct: 115 VKGKDERGILFGKLFGLKSLLNEPLFSEIFV-DDIKKGNTEFVIRFMEQLIDLALRKNWI 173

Query: 180 RESCFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLE 239
           RE C F+L+QTI+ LLP+ +      +L + DKY+LTL+ EGL+ YL++ Y S      +
Sbjct: 174 REPCLFSLFQTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVLKYES------D 227

Query: 240 KTL--SDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPANWA 297
           ++L  S + L NS WK+N+PLARGNLP LT +LRDS+V    D         KQ  ANW 
Sbjct: 228 ESLIPSTLDLRNSGWKNNDPLARGNLPLLTKVLRDSSV--LPDTNGKLQDAKKQKNANWN 285

Query: 298 PRLHFVWDILLPILXXXXXXXXXNXXXXXXXXXXXXXXXNQDSNEFIRFPEFWQMAIDES 357
           PRLHFVWD+LLP+          N                Q+S   I+FPEFW+MA+DES
Sbjct: 286 PRLHFVWDVLLPLF---GSGKLENTEHITKKRKKTSGKKVQNS---IQFPEFWKMAVDES 339

Query: 358 FFNEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMS 417
           FFNEKASSERKYLGFLI   T +++       I +CF++N MR+LINQS D++R+L+K++
Sbjct: 340 FFNEKASSERKYLGFLIIDATFKTVP---GSCIGSCFSQNVMRTLINQSIDSQRILNKIA 396

Query: 418 QIAIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVXXXXXXXXXXXXT 477
           QI +++IVK CE+DP  KL+PCL+A+LF  +  GSINFDKLTKS  +             
Sbjct: 397 QITLESIVKACEEDPIKKLVPCLNAMLFGPH--GSINFDKLTKSNIISKLIAIKELPSAV 454

Query: 478 LRQLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLVKLA 537
           L QLI  F+ Q+     +   T    F LD++LH++R+HK E +   +++P+L P++ +A
Sbjct: 455 LAQLISAFLLQLQEKRGDLPHT---HFILDSLLHIIRAHKVEINDVGIIKPVLTPIIHMA 511

Query: 538 FFS-----KDNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELEKSG 592
           FF      ++ E L+ELAKERLYSIL ELT            +SW Y TL LIL++EKS 
Sbjct: 512 FFKHATDEQEFEQLHELAKERLYSILGELTINKEVNSEDPQINSWQYLTLNLILDIEKSY 571

Query: 593 NQELVNKLDADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDTESL 652
             +L+N LD  LE IKN  +  L EIS +N    T QS GL  LLSMC++QL++G+T+S+
Sbjct: 572 KADLINPLDESLEKIKNEAISSLAEISKSN----TTQSWGLSTLLSMCLIQLYAGETDSI 627

Query: 653 STIEELVEFYSNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIGKNELN 712
           S IEEL EF     + ++ S+VGITEILLS LAQKKA+LRKLSL +W+ FI D+G  EL 
Sbjct: 628 SVIEELCEF----TKHDNNSMVGITEILLSFLAQKKALLRKLSLIIWQQFIEDVGLEELQ 683

Query: 713 VLLAVLPVRENKQGFAHLF 731
           +LL VL  RENKQGFA LF
Sbjct: 684 ILLDVLKARENKQGFAQLF 702

 Score =  233 bits (593), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 134/284 (47%), Positives = 169/284 (59%), Gaps = 23/284 (8%)

Query: 784  NGDIANIDKEATSALAKALNLPENIVNEKGEVDLAKLEXXXXXXXXXXXXXXXXXXXXXX 843
            N D+ NIDKEAT AL KAL+LP+NIVN+KGEVD+ +L                       
Sbjct: 747  NEDVVNIDKEATGALIKALHLPDNIVNDKGEVDMNQL----------GGLSDDDDDEDEE 796

Query: 844  XXXXXXXXXXXXQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYM 903
                        QLSEIFKRRKEALSNISTGNQRK+EVKESRENVI+FKHR++DML +Y+
Sbjct: 797  SMDDEKMMELDDQLSEIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYV 856

Query: 904  KYVEGLTLT--TENGEK----FGNLLLFIEPMIKCVKQTLDKSXXXXXXXXXXXXXXXXX 957
            KY E L +    EN          L+ FI PM+KC+++TLDK                  
Sbjct: 857  KYCEKLAIANKVENSSNLEGPLSKLVYFIVPMLKCIRETLDKPLADKISKLLKGKIFKIK 916

Query: 958  SSNFQIESLNADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESN 1017
            ++ F+I   N +   +M LL+ THE +LTSK GQ  S+++S CST S+FL K+   +  N
Sbjct: 917  ANTFKILDKNIE---LMNLLKSTHELMLTSKPGQHASVFFSACSTSSLFLSKLYFEIGGN 973

Query: 1018 DKEIAYGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQRQ 1061
            +   A  +LIDLY  TTK W M KGKF  N F DF NWLSS++Q
Sbjct: 974  N---ALDELIDLYAATTKEW-MLKGKFSTNVFIDFTNWLSSKKQ 1013

>YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}
           POL5DNA Polymerase phi; has sequence similarity to the
           human MybBP1A and weak sequence similarity to B-type DNA
           polymerases, not required for chromosomal DNA
           replication; required for the synthesis of rRNA
          Length = 1022

 Score =  687 bits (1773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/739 (51%), Positives = 496/739 (67%), Gaps = 45/739 (6%)

Query: 1   MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRN 60
           M GKVNRDLF+KLASDL EERL +AV+LIK+LS L++PDD EEW+YVLNRLIKGL+SDRN
Sbjct: 1   MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRN 60

Query: 61  SARLGFSLCLTEAINLALGMGDNA-PQGVQSINEFLDLLSKTLPIDSNTVATENKTALKK 119
           SARLGFSLCLTE INLA+ M     P+G++S NEFL  LS  L ++       N+   K 
Sbjct: 61  SARLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNV------NEGTKKS 114

Query: 120 KKGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWI 179
            KG+DERGILFGKLF L++LLNEPLFS IF+ +D +K ++  FIR+ ++L  L  KKNWI
Sbjct: 115 MKGKDERGILFGKLFGLKSLLNEPLFSEIFV-KDLEKGNTEFFIRFTEQLIDLALKKNWI 173

Query: 180 RESCFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLE 239
           +E CFFTL+QT++ LLP+ D    + +L + DKY+LTL+ EGL+ YLL+ Y        +
Sbjct: 174 KEPCFFTLFQTMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEG------D 227

Query: 240 KTL--SDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPANWA 297
           ++L  S + L N  WK N+PLARGNLP LT +LR+S+V    D      +  KQ   NW 
Sbjct: 228 ESLIPSVLDLKNPGWKDNDPLARGNLPLLTKVLRNSSV--IPDANGGLKETKKQKNTNWN 285

Query: 298 PRLHFVWDILLPILXXXXXXXXXNXXXXXXXXXXXXXXXNQDSNEFIRFPEFWQMAIDES 357
           PRLHFVW +LLP+          N                Q+S   I+FPEFW+MA+DES
Sbjct: 286 PRLHFVWSVLLPLF---GNGKLENTSHISKKRKKTNNKKVQNS---IQFPEFWKMAVDES 339

Query: 358 FFNEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMS 417
           FFNEKASSERKYLGFLI     +++       I  CF++N MR+LINQS D++R+L+K+S
Sbjct: 340 FFNEKASSERKYLGFLIIDAAFKAVP---GSYIGFCFSQNVMRTLINQSIDSQRVLNKIS 396

Query: 418 QIAIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVXXXXXXXXXXXXT 477
           Q+ +D+IVK CE+D +N+L+PCL+A+LF  +  GSINFDKLTKS TV             
Sbjct: 397 QLTLDSIVKACEEDSANRLVPCLNAMLFGPH--GSINFDKLTKSGTVSKLIAIKELPSTV 454

Query: 478 LRQLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLVKLA 537
           L QL+ +F  Q   +  +K +     FALD+ILH+VR+HK E +   +++P+L P+V +A
Sbjct: 455 LAQLLDVFFLQ---LQDKKGVLSHTLFALDSILHIVRAHKVEINDMDIMKPVLRPIVYMA 511

Query: 538 FFSKDN-----EALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELEKSG 592
           FF   +     E L+ELAKERLYSIL ELT            +SW Y TL+LIL++E S 
Sbjct: 512 FFKHTSDDLKLEQLHELAKERLYSILGELTINKEIRCKDPEINSWQYLTLKLILDIENSH 571

Query: 593 NQELVNKLDADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDTESL 652
             +L+N LD +LE IKN  +  L+++  +     T QS GL  LLSMC++QL++GDT+S+
Sbjct: 572 VGDLINPLDENLENIKNEAISCLSKVCRSR----TAQSWGLSTLLSMCLVQLYAGDTDSI 627

Query: 653 STIEELVEFYSNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIGKNELN 712
           S IEEL EF     + E+ S+VGITEILLSLLAQKKA+LRKLSL +W+ FI ++G  EL 
Sbjct: 628 SVIEELCEF----SKHENNSMVGITEILLSLLAQKKALLRKLSLIIWQQFIEEVGLEELQ 683

Query: 713 VLLAVLPVRENKQGFAHLF 731
           +LL +L  RENKQGFA LF
Sbjct: 684 ILLDILKARENKQGFAQLF 702

 Score =  238 bits (607), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 138/281 (49%), Positives = 173/281 (61%), Gaps = 22/281 (7%)

Query: 787  IANIDKEATSALAKALNLPENIVNEKGEVDLAKLEXXXXXXXXXXXXXXXXXXXXXXXXX 846
            I NIDKEATSAL KALNLP+NIVN+KGEVDL +LE                         
Sbjct: 752  ILNIDKEATSALVKALNLPDNIVNDKGEVDLDQLEGLSDDGGDDEDEESMDDEKMMELDD 811

Query: 847  XXXXXXXXXQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYMKYV 906
                     QLSEIFKRRKEALS+ISTGNQRK EVK+SRENVI+FKHRV+DML +Y+KY 
Sbjct: 812  ---------QLSEIFKRRKEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYC 862

Query: 907  EGLTLTTEN------GEKFGNLLLFIEPMIKCVKQTLDKSXXXXXXXXXXXXXXXXXSSN 960
            E LTL  ++      G     L+ FI PM+KCV +TLD+                   + 
Sbjct: 863  EKLTLANKSEHSNNLGGSLSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKVTA 922

Query: 961  FQIESLNADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESNDKE 1020
            F+   +N D + +M+LL++TH+ +LTSK GQ  +++YS+CST S+FL K+ V +  NDK 
Sbjct: 923  FK--DMNKDIE-LMDLLKKTHKLMLTSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGNDK- 978

Query: 1021 IAYGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQRQ 1061
                +LIDLY  TTK W M KGK G N F DF NWLSS++Q
Sbjct: 979  --LDELIDLYTATTKEW-MQKGKCGPNIFIDFINWLSSKKQ 1016

>ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar to
           gnl|GLV|CAGL0B03553g Candida glabrata CAGL0B03553g and
           weakly similar to YEL055C uniprot|P39985 Saccharomyces
           cerevisiae
          Length = 1039

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/735 (50%), Positives = 493/735 (67%), Gaps = 48/735 (6%)

Query: 1   MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRN 60
           M GKVNRD FY+LASDL++ER+++AVSLI+ELS L +P   EEW+YVL RLI GLAS RN
Sbjct: 1   MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRN 60

Query: 61  SARLGFSLCLTEAINLALGMGDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKKK 120
           SARLGFSLCL+E + +AL  G  APQ + S +++L+LLS  L  D+     ++K  L   
Sbjct: 61  SARLGFSLCLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNLSPDA---VGKSKKDL--- 114

Query: 121 KGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWIR 180
           KG+DERGILFGK+F LQA+LNEPLF++IF  ++ K   S   +R+  EL  L  KKNW+R
Sbjct: 115 KGKDERGILFGKMFGLQAILNEPLFTSIFFDQEGKV--SPFALRFAQELAELAVKKNWLR 172

Query: 181 ESCFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLE- 239
           ESC +TL+QT+++L+P  + E    +L LLDKY+LT++ EGLAIYLL+ +  A K     
Sbjct: 173 ESCLYTLFQTVQRLVPAMESEIVSSILLLLDKYQLTMTNEGLAIYLLLFHGKARKNGKSF 232

Query: 240 KTLSDIQLSNSHWKSNNPLARGNLPALTNILRD--SNVTEFQDHEKPPTKNNKQPPANWA 297
           K  S + L  + WK+N+PL++GNLP L+ +LRD  +N +E  D   P +       ANW 
Sbjct: 233 KVPSSLALEFAAWKNNDPLSKGNLPQLSRVLRDAPANDSEVADGSHPKS-------ANWN 285

Query: 298 PRLHFVWDILLPILXXXXXXXXXNXXXXXXXXXXXXXXXNQDSNEFIRFPEFWQMAIDES 357
           PRLHFVWDIL+PIL                          +D+ E I FPEF+Q A+DE+
Sbjct: 286 PRLHFVWDILIPIL-------APGKSDEEIPSKKSHKKKKKDTVEGIEFPEFFQAAVDET 338

Query: 358 FFNEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMS 417
           FF+EKASSERKYLGFL+F + ++ +   +++ I +CFT+NFMR+LINQSSD+KRLL+K+S
Sbjct: 339 FFSEKASSERKYLGFLVFIRAVEVV---SSQWIQSCFTQNFMRTLINQSSDSKRLLNKIS 395

Query: 418 QIAIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVXXXXXXXXXXXXT 477
           Q A+D IVK CE D S K+  CL+A+LF  +  G+I+FDKLTKSKT              
Sbjct: 396 QKALDAIVKACEKDASEKIALCLEAMLFGPH--GTISFDKLTKSKTASKLVAIKDISSSG 453

Query: 478 LRQLIKLFISQINAMSTEKEITIVN-QFALDTILHVVRSHKSEFDYDSVVEPLLNPLVKL 536
           L +L  +  +Q   +S E+E    + QF LDT+LH VR+H+ E   + +  PLL+ +V L
Sbjct: 454 LDRLFNMLSAQ---LSREEEPNKQHYQFVLDTVLHAVRTHRLEISQELIAHPLLDSIVTL 510

Query: 537 AFFSKDNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELEKSGNQEL 596
           AFFSK  E +++LA+ERL+SILSELT             SW +YTL+LIL  E  GN E 
Sbjct: 511 AFFSKKGEDISDLARERLFSILSELT-------IQKDGQSWQHYTLKLILSKEAEGN-EP 562

Query: 597 VNKLDADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDTESLSTIE 656
           +NKLD DL+ I+   L +L  IS       + QS+GLE LLS C+LQL+SGD+ESLS +E
Sbjct: 563 INKLDEDLKAIETEALDILQNISSD-----SPQSRGLEWLLSNCLLQLYSGDSESLSIVE 617

Query: 657 ELVEFYSNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIGKNELNVLLA 716
           EL  FY      ES SLVGITEILLSLLAQKKA+LRKLSL VWE F+S++G+ EL +LL 
Sbjct: 618 ELCIFYREGLN-ESNSLVGITEILLSLLAQKKALLRKLSLVVWEQFVSEVGEQELKILLE 676

Query: 717 VLPVRENKQGFAHLF 731
           VL  RENK+GFA LF
Sbjct: 677 VLDARENKEGFAKLF 691

 Score =  258 bits (658), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 137/288 (47%), Positives = 179/288 (62%), Gaps = 14/288 (4%)

Query: 786  DIANIDKEATSALAKALNLPENIVNEKGEVDLAKLEXXXXX-----XXXXXXXXXXXXXX 840
            ++A ID+EATSALAKALNLPENIVN+KGEVD+ +LE                        
Sbjct: 754  NVAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANSDEMDDDDDDEEDEEEDE 813

Query: 841  XXXXXXXXXXXXXXXQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLM 900
                           QLS+IFKRRKEALS ++TGN+RK+EVKE+RENVI FKHR++DML 
Sbjct: 814  EEESMDDEQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLE 873

Query: 901  IYMKYVEGLTLTTENGEK-----FGNLLLFIEPMIKCVKQTLDKSXXXXXXXXXXXXXXX 955
             Y+K+ + + L   N E      F NL LF+EPMI+C++ TLDK                
Sbjct: 874  AYIKHADRIALQDNNDEANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYK 933

Query: 956  XXSSNFQIESLNADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVE 1015
               S F+      D  R++E L+ TH++LLTSK GQFP+LY+S CST S+FLGK+LV   
Sbjct: 934  IKISAFKGA---IDSKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVENN 990

Query: 1016 SNDKEIAYGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQRQIP 1063
            S D  I+YG++IDLY +TTK W++  GKFG N F DF+NWL S+++ P
Sbjct: 991  SEDPAISYGQMIDLYADTTKEWLLI-GKFGANVFADFHNWLLSRKKTP 1037

>TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {ON}
           Anc_6.7 YEL055C
          Length = 1017

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/732 (50%), Positives = 490/732 (66%), Gaps = 43/732 (5%)

Query: 1   MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRN 60
           M G+VNRD FYKLASDL+EER+Q+AV+LI+ELS L++PD   EW+YVL RLI GL+S RN
Sbjct: 1   MTGRVNRDWFYKLASDLQEERVQAAVALIQELSALDLPDGASEWSYVLKRLINGLSSSRN 60

Query: 61  SARLGFSLCLTEAINLALGMGDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKKK 120
           SARLGFSLCLTE INLAL +  + P+ + SI+ FLDLLS T      ++    + + K+ 
Sbjct: 61  SARLGFSLCLTEVINLALNLEGDRPEELSSIDTFLDLLSST-----LSLQPSGQDSKKQI 115

Query: 121 KGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWIR 180
           KG+DERG+LFGK+F LQALL+EPLF  +F+S++K   D +L  R++DEL  L   K+W+R
Sbjct: 116 KGKDERGLLFGKMFGLQALLSEPLFEKVFISKEKGISDFAL--RFMDELCQLAVFKSWLR 173

Query: 181 ESCFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLEK 240
           E C FTL+Q  E++LP ADIE  Q+VL LLD+Y+LTL+ EGLAIYLL++Y+S   +    
Sbjct: 174 EPCLFTLFQAYERILPLADIETAQVVLRLLDQYQLTLTNEGLAIYLLLLYKSP--RDYSS 231

Query: 241 TLSDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPA-NWAPR 299
           ++  +   +  WKSN+PLARGNLP L+ +LRDS+V          T++   P A NW PR
Sbjct: 232 SILQMDFESKSWKSNDPLARGNLPLLSQVLRDSSVA---------TEDESSPKASNWTPR 282

Query: 300 LHFVWDILLPILXXXXXXXXXNXXXXXXXXXXXXXXXNQDSNEFIRFPEFWQMAIDESFF 359
           LHFVWDILLPI+         N                ++    I+FPEFWQMA+DES F
Sbjct: 283 LHFVWDILLPII------TQDNSRRESEDRKPKTKKRKKEKATAIQFPEFWQMAVDESMF 336

Query: 360 NEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMSQI 419
           NEKAS+ERK+LG +IFQK ++       KL+  CF++N MR+LIN +SD+KRLL K+S  
Sbjct: 337 NEKASTERKFLGLVIFQKALEVTPH---KLVGCCFSQNVMRTLINHASDSKRLLFKISLK 393

Query: 420 AIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVXXXXXXXXXXXXTLR 479
            +++IV +C+  P  KL+PCL A+LF  +  GSINFDKLTKSKT              L 
Sbjct: 394 VLNSIVDICKKRPKEKLVPCLSAILFGPH--GSINFDKLTKSKTATNLLAVNGLDETALN 451

Query: 480 QLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLVKLAFF 539
           +L  L  S +   S  ++     QF LDT+LH VRSHKSE + D +V  +L P++ LAFF
Sbjct: 452 ELFGLLSSNLIESSLVEQKN--QQFILDTMLHAVRSHKSELNKDIIVTSILRPIISLAFF 509

Query: 540 SKDNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELEKSGNQELVNK 599
           +  +E  + LAKER YSILSE+T        +N   S+    L +I + E +  +EL  K
Sbjct: 510 TVKDEHTSNLAKERFYSILSEITHL------NNEGPSYQNMALDIIRD-EIAAGKELTTK 562

Query: 600 LDADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDTESLSTIEELV 659
           LD  LE +K+  L+ L  IS    +E   Q +GLE+L+SMC+LQL+SG++E++S IEEL 
Sbjct: 563 LDDTLEDVKSEALRTLQAIS---NNEKNPQLRGLEMLISMCLLQLYSGESEAVSVIEELC 619

Query: 660 EFYSNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIGKNELNVLLAVLP 719
            FY ++  E STSLVGITEILLSLLAQKKA+LRKLSLS W+ F+S+IG+ EL  LL VLP
Sbjct: 620 AFYQDT-DENSTSLVGITEILLSLLAQKKAVLRKLSLSAWQQFVSEIGEAELKALLDVLP 678

Query: 720 VRENKQGFAHLF 731
            RENK+GF+ LF
Sbjct: 679 ARENKKGFSQLF 690

 Score =  242 bits (617), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 138/279 (49%), Positives = 169/279 (60%), Gaps = 9/279 (3%)

Query: 786  DIANIDKEATSALAKALNLPENIVNEKGEVDL----AKLEXXXXXXXXXXXXXXXXXXXX 841
            D+A IDKEATSALAKALNLP+NIVN+KGEVDL       +                    
Sbjct: 744  DVAKIDKEATSALAKALNLPDNIVNDKGEVDLNNWDDGADDVADDGADDEVDGEEDEDED 803

Query: 842  XXXXXXXXXXXXXXQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMI 901
                          QLS+IFKRRK+ALSNISTGNQRK E KESRE+VIAFK RVIDML I
Sbjct: 804  EDSMDDEKMMELDDQLSQIFKRRKDALSNISTGNQRKNEAKESREDVIAFKQRVIDMLEI 863

Query: 902  YMKYVEGLTLTTENGEKFGNLLLFIEPMIKCVKQTLDKSXXXXXXXXXXXXXXXXXSSNF 961
            Y+K+VE  +L  EN  K  + LL +EPMIKC++QT DKS                 +S F
Sbjct: 864  YVKFVEKQSLKEENYSKISSCLLLLEPMIKCIQQTTDKSLANRIAKLLRTKVFKLKTSAF 923

Query: 962  QIESLNADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESNDKEI 1021
                 + D D +ME+L+ THE + T K GQ  ++YYS+CST S+FL KI++   S+ K+ 
Sbjct: 924  ---CGSCDQDELMEMLRMTHEKIQTLKPGQHQAIYYSVCSTASLFLTKIIIE-NSDSKDA 979

Query: 1022 AYGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQR 1060
            A   +IDLY ET K W  S GKFG N F DF NWLSS++
Sbjct: 980  AVHDIIDLYAETMKQWA-SNGKFGPNIFIDFSNWLSSRK 1017

>Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON}
           YEL055C (REAL)
          Length = 1023

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/736 (51%), Positives = 494/736 (67%), Gaps = 40/736 (5%)

Query: 1   MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRN 60
           M GKVNRDLF+KLASDL+EERL +AV+LIK+LS L +P D EEW+YVLNRLIKGLASDRN
Sbjct: 1   MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRN 60

Query: 61  SARLGFSLCLTEAINLALGM-GDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKK 119
           SARLGFSLCLTE INLA+ M     P+G++S+N+FLD LS  L I+       N+T  K 
Sbjct: 61  SARLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLSFILDINV------NETGKKP 114

Query: 120 KKGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWI 179
            KG+DERGILFGKLF L++LLNEPLFS IF+ ED K+ ++   IR++++L  L  +KNWI
Sbjct: 115 VKGKDERGILFGKLFGLKSLLNEPLFSGIFV-EDLKRGNTEFIIRFMEQLIDLALRKNWI 173

Query: 180 RESCFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLE 239
           +E C ++L+QTI+ LLP  +      +L   DKY+LTL+ EGL+ YLL+ Y S +K  + 
Sbjct: 174 KEPCLYSLFQTIKMLLPTMNESTAAEILLTYDKYDLTLTNEGLSTYLLLKYES-DKDLVP 232

Query: 240 KTLSDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPANWAPR 299
            TL    L N  WK+N+PLARGNLP LT +LRDS V     + K      KQ   NW PR
Sbjct: 233 STLG---LKNLGWKNNDPLARGNLPLLTKVLRDSAVAP-DTNGKAQDNTKKQKNTNWNPR 288

Query: 300 LHFVWDILLPILXXXXXXXXXNXXXXXXXXXXXXXXXNQDSNEFIRFPEFWQMAIDESFF 359
           LHFVW+ILLP+          +               +      I+FPEFWQMA+DESFF
Sbjct: 289 LHFVWNILLPLFGSGKLENAEHISKKRKKTSNKKVPSS------IQFPEFWQMAVDESFF 342

Query: 360 NEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMSQI 419
           NEKASSERKYLGFLI   T +++       I  CF+RN MR+LINQS D++R+L+K++QI
Sbjct: 343 NEKASSERKYLGFLIIDATFKTVP---GSCIGYCFSRNVMRTLINQSIDSQRILNKIAQI 399

Query: 420 AIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVXXXXXXXXXXXXTLR 479
            +D+I+K CE+DP NKL+PCL A+LF  +  GSINFDKLTK+                L 
Sbjct: 400 TLDSIIKACEEDPVNKLVPCLSAMLFGPH--GSINFDKLTKTSITSKLIAIKELPATVLN 457

Query: 480 QLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLVKLAFF 539
           QL  LF+ Q   +  +K+      F LD++LH++R+HK+E +   +++P+L+P+V +AFF
Sbjct: 458 QLFNLFVLQ---LQEKKDDLPHTHFVLDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFF 514

Query: 540 -----SKDNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELEKSGNQ 594
                 K++E L+ELAKERLYSIL ELT            +SW + TL+LIL++EKS   
Sbjct: 515 KHATDDKESEQLHELAKERLYSILGELTINKEMRSEDPQINSWQFLTLRLILDMEKSHKG 574

Query: 595 ELVNKLDADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDTESLST 654
           +L N LD  LE  KN  +  L EIS +N    T QS GL  LLSMC++QL++G+T+S+S 
Sbjct: 575 DLTNPLDEGLEKTKNEAISSLTEISKSN----TSQSWGLSTLLSMCLIQLYAGETDSISV 630

Query: 655 IEELVEFYSNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIGKNELNVL 714
           IEEL EF     ++E++S+VGITEILLSLLAQKKA+L+KLSL +W+ FI D+G  EL +L
Sbjct: 631 IEELCEF----AKDENSSMVGITEILLSLLAQKKALLKKLSLIIWQQFIGDVGLKELQIL 686

Query: 715 LAVLPVRENKQGFAHL 730
           L VL  RENKQGFA L
Sbjct: 687 LDVLKTRENKQGFALL 702

 Score =  236 bits (601), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 137/284 (48%), Positives = 171/284 (60%), Gaps = 25/284 (8%)

Query: 787  IANIDKEATSALAKALNLPENIVNEKGEVDLAKLEXXXXXXXXXXXXXXXXXXXXXXXXX 846
            + NIDKEATSAL KALNLP+NIVN+KGEVD+ +LE                         
Sbjct: 751  VVNIDKEATSALIKALNLPDNIVNDKGEVDMDQLEGISDDGDGGDDDEDEESMDDEKMME 810

Query: 847  XXXXXXXXXQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYMKYV 906
                     QLSEIFKRRKEALS+ISTGNQRK+EVKESRENVIAFKHR++DML IY+K+ 
Sbjct: 811  LDD------QLSEIFKRRKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHC 864

Query: 907  EGLT------LTTENGEKFGNLLLFIEPMIKCVKQTLDKSXXXXXXXXXXXXXXXXXSSN 960
            E L       L+ E G    NL+ FI PMIKC+K+TLD+                  +S 
Sbjct: 865  EKLAIANKGELSIEIGGPLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIRTSA 924

Query: 961  FQIESLNADDDRVME---LLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESN 1017
            F+      D D+ +E   LL+  H+ +LTSK GQ  ++++S CST S+FL K+ V +  N
Sbjct: 925  FK------DLDKTIELLDLLKSAHKEMLTSKPGQHANVFFSACSTSSLFLSKLYVDINGN 978

Query: 1018 DKEIAYGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQRQ 1061
            DK   +  LIDLY  TTK W   KGKFG N F DF NWLSS+++
Sbjct: 979  DK---FDDLIDLYASTTKQWT-QKGKFGANIFIDFINWLSSKKE 1018

>Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON}
           YEL055C (REAL)
          Length = 1020

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/736 (51%), Positives = 498/736 (67%), Gaps = 41/736 (5%)

Query: 1   MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRN 60
           M GKVNRDLF+KLASDL+EERL +AV+LI++LS LN+P D EEW YVLNRL+KGLASDRN
Sbjct: 1   MTGKVNRDLFFKLASDLQEERLHAAVALIEDLSALNLPSDAEEWLYVLNRLVKGLASDRN 60

Query: 61  SARLGFSLCLTEAINLALGM-GDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKK 119
           SARLGFSLCLTE INLA+ M     P+G++S N+FL+ LS  L ++ N          K 
Sbjct: 61  SARLGFSLCLTEVINLAINMPSGQRPKGLESTNDFLNTLSSVLDVNVNDGGK------KS 114

Query: 120 KKGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWI 179
            KG+DERGILFGKLF L++LLNEPLFS IF+ ++ +  ++  FIR+ +EL  L  KKNWI
Sbjct: 115 VKGKDERGILFGKLFGLKSLLNEPLFSEIFI-KNFENGNTDFFIRFTEELIDLALKKNWI 173

Query: 180 RESCFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLE 239
           +E CFFTL+QTI+ LLP+ D      +L + DKY +TL+ EGL+ YLL+ Y   +K  + 
Sbjct: 174 KEPCFFTLFQTIKMLLPFIDESIAAKILLIYDKYNMTLTNEGLSTYLLLKY-GGDKNLIP 232

Query: 240 KTLSDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPANWAPR 299
            TL    L N  WKS++PLARGNLP LT +LRDS+V    D +   TK  KQ   NW PR
Sbjct: 233 STL---DLKNLGWKSDDPLARGNLPLLTKVLRDSSVIPDTDGKSRDTK--KQKNTNWNPR 287

Query: 300 LHFVWDILLPILXXXXXXXXXNXXXXXXXXXXXXXXXNQDSNEFIRFPEFWQMAIDESFF 359
           LHFVWDILLP+          N                Q+S   I+FPEFW+MAIDESFF
Sbjct: 288 LHFVWDILLPLF---GSGKLENTEHVSKKRKKTSTKKVQNS---IQFPEFWKMAIDESFF 341

Query: 360 NEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMSQI 419
           NEKASSERKYLGFLI     +++       I +CF++N MR+LINQS D++R+L+K++QI
Sbjct: 342 NEKASSERKYLGFLIIDAAFKTVP---GSYIGSCFSQNVMRTLINQSIDSQRVLNKIAQI 398

Query: 420 AIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVXXXXXXXXXXXXTLR 479
            + +IVK CE+D +NKL+PCL+++LF  +  GS+NFDKLTKS TV             L 
Sbjct: 399 TLGSIVKACEEDLTNKLVPCLNSMLFGPH--GSVNFDKLTKSSTVSKLIAIKELPSTVLT 456

Query: 480 QLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLVKLAFF 539
           QL+ +F+ Q+    +++++T    F LD+ILH++R+HK E D   V++P+L P++ +AFF
Sbjct: 457 QLLNVFLPQLQ--QSKRDLT-HTHFILDSILHIIRAHKVEIDDMDVMKPILTPIIYMAFF 513

Query: 540 -----SKDNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELEKSGNQ 594
                 ++ E L+ELAKERL+SIL ELT            +SW + TL+LIL++EKS   
Sbjct: 514 KDATDDQELEQLHELAKERLFSILGELTMNKEIHSEDPEINSWQFLTLKLILDMEKSHRG 573

Query: 595 ELVNKLDADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDTESLST 654
            L+N LD +LE  K   +  L EIS ++    T Q+ GL  LLSMC++QL++G+T+S+S 
Sbjct: 574 ILINPLDENLEKTKEEAISSLAEISRSS----TAQAWGLSTLLSMCLIQLYAGETDSISV 629

Query: 655 IEELVEFYSNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIGKNELNVL 714
           IEEL EF     ++++ S+VGITEILLSLLAQKKA+L+KLSL +W+ FI D+G  EL VL
Sbjct: 630 IEELCEF----SKDKNNSMVGITEILLSLLAQKKALLKKLSLIIWQQFIEDVGLEELQVL 685

Query: 715 LAVLPVRENKQGFAHL 730
           L VL  RENKQGFA L
Sbjct: 686 LDVLKARENKQGFAQL 701

 Score =  242 bits (617), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 135/281 (48%), Positives = 171/281 (60%), Gaps = 22/281 (7%)

Query: 787  IANIDKEATSALAKALNLPENIVNEKGEVDLAKLEXXXXXXXXXXXXXXXXXXXXXXXXX 846
            + NIDKEATSAL KALNLP+NIVN+KGEVD+ +LE                         
Sbjct: 750  VVNIDKEATSALVKALNLPDNIVNDKGEVDIDQLEGLSDDDEDDEDEESMDDEKMMELDG 809

Query: 847  XXXXXXXXXQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYMKYV 906
                     QLSEIFKRRKEALSNISTGNQRK+EVKESRENVI+FKHR++DML +Y+KY 
Sbjct: 810  ---------QLSEIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYC 860

Query: 907  EGLTLTTEN------GEKFGNLLLFIEPMIKCVKQTLDKSXXXXXXXXXXXXXXXXXSSN 960
            E L L  ++      G     L+ FI P++KC+ +TLD+                   + 
Sbjct: 861  EKLALANKSEDSSSIGSPLSKLVYFIIPILKCINETLDRPLADKISKLLKGKIFKIKVNA 920

Query: 961  FQIESLNADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESNDKE 1020
            F+    N +   VM+LL+ TH+ LLTSK GQ P+++YS CST S+FL K+ V +  NDK 
Sbjct: 921  FKEMDKNIE---VMDLLKSTHKVLLTSKPGQHPAVFYSACSTSSLFLSKLYVEIHGNDK- 976

Query: 1021 IAYGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQRQ 1061
                +LIDLY  TTK W  ++GKFG N F DF NWLSS++Q
Sbjct: 977  --LDELIDLYAATTKEWT-NRGKFGANVFIDFINWLSSKKQ 1014

>TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_6.7
            YEL055C
          Length = 1041

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/1089 (39%), Positives = 606/1089 (55%), Gaps = 87/1089 (7%)

Query: 5    VNRDLFYKLASDLEEERLQSAVSLIKELSQL--NVPDD-----IEEWTYVLNRLIKGLAS 57
            VNRD+FY+LASDLEEERLQS V L+KEL +L  N  D+     ++EW YV+NRLI GLAS
Sbjct: 4    VNRDVFYRLASDLEEERLQSVVLLVKELDELKANNSDENRELVVKEWNYVVNRLINGLAS 63

Query: 58   DRNSARLGFSLCLTEAINLALGMG--DNAPQGVQSINEFLDLLSKTLPIDSNTVATENKT 115
            +R  ARLGFSLCLTE +NLAL     +  P  +  I+ FL L+S TL I S+      K 
Sbjct: 64   NRKGARLGFSLCLTEVLNLALSQKWKNILPPNLTDISSFLHLISDTLSIPSSKQGEPRKL 123

Query: 116  ALKKKKGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSK 175
                 KG+DERG+LFGKLFALQ+LLN+P+F  IF  ++K     ++   ++ EL  L + 
Sbjct: 124  L----KGKDERGLLFGKLFALQSLLNDPIFGKIFNKDNK-----AILFEFIYELIALSNL 174

Query: 176  KNWIRESCFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANK 235
            KNWI+E   FTL+  I+K++ + D      +L +L    LTL+ EGL+IY+ +IY + + 
Sbjct: 175  KNWIKEPTLFTLFNFIQKIIEFLDRSDIVQLLNILASNNLTLTNEGLSIYIYLIYTNPHI 234

Query: 236  KQLEKTLSDIQLSNSHWKSN---NPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQP 292
                    DIQ+ N++  +    +P  + N+  L+ +L +++        +  T N    
Sbjct: 235  SP-----EDIQIDNNNNNTWKNNDPFLKSNIVLLSKVLLNTSAAS---QSEKHTSN---- 282

Query: 293  PANWAPRLHFVWDILLPILXXXXXXXXXNXXXXXXXXXXXXXXXNQDSNEFIRFPEFWQM 352
             ANW PRLH+VWD++LPIL         N                + S + I+F EFW+ 
Sbjct: 283  -ANWTPRLHYVWDVILPILL--------NPKSSDKLLNKNGNKRRKVSRDRIKFNEFWRQ 333

Query: 353  AIDESFFNEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRL 412
             IDESFFNEKAS ERKYLGFLI QKT   +  N A  I + FT N +RS+INQ +D+KR 
Sbjct: 334  VIDESFFNEKASHERKYLGFLIIQKTFPLL--NTANDIESIFTSNLIRSIINQMNDSKRY 391

Query: 413  LHKMSQIAIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVXXXXXXXX 472
            L+K+S   ID IV  C+ +   +LIP L+  LF      SINFDKLTK+KT+        
Sbjct: 392  LNKISHKTIDQIVSQCQSNSELRLIPVLNGFLFKEENSSSINFDKLTKTKTISRLINLQD 451

Query: 473  XXXXTLRQLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYD-SVVEPLLN 531
                TL +L  LF S++++ +T  E+    QF LD+ILH++RSHKS+       ++P+L 
Sbjct: 452  LSTDTLSKLFFLFTSKLDSFTTTTEL----QFLLDSILHIIRSHKSQIIVSHKFLDPVLE 507

Query: 532  PLVKLAFFSKDNE-ALNELAKERLYSILSELT--GATSSPKSSNAAHSWHYYTLQLILEL 588
            P++ L FF +  + +++ + K+RL SIL++LT  G  SS        S  Y TL LI+ L
Sbjct: 508  PIILLTFFKETADVSISNILKDRLISILNDLTTVGENSS--------SIQYLTLNLIVNL 559

Query: 589  EKSGNQELVNKLDADLETIKNNGLKVLNE-ISMTNTDEMTQQSKGLELLLSMCILQLFSG 647
             +     L  K D  L  +K++ +  L   I  +  D   +    L    S+ ++QL+  
Sbjct: 560  NEDPKNVLNFKFDDSLLEVKDSAITTLKRAIEHSKRDSRLKSLVSLL---SLSVIQLYLA 616

Query: 648  DTESLSTIEELVEFY----SNS--KQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEH 701
            D +S++TI++L +FY    SN+  K +++   +GI EILL+L AQKK+IL+KL L++WE 
Sbjct: 617  DIDSIATIQDLCDFYDRYKSNTIMKNDKNRPSLGIIEILLALFAQKKSILKKLGLAMWES 676

Query: 702  FISDIGKNELNVLLAVLPVRENKQGFAHLFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 761
            FI  I  NE + +  VL  RENK+GFA LF                              
Sbjct: 677  FIDLIELNEFDEIFDVLLTRENKEGFARLF-----EGDDEYEEIDSHDDEEKDEDKNIDD 731

Query: 762  XXXXXXXXXXXXXXXXXXXVIENGDIANIDKEATSALAKALNLPENIVNEKGEVDLAKLE 821
                               V  N DI  IDKEATSALAKAL LP+NI+N+KGEVDL KLE
Sbjct: 732  ISTENSDDDNSSDEENDSIVESNDDINRIDKEATSALAKALKLPDNIINDKGEVDLGKLE 791

Query: 822  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSEIFKRRKEALSNISTGNQRKIEV 881
                                              QLS+IF RRKEALSNI TGN+RK++V
Sbjct: 792  -DISDNEVHFSSSDDDADMSDESMDDEQMMELDGQLSQIFSRRKEALSNIQTGNKRKLDV 850

Query: 882  KESRENVIAFKHRVIDMLMIYMKYVEGLTLTTENGEK--FGNLL----LFIEPMIKCVKQ 935
            KESRENVIAFKHR++DM+ +Y+K++E +T ++EN E+  F  +L    L I+ ++ C++Q
Sbjct: 851  KESRENVIAFKHRIVDMIEVYLKHIEIITKSSENIERTYFNKILNSIPLIIKSLLLCIQQ 910

Query: 936  TLDKSXXXXXXXXXXXXXXXXXSSNFQIESLNADDDRVMELLQRTH-ESLLTSKAGQFPS 994
            TLD++                    F+ +  +   + ++E +   H E +L  K+GQ+  
Sbjct: 911  TLDRNLAEKISKLLKNKLFKIKLVEFK-DCGDLTSENILEWISTLHTECILVKKSGQYQP 969

Query: 995  LYYSLCSTFSIFLGKILVHVESNDKEIAYGKLIDLYGETTKSWVM-SKGKFGINTFTDFY 1053
            LY+ LCS  S+F  +I     +N     Y  LIDLYG+TTK+W   S+ K     F+DF+
Sbjct: 970  LYFKLCSGSSLFYCRIFAETSTNAD--LYDSLIDLYGQTTKTWFKNSEMKIPTTIFSDFH 1027

Query: 1054 NWLSSQRQI 1062
            NWLSS+R +
Sbjct: 1028 NWLSSKRSV 1036

>Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]
           {ON} complement(186946..190005) [3060 nt, 1020 aa]
          Length = 1019

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/729 (48%), Positives = 483/729 (66%), Gaps = 50/729 (6%)

Query: 4   KVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIE-EWTYVLNRLIKGLASDRNSA 62
           KVNRD FYKLASDL EER+QSAV+LIK+LS L  P ++E E+ YVLNRLI GL+S+RNSA
Sbjct: 3   KVNRDSFYKLASDLPEERVQSAVALIKDLSALK-PSEVEKEFEYVLNRLISGLSSNRNSA 61

Query: 63  RLGFSLCLTEAINLALGMGDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKKKKG 122
           RLGFSLCLTE +NLAL   D     ++SI++FLD++ KTL +DS  VAT  K     KKG
Sbjct: 62  RLGFSLCLTEVVNLALDRKDQPLTCLRSIDDFLDMVDKTLVLDS--VATGKKL----KKG 115

Query: 123 RDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWIRES 182
           +DERGI+FG++FALQALLNEPLF+ +F+  DK    S   IR+  +L  L   KNW+RE 
Sbjct: 116 KDERGIMFGRMFALQALLNEPLFAKVFI--DKNGKISKFAIRFQTQLVELAVLKNWLREP 173

Query: 183 CFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLEKTL 242
           C FTLYQT+EK +PY D  + + ++ LLDKY+LTL+ EGLAIYL +I+ +      +K  
Sbjct: 174 CLFTLYQTVEKFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHTNG-----KKIA 228

Query: 243 SDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPANWAPRLHF 302
           S + L +  WK N+PLA+GNLP LT +L +SN+    +  + P  N     ANW+PRLHF
Sbjct: 229 SSLPLESQGWKLNDPLAKGNLPTLTQVLLNSNI----NQSETPQGN----AANWSPRLHF 280

Query: 303 VWDILLPILXXXXXXXXXNXXXXXXXXXXXXXXXNQDSNEFIRFPEFWQMAIDESFFNEK 362
           VWDILLPIL                            S+  I+F  FW+M +DESFFNEK
Sbjct: 281 VWDILLPILLGQDSTTNDEHVSKKQKSKTT-------SSTSIKFQSFWKMVVDESFFNEK 333

Query: 363 ASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMSQIAID 422
           +SSERKYLGFLI QK+++ +    A+L+ + F +N +RS+INQS+D KR+LHK+SQ  ++
Sbjct: 334 SSSERKYLGFLIIQKSLELVP---AQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLN 390

Query: 423 TIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVXXXXXXXXXXXXTLRQLI 482
           +I++ CE D + K+ P +  +LF  N  G+ NFDKLTK+KT+            TL Q  
Sbjct: 391 SIIEACEKD-TTKITPIVKVILFGEN--GATNFDKLTKTKTINKILSIKNLEEETLSQ-- 445

Query: 483 KLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLVKLAFFSKD 542
            +FI   N +    E    +QF LDTILHVVR+HK E +  +++  LL P++ LAFF K+
Sbjct: 446 -IFIMLSNEIKGSSESIQKDQFVLDTILHVVRNHKLEMNIGTIIIQLLTPVIDLAFFLKE 504

Query: 543 NEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELEKSGNQELVNKLDA 602
           NE ++ +AKER +S+LSEL   T+S +      SW Y  L+LI   E SG+  L  ++D 
Sbjct: 505 NERISNIAKERFFSLLSELAAITTSTR------SWQYTALELISNKEASGS-PLNQEMDQ 557

Query: 603 DLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDTESLSTIEELVEFY 662
           DL  IK  G++ L E++  +    T Q +GLE LLSM +LQL++GD +S+S +E+L  FY
Sbjct: 558 DLIAIKEKGIECLKEVTKKSD---TVQLRGLECLLSMSLLQLYAGDVDSVSIVEDLCTFY 614

Query: 663 SNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIGKNELNVLLAVLPVRE 722
            + ++++S SLVGITEILL+LLAQ+KA+L+K++L  WE F+  IG  E+ VL+ VL  RE
Sbjct: 615 -DEREDDSVSLVGITEILLALLAQRKAVLKKIALVAWEQFVPFIGPEEVKVLVDVLNARE 673

Query: 723 NKQGFAHLF 731
           NK+GFA LF
Sbjct: 674 NKEGFAQLF 682

 Score =  208 bits (529), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 121/278 (43%), Positives = 170/278 (61%), Gaps = 10/278 (3%)

Query: 790  IDKEATSALAKALNLPENIVNEKGEVDLAKLEXXXXXXXXXXXXXXXXXXXXXXXXXXXX 849
            I+KE TSALAKALNLP+NI+NE GEVDL  LE                            
Sbjct: 739  INKETTSALAKALNLPDNIINENGEVDLDALEGMSEEENDDDDDDESEEEDDESMDDEKM 798

Query: 850  XXXXXXQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYMKYVEGL 909
                  QLSEIFKRRKEALS++++GNQRK++VKESRENVIAFKHR+ID+L  Y+KYVE +
Sbjct: 799  MELDD-QLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKI 857

Query: 910  T---LTTE--NGEKFGN-LLLFIEPMIKCVKQTLDKSXXXXXXXXXXXXXXXXXSSNFQI 963
            T   L  +  N E+  N + + +  M++C++ TLD+                   + F  
Sbjct: 858  TSRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDN 917

Query: 964  ESLNADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESND-KEIA 1022
             ++ ++ + V+  L+  HE L+TSK GQ  SLY+S+CST S+FL K+L+   + D +  A
Sbjct: 918  GNV-SNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYA 976

Query: 1023 YGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQR 1060
            + +LID+YGE +K W++ KG+FG   F DFYNWL+S++
Sbjct: 977  FSQLIDIYGELSKKWLL-KGRFGPIVFMDFYNWLNSKK 1013

>KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6.7
           YEL055C
          Length = 1004

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/743 (47%), Positives = 482/743 (64%), Gaps = 57/743 (7%)

Query: 1   MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRN 60
           M GKVNRD FYKLASDL EERLQ+AVSLIKELS L +P   +EW+YV+NRLIKGL+SDRN
Sbjct: 1   MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRN 60

Query: 61  SARLGFSLCLTEAINLALGMGDN-APQGVQSINEFLDLLSKTLPIDSNTVATENKTALKK 119
            ARLGFSLCLTE ++LA+ M D+ AP+ ++S++ FL LLSKT  ID      + K   ++
Sbjct: 61  GARLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDEKKKRKGKEER 120

Query: 120 KKGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWI 179
                   ++FGKLFALQALLNEPLFS IF+ + K    +    +++DEL  L S+KNWI
Sbjct: 121 G-------LMFGKLFALQALLNEPLFSDIFIKDGKI---TKFTTKFIDELVNLASRKNWI 170

Query: 180 RESCFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLE 239
           ++ C FTLYQTIE+LLPY+D  F + V+T+LD  + TL+ EGLAIYLL I      K   
Sbjct: 171 KQPCLFTLYQTIERLLPYSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFI-----SKGYS 225

Query: 240 KTLSDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPANWAPR 299
             L  I ++N  WK NNPL +GNL  ++ ++R+S V    D+E   TK N    ANW P+
Sbjct: 226 SALLSINVTNKGWKYNNPLLKGNLSLVSEVVRESAVV-VDDNE---TKTNN---ANWHPK 278

Query: 300 LHFVWDILLPILXXXXXXXXXNXXXXXXXXXXXXXXXNQDSNEFIRFPEFWQMAIDESFF 359
           LHFVWDILLPIL                           ++   I FPEFW+  +DE++F
Sbjct: 279 LHFVWDILLPIL---YNDPREEPLKKKKKHNNGSSKSKSEAVGAIEFPEFWKAIVDETYF 335

Query: 360 NEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMSQI 419
           ++KASSERK+LG LIF K + ++    +K I+ CF++N MR LINQ SD++R LHK+++ 
Sbjct: 336 SDKASSERKFLGLLIFLKALPTVP---SKWIACCFSQNLMRCLINQCSDSERHLHKIAEK 392

Query: 420 AIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVXXXXXXXXXXXXTLR 479
            + +IVK CE DP +KL+P + ALLF TN  GSINFD+LTKSKTV            ++ 
Sbjct: 393 CLISIVKTCEADPGHKLVPVVGALLFGTN--GSINFDRLTKSKTVAKLIATKGLEDDSIG 450

Query: 480 QLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSV----VEPLLNPLVK 535
           +L  LF S++N+   E     V  F LDT+LH++RSHK     + +    +  LL PLVK
Sbjct: 451 KLFALFTSELNSQKNEA----VLHFILDTLLHILRSHKLNLKGEHISTWLMSVLLLPLVK 506

Query: 536 LAFF------SKDNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELE 589
           L FF       +D   ++E+A+ER+YSILSEL   +S P  +  AHSW ++ L  +  +E
Sbjct: 507 LGFFHATETSPEDKINVSEIARERIYSILSEL---SSVP--TGDAHSWQFHILNELTTVE 561

Query: 590 KSGNQELVNKLDADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDT 649
                 L N LD DL T+K+ GL V++ +S+ N     + S+G+E LL+MC+LQL+SG+ 
Sbjct: 562 --NELTLTNALDEDLTTVKDTGLSVIHSLSVKN----DKSSRGIESLLAMCLLQLYSGEA 615

Query: 650 ESLSTIEELVEFYSNSKQEE-STSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIGK 708
           +S++TI+E+ ++ +  K  + S SLVGITEILL LLAQKK +L K SL VWE  I D+G 
Sbjct: 616 DSVATIKEICDYLTEEKSSKNSISLVGITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGS 675

Query: 709 NELNVLLAVLPVRENKQGFAHLF 731
           +ELN++L VL  RENK+GF++LF
Sbjct: 676 DELNLILDVLSARENKEGFSYLF 698

 Score =  213 bits (541), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 122/281 (43%), Positives = 165/281 (58%), Gaps = 22/281 (7%)

Query: 784  NGDIANIDKEATSALAKALNLPENIVNEKGEVDLAKLEXXXXXXXXXXXXXXXXXXXXXX 843
            N D+ NID++   ALAKAL LPEN+VNE GEV   +++                      
Sbjct: 741  NKDVTNIDRQTACALAKALKLPENVVNEDGEVKFNEIDDLEDESSDDESMDDEAMMALDG 800

Query: 844  XXXXXXXXXXXXQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYM 903
                        QL++IFKRRK+ALS++ TGN RKIEV++SRE+VI FK R+IDML IY+
Sbjct: 801  ------------QLADIFKRRKDALSHVPTGNMRKIEVRDSRESVINFKQRMIDMLTIYV 848

Query: 904  KYVEGLTLTTEN--GEKFGNLLLFIEPMIKCVKQTLDKSXXXXXXXXXXXXXXXXXSSNF 961
            KYVE L L  ++   EK   +  F+EPM+KCV++TLD+                      
Sbjct: 849  KYVEKLDLEDKDVMKEKLQTVSTFVEPMLKCVQRTLDRPLADKIFKLLKAKIF-----KV 903

Query: 962  QIESLNADDDRVMELLQRTHES-LLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESNDKE 1020
            +I     D +R +E LQR H + LL  K+GQ+ ++YYSLCS+ SIF  K+L+    N K+
Sbjct: 904  KIPVSAEDGERFVESLQRIHGTYLLAEKSGQYQAIYYSLCSSASIFFCKLLIESRDN-KD 962

Query: 1021 IAYGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQRQ 1061
             A+ ++ID+Y ETTK W M K KF  + F DFYNWLSS+RQ
Sbjct: 963  AAHNEVIDIYAETTKKW-MDKKKFPTSVFFDFYNWLSSKRQ 1002

>CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} similar
           to uniprot|P39985 Saccharomyces cerevisiae YEL055c POL5
           DNA polymerase V
          Length = 1021

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/732 (44%), Positives = 468/732 (63%), Gaps = 44/732 (6%)

Query: 3   GKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRNSA 62
            KVNRD FYKLASDL EERLQ+AV +IK+LS L VP +IEEW Y +NRL+KGL S RNSA
Sbjct: 2   AKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNSA 61

Query: 63  RLGFSLCLTEAINLALGMGDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKKKKG 122
           RLGFS+CL+EA+NLAL +GD AP+G+ SI  +L +L++TL  D +          KK+KG
Sbjct: 62  RLGFSMCLSEALNLALSLGDKAPEGLNSIENYLKILNETLGADFDEG--------KKRKG 113

Query: 123 RDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWIRES 182
           +DERGILFGKLF LQALLNEPLFS +F+++D     S+    +V E+  L   KNWIRE 
Sbjct: 114 KDERGILFGKLFGLQALLNEPLFSNVFVTKDGI---SNFVPVFVQEMINLSKCKNWIREP 170

Query: 183 CFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLEKTL 242
             F+LYQT+EKL+          +++ LD+  LT++ EGLAIYLL++  S    + E  +
Sbjct: 171 ALFSLYQTLEKLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAE--I 228

Query: 243 SDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEF-QDHEKPPTKNNKQPPANWAPRLH 301
           ++I+L N  WKSN+PLA+GNLP+LT +L D++   F +D+E+   K      ANW PRLH
Sbjct: 229 AEIKLQNQGWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGG----ANWNPRLH 284

Query: 302 FVWDILLPILXXXXXXXXXNXXXXXXXXXXXXXXXNQDSNEF--IRFPEFWQMAIDESFF 359
           FVW+ LL  +         N                + +N    I+F EFWQM +DE++F
Sbjct: 285 FVWEKLLSTI--------INGSHSLNVEDKHVSKKRKKNNTIASIKFHEFWQMVVDETYF 336

Query: 360 NEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMSQI 419
           N+KASSERKYLGFLIFQ+    +   + + +     +NF+RSLINQ S+ KR L+K++  
Sbjct: 337 NDKASSERKYLGFLIFQRAFPML--KSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQ 394

Query: 420 AIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVXXXXXXXXXXXXTLR 479
            ++ IV+ CE+D + K++P  + L F  +  GSI FD+L+K+K +             L 
Sbjct: 395 TVEIIVESCEND-TTKILPVFETLAFGKS--GSITFDRLSKTKLLSRLLGIKSVRYEVLS 451

Query: 480 QLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLVKLAFF 539
           +L  +   Q++  S EK  +   QF LD++LH+VR+ K+E D   + E +L  +VKLAFF
Sbjct: 452 KLFDILSRQLSIKSEEKSFS---QFILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFF 508

Query: 540 SKDNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELEKSGNQELVNK 599
           + DNE L E++KERL+SILSEL    +S   S +     Y  ++L+ +    G +++ ++
Sbjct: 509 TGDNETLQEMSKERLFSILSEL----NSLHLSESQEIPQYVVIKLV-QQHIEGGEKMTSE 563

Query: 600 LDADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDTESLSTIEELV 659
           LD +L   +++ L++L EI+   TD+     +GL  L + C+LQL++GD+ES+ T++EL 
Sbjct: 564 LDDELRETESSALRILAEIAKA-TDK--PYLRGLGSLFATCLLQLYTGDSESVGTLQELK 620

Query: 660 EFYSNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIGKNELNVLLAVLP 719
           + Y     ++   L  ITEILLSLLAQKKA+L+K S++VWE  +  + ++ELN+LL +L 
Sbjct: 621 DIYEKLISDDERPLSSITEILLSLLAQKKALLKKASIAVWEQVVPYVSQDELNLLLDILL 680

Query: 720 VRENKQGFAHLF 731
            RENKQGFA LF
Sbjct: 681 ARENKQGFAQLF 692

 Score =  209 bits (531), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 122/285 (42%), Positives = 160/285 (56%), Gaps = 21/285 (7%)

Query: 784  NGDIANIDKEATSALAKALNLPENIVNEKGEVDLAKLEXXXXXXXXXXXXXXXXXXXXXX 843
            N  + NIDKE TSALAKAL+LP +I+N  GEVD+ KL                       
Sbjct: 750  NDAVNNIDKETTSALAKALDLPADIINANGEVDIEKL---------EMQSDDDEDDEDDE 800

Query: 844  XXXXXXXXXXXXQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYM 903
                        QLSEIFKRRKEALSNI TGN+RK EVKESRE+VIAFKHR++D+L++Y+
Sbjct: 801  SMDDEQMMDLDDQLSEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYI 860

Query: 904  KYVEGLTLTTE-----NGEKFGNLLLFIEPMIKCVKQTLDKSXXXXXXXXXXXXXXXXXS 958
            K+VE +    +       +K   LL F  PMIKC+KQTLDKS                  
Sbjct: 861  KHVEKMIQREDVDENSKADKLNCLLTFAIPMIKCIKQTLDKSLAEKLAKLLKTRLF---- 916

Query: 959  SNFQIESLNADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESND 1018
               ++  +  D   V+E  QR H+  L +K GQFP LYYS+CS+ S++  KILV   ++ 
Sbjct: 917  -KIRVTGIKLDTADVVEDFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVD-NADY 974

Query: 1019 KEIAYGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQRQIP 1063
            ++  Y  L+D Y  T K W +   KF  + F DF NWL+S++Q P
Sbjct: 975  QQGVYETLVDTYSTTIKEW-LKDTKFPHSIFLDFVNWLASKKQGP 1018

>SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar to
           uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1047

 Score =  556 bits (1433), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 333/752 (44%), Positives = 461/752 (61%), Gaps = 69/752 (9%)

Query: 1   MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRN 60
           M  K+NRDLFYKLASDL+EER+Q+A+SLIKEL+ L   D   EW YVLNRLIKGL+S+RN
Sbjct: 1   MVEKINRDLFYKLASDLQEERVQAAISLIKELASLENND--SEWEYVLNRLIKGLSSNRN 58

Query: 61  SARLGFSLCLTEAINLALGMGDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKKK 120
           SARLGFSLCLTE +++AL  G      + SI E++ LL  TL     TV          K
Sbjct: 59  SARLGFSLCLTEVLSVALEKG-----YLNSIEEYIQLLQSTLL--KETV----------K 101

Query: 121 KGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWIR 180
            G++ERG+LFG++F LQALLNEPL S IFL +    +++   + ++ EL  +   K WIR
Sbjct: 102 NGKEERGLLFGRMFGLQALLNEPLLSKIFL-DKTGGLNAHFMVNFMGELVQVALSKTWIR 160

Query: 181 ESCFFTLYQTIEKLLPYA-DIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLE 239
           E C FTL+Q +EKL P+  D    + +  LLD  +L+L+ EGLAIYL +I+      +  
Sbjct: 161 EPCLFTLFQVVEKLSPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFI 220

Query: 240 KT---LSDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPANW 296
           K    L +++L NS WK+N+PL +GNLP L+ +L+D +         P   +  +   +W
Sbjct: 221 KKSGLLKNLEL-NSQWKNNDPLTKGNLPTLSAVLKDVS---------PVEDSGLKQKGSW 270

Query: 297 APRLHFVWDILLPILXXXXXXXXXNXXXXXXXXXXXXXXXNQDSNEFIRFPEFWQMAIDE 356
           APRLHFVW+I+LPIL         +                Q   + I FPEFW+  +DE
Sbjct: 271 APRLHFVWNIILPILARDDQNEGSSDEHITKKRKKEKAKDVQ--VKMIEFPEFWKAVVDE 328

Query: 357 SFFNEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKM 416
           SFFNEK+S ERKYLGFLI +   + +      L+S  F++N MR+LINQSSD+KR+LHK+
Sbjct: 329 SFFNEKSSGERKYLGFLILEAAFKQVP---LSLVSLLFSKNLMRTLINQSSDSKRILHKI 385

Query: 417 SQIAIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVXXXXXXXXXXXX 476
           SQ  + +I+++CE  P +K +P + A+LF+ N  G+INFDKLTK+KTV            
Sbjct: 386 SQKVLASILELCESHP-DKTVPSIQAMLFSEN--GTINFDKLTKTKTVDLLVANPSMTPK 442

Query: 477 TLRQLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLVKL 536
            L  L+ LF+S +     E+    + +F LD++LHVVR+HK+  D  + V+PL+  ++ +
Sbjct: 443 HLSSLVDLFVSHLPDDPNEE--AALTRFLLDSMLHVVRTHKTVSD-KTWVKPLITSVISM 499

Query: 537 AFF----------SKDNEALNEL---AKERLYSILSELTGATSSPKSSNAAHS--WHYYT 581
            FF          ++D++  +     A+ERLYSIL++L      P S  + HS  W Y T
Sbjct: 500 GFFKTSPAKVDQENQDDDHTDGFEFQARERLYSILADLI-----PLSKQSIHSASWPYIT 554

Query: 582 LQLILELEKSGNQELVNKLDADLETIKNNGLKVLNEISMT-NTDEMTQQSKGLELLLSMC 640
           LQ++L  E+S  +EL++ LD  L  IK + L  L  I      D    Q  GLELLLSM 
Sbjct: 555 LQVLLSQEQS--KELIHPLDDGLNKIKLDALNDLEGIRRELENDPSASQFYGLELLLSMT 612

Query: 641 ILQLFSGDTESLSTIEELVEFYSNSKQE-ESTSLVGITEILLSLLAQKKAILRKLSLSVW 699
           +LQ++ GDTESLS +E+LV FY + +   E  SL+G+ EILL+LLAQKKA+LR+LSL VW
Sbjct: 613 VLQIYGGDTESLSVLEDLVTFYHSMRDSSEENSLIGVIEILLALLAQKKALLRRLSLLVW 672

Query: 700 EHFISDIGKNELNVLLAVLPVRENKQGFAHLF 731
           E F+  +G  EL VL  +L  RENK+GF  LF
Sbjct: 673 ELFVDKVGTPELEVLFDILSARENKEGFTALF 704

 Score =  211 bits (536), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 124/283 (43%), Positives = 161/283 (56%), Gaps = 20/283 (7%)

Query: 784  NGDIANIDKEATSALAKALNLPENIVNEKGEVDLAKLEXXXXXXXXXXXXXXXXXXXXXX 843
            N DI  IDKE TSALAKALNLP+ I+NE GEV+  +L                       
Sbjct: 776  NEDINKIDKETTSALAKALNLPDGIINENGEVNFNELSESDDEDESEEDEDEESMDDEKM 835

Query: 844  XXXXXXXXXXXXQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYM 903
                        QLS+IF+RRKEALS ISTGN+RK+E KESRENVIAFKH+V+DML +++
Sbjct: 836  MELDD-------QLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFV 888

Query: 904  KYVEGLTLTTENGE-KFGNLLLFIEPMIKCVKQTLDKSXXXXXXXXXXXXXXXXXSSNFQ 962
            K+VE  +   E GE +  ++    +P+IKCV+QT DK+                     +
Sbjct: 889  KFVERTSKNKECGETELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRM-----CKLK 943

Query: 963  IESLNADDDRVMEL----LQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESND 1018
            +  L  D D + EL    L   H  +L  K GQFP+LY+S CS  S+FL K+LV   +ND
Sbjct: 944  LPKLINDSDDIEELTISNLGAVHRLMLADKCGQFPNLYFSTCSVVSLFLSKLLVQASTND 1003

Query: 1019 KEIAYGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQRQ 1061
                Y +LID+Y  T K W  SKGKFG + F DF NWL+S++Q
Sbjct: 1004 S--IYDRLIDIYLSTMKKW-FSKGKFGTSFFFDFINWLASKKQ 1043

>TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7
           YEL055C
          Length = 1024

 Score =  537 bits (1384), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 321/736 (43%), Positives = 454/736 (61%), Gaps = 61/736 (8%)

Query: 4   KVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIE-EWTYVLNRLIKGLASDRNSA 62
           +V+RDLFYKLASD+ EER+ S V ++  L +L+V D+ E EW YV++RL+KGL S+RNSA
Sbjct: 2   RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61

Query: 63  RLGFSLCLTEAINLALGMG-DNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKKKK 121
           RLGFS+CLTEA++L L       P+ ++ + ++L  +    P+     A     A  K K
Sbjct: 62  RLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLS----AVGTGKAKVKVK 117

Query: 122 GRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWIRE 181
           G+DERG LFG+LFA + LLNEPLFS +F        D    I + + +  LGS KNW+ E
Sbjct: 118 GKDERGTLFGRLFAYKVLLNEPLFSLLF--------DQKFLIEFQERVIQLGSMKNWLLE 169

Query: 182 SCFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLEKT 241
            CFF+LYQ IEKLLP  D E+ Q  +  +D+++LT++ EGL++YLL+  +         T
Sbjct: 170 PCFFSLYQAIEKLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLLAKKF--------T 221

Query: 242 LSDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPANWAPRLH 301
           LSD  L NS WK+N+PL +GNL  +  ++ D+NV      +   +  NK    NWAPRLH
Sbjct: 222 LSDFTLENSAWKANDPLQKGNLSVMAKVMLDTNV------DGANSNTNK----NWAPRLH 271

Query: 302 FVWDILLPILXXXXXXXXXNXXXXXXXXXXXXXXXNQDSN--EFIRFPEFWQMAIDESFF 359
           ++WDI+L            N               +  S   + + F  FWQ  +DESFF
Sbjct: 272 YIWDIIL-------REFFDNEQHGSDAKHVYQKKKHDKSKNPQRVEFKSFWQAVVDESFF 324

Query: 360 NEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMSQI 419
           N+KAS ERKY G+LIFQK ++S+    A  +  CFT+N MRS+INQ+SD+KR+L+K+SQ 
Sbjct: 325 NDKASPERKYQGYLIFQKAVESVP---ASEVEYCFTQNIMRSMINQASDSKRMLNKLSQK 381

Query: 420 AIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVXXXXXXXXXXXXTLR 479
            ++T+V +CE +P+ KL P L ALLF+    GS+NFD LTKSKTV             L 
Sbjct: 382 TLNTLVSICESEPA-KLTPVLTALLFSEE--GSLNFDILTKSKTVSRLLATKQSDHHYLA 438

Query: 480 QLIKLFISQINAMSTEKEITIVN---QFALDTILHVVRSHKSEFDYD-SVVEPLLNPLVK 535
            LI+LF S++N      E+  +N   +F LD++L+++RS K+  + D  +V  +L   ++
Sbjct: 439 TLIRLFTSRLNVSDKTPELEELNPRLKFILDSLLNLIRSQKALLETDKEIVMEILESTIQ 498

Query: 536 LAFFSKDNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELEKSGNQE 595
           LAFF KDNE +N +AKERL S+L+EL    S+        SW Y  L++I+  EKS  + 
Sbjct: 499 LAFFQKDNEYINNIAKERLSSMLAELIVLPSTDG------SWPYLALEIIVTKEKS--ET 550

Query: 596 LVNKLDADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDTESLSTI 655
           L++ LD  L  +K   L +L +IS   +   + Q  G+E L+SM ++QL+SGD ES+  I
Sbjct: 551 LIDSLDDSLVAVKAESLDILKKISELKSK--SSQLLGIESLMSMNLIQLYSGDAESIGII 608

Query: 656 EELVEFYSNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIGKNELNVLL 715
           E+L  FY  +   E+ +  G+TEILLSLLAQ+K++LRKLSL VWE FI  IGK E+N+LL
Sbjct: 609 EDLTTFYHETSNHETANFTGVTEILLSLLAQRKSLLRKLSLLVWEQFIDQIGKEEINLLL 668

Query: 716 AVLPVRENKQGFAHLF 731
             L  RENK+GF+ LF
Sbjct: 669 NFLHARENKEGFSVLF 684

 Score =  203 bits (516), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 123/288 (42%), Positives = 164/288 (56%), Gaps = 23/288 (7%)

Query: 787  IANIDKEATSALAKALNLPENIVNEKGEVDLAKLEXXXXXXXXXXXXXXXXXXXXXXXXX 846
            I+ IDKE TSALAKALNLP+NI+NE GEV++  LE                         
Sbjct: 744  ISQIDKETTSALAKALNLPDNIINENGEVNINMLEGMDEDDDDDSSSAEDDDESMDDEKM 803

Query: 847  XXXXXXXXXQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYMKYV 906
                     QLSEIFKRRK+ALS +STGNQRK++VKESRENVIAFKHR+IDML IY+K++
Sbjct: 804  MELDD----QLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHI 859

Query: 907  EGLTLTTENGEK----------FGNLLLFIEPMIKCVKQTLDKSXXXXXXXXXXXXXXXX 956
            E L+L   +G K             +L  ++    CV+QTLDK                 
Sbjct: 860  EQLSLNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKI 919

Query: 957  XSSNFQ-IESLNADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVH-- 1013
              + F+ IE+       +M  L+R H  L T+K GQF + YY  CS+ S++L + L+   
Sbjct: 920  RFTLFEDIET----STEIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTT 975

Query: 1014 VESNDKEIAYGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQRQ 1061
            VE+ +K   + KL+D+Y  TTK W M +GK+G   F DFYNWL+S++Q
Sbjct: 976  VEA-EKTKMFEKLVDVYAATTKIW-MQEGKYGAKIFVDFYNWLASKKQ 1021

>ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL055C
           (POL5)
          Length = 1002

 Score =  536 bits (1380), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 330/744 (44%), Positives = 449/744 (60%), Gaps = 59/744 (7%)

Query: 1   MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRN 60
           MA +VNRDLFYKL SDL +ER+QSA++LI EL++L V ++ +EW YVL RL++GLAS   
Sbjct: 1   MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNK 60

Query: 61  SARLGFSLCLTEAINLALGMGDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKKK 120
           SARLGFSLCLTE    AL  G      + S  E+L+ L   LP+D            K K
Sbjct: 61  SARLGFSLCLTEVAAAALENGH-----IGSAEEYLERLEAALPVD------------KVK 103

Query: 121 KGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWIR 180
            G++ERG LFG++F LQA+LNEPLFS +F++ D + I  +   +++  L  L   K W+R
Sbjct: 104 NGKEERGQLFGRMFGLQAMLNEPLFSRVFVAGDGQ-IQQAFAHQFMQRLVQLALTKAWLR 162

Query: 181 ESCFFTLYQTIEKLLPYA-DIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQL- 238
           + C FTLYQ IE+L P A D EF + VLTLLD++ LT + EGLAIYL +  +    K++ 
Sbjct: 163 QPCLFTLYQVIERLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRIL 222

Query: 239 -EKTLSDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPANWA 297
            E  + D       WK++NPLA+GN  AL ++L+D  + E    + P  K        W 
Sbjct: 223 DETKIFDALPLVKRWKADNPLAKGNAKALASVLKDDALIE---GDGPKQK------GVWT 273

Query: 298 PRLHFVWDILLPILXXXXXXXXXNXXXXXXXXXXXXXXXNQDSNEFIRFPEFWQMAIDES 357
           PRLHFVWD+LLP+L         +                +     + F EFWQ+ +DES
Sbjct: 274 PRLHFVWDLLLPLLAEEKVSPDTHVHIAKKHKTGKKPKSAESG--MLSFGEFWQVVVDES 331

Query: 358 FFNEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMS 417
           FF+EKASSERKYLG LI +K ++S+    + L+   F++N +R+LINQSS+  R LHK+S
Sbjct: 332 FFSEKASSERKYLGVLIMEKAVRSVP---SSLVQDIFSKNALRTLINQSSETTRHLHKLS 388

Query: 418 QIAIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVXXXXXXXXXXXXT 477
              + TIV  CE D S K++P L A+ F  N  G+INFDKLTKSKT             +
Sbjct: 389 VNFLKTIVSACETDAS-KVVPVLTAIWFGPN--GTINFDKLTKSKTTDSLVTAK-----S 440

Query: 478 LRQLIKLFISQINAMSTEKEITIVNQ--FALDTILHVVRSHKSEFDYDSVVEPLLNPLVK 535
           L       +  +     E E T +++  F LDT+LHV+R+HK +  + S   PLL  LV+
Sbjct: 441 LTATELAQLVTLLLQQLEHENTDISKIKFILDTLLHVIRAHKWK-AHLSWTNPLLLALVR 499

Query: 536 LAFFS------KDNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELE 589
            AFFS      + +E +  L++ERL+S+L EL   +   K    A SW Y TL+L+L+ E
Sbjct: 500 YAFFSAPSHLSEQSEEIITLSRERLFSVLGELIPLS---KHDMGAPSWAYATLELLLQ-E 555

Query: 590 KSGNQELVNKLDADLETIKNNGLKVLNEISMTNTDEMTQQSK--GLELLLSMCILQLFSG 647
           K     L  +LDA+LET+ +N LK+L +I   +T    +  +  GLELLLS+ ILQ+ +G
Sbjct: 556 KE-KHPLALQLDAELETVTSNALKILRKIINKSTKSPNENPQLFGLELLLSVSILQVHAG 614

Query: 648 DTESLSTIEELVEFYSNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIG 707
           D +S ST+EEL  FY ++ Q     LVGITEILLSL+AQKK++LRKL+L VWE FI  +G
Sbjct: 615 DVDSASTLEELASFYESATQGADNGLVGITEILLSLVAQKKSMLRKLTLVVWESFIDKVG 674

Query: 708 KNELNVLLAVLPVRENKQGFAHLF 731
           K EL +LL  L  RENK GFA LF
Sbjct: 675 KEELELLLNTLSARENKAGFAQLF 698

 Score =  186 bits (473), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 108/277 (38%), Positives = 153/277 (55%), Gaps = 20/277 (7%)

Query: 786  DIANIDKEATSALAKALNLPENIVNEKGEVDLAKLEXXXXXXXXXXXXXXXXXXXXXXXX 845
            D+A IDKEATSALA AL LP+NI++E G V   +                          
Sbjct: 741  DVAKIDKEATSALAHALRLPDNILDEDGNVGFEE---------------MDDEEEEEESM 785

Query: 846  XXXXXXXXXXQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYMKY 905
                      QLSEIFKRRK+AL+ I TGNQRKIE KESR++VIAFKHRV+DML IY K 
Sbjct: 786  DDEAMMELDGQLSEIFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKN 845

Query: 906  VEGLTLTTE--NGEKFGNLLLFIEPMIKCVKQTLDKSXXXXXXXXXXXXXXXXXSSNFQI 963
            VE      +  +     N+L   EPM+K ++QTLD+                   + ++ 
Sbjct: 846  VERSVTKNKKLSATMSANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKPAAYKE 905

Query: 964  ESLNADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESNDKEIAY 1023
             +   +++ ++  L+  H ++L+ K GQFP L++S CS+ S+FL K+L+ ++  D     
Sbjct: 906  FTSEINEESILTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMK--DDPSTS 963

Query: 1024 GKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQR 1060
             ++I +Y  T K W +S GKFG N F DF NWL+S++
Sbjct: 964  EQVIGIYSTTMKHWNVS-GKFGPNFFIDFINWLASKK 999

>Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to
           Ashbya gossypii ACR020C
          Length = 1027

 Score =  510 bits (1314), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 320/752 (42%), Positives = 451/752 (59%), Gaps = 71/752 (9%)

Query: 4   KVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRNSAR 63
           +VNRDLFY+LASD+EEER+++AV ++ ELS++   D+ +EW YVL RLIKGLAS R  AR
Sbjct: 3   QVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQGAR 62

Query: 64  LGFSLCLTEAINLALGMGDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKKKKGR 123
           LGFS+CL+E + L L  G      ++S+  ++  L + L  D +            K G+
Sbjct: 63  LGFSMCLSEVVTLGLEKGR-----LESVEVYIGQLFEKLA-DGHV-----------KNGK 105

Query: 124 DERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWIRESC 183
           +ERG++FGKLF LQALLNEPLF  IF+  D K ID    + ++D L  L   K W+RE C
Sbjct: 106 EERGLVFGKLFGLQALLNEPLFGRIFM--DGKVIDLQFTVLFMDHLVKLALSKTWLREPC 163

Query: 184 FFTLYQTIEKLLP-YADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQL---E 239
            FTLYQ IEKL   + ++   + +  LLD ++LTL+ EGLAIYLL+IY     K L    
Sbjct: 164 LFTLYQLIEKLSSKFTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETKSLLIKS 223

Query: 240 KTLSDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPANWAPR 299
           K LS I L  S WK+N+PL++GN+  L+++L+D           P   N  +   +WAPR
Sbjct: 224 KILSKITL-RSCWKNNDPLSKGNVTILSSVLKDI---------IPVEDNVMKQKGSWAPR 273

Query: 300 LHFVWDILLPILXXXXXXXXXNXXXXXXXXXXXXXXXNQDSNEFIRFPEFWQMAIDESFF 359
           LHFVWDIL+PIL                          +     + F EFWQ+ +DESFF
Sbjct: 274 LHFVWDILIPILCRQQEIPGAAEHVPKKRKTDKKDKI-EKVRAPLSFSEFWQVVVDESFF 332

Query: 360 NEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMSQI 419
           N KASSERKYLG LI +K +Q +    +  + + F++N MR+LINQSS++ R LHK+S  
Sbjct: 333 NAKASSERKYLGLLIIEKAMQCVP---SSYVPSIFSKNIMRTLINQSSESTRNLHKISTN 389

Query: 420 AIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVXXXXXXXXXXXXTLR 479
            +  IV +CE DP+ K++P +++L F  N  GSINFD LTKSKT+             L 
Sbjct: 390 VLKNIVSICESDPT-KVLPVVNSLWFGPN--GSINFDILTKSKTMDSIIAVQGLKSEHLA 446

Query: 480 QLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLVKLAFF 539
            L+ L +S+I+  S+   ++ V ++ LD +LH+V++HK + D     +PLL+ +VKL+FF
Sbjct: 447 SLVALIVSEIDKESS--PVSKV-RYLLDILLHIVQAHKLKADM-FWTKPLLSSIVKLSFF 502

Query: 540 S------------------KDNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYT 581
           +                   +++ +  L++ERL+SIL +L   +   K +    +W Y T
Sbjct: 503 NDKLSDFEDVDLDAHADADAESKKIPVLSRERLFSILGQLIPTS---KQNVDGPTWPYVT 559

Query: 582 LQLILELEKSGNQELVNKLDADLETIKNNGLKVLNEISMTNTDEMTQQS--KGLELLLSM 639
           LQ+++  E    + L+ KLD +L+  K + LK +N+I    + E  Q S   GLELLL +
Sbjct: 560 LQIVIAEEH--RRSLIFKLDEELQQTKEHALKAINDIR-KKSQESPQASELCGLELLLGV 616

Query: 640 CILQLFSGDTESLSTIEELVEFYSNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVW 699
            ILQ++SGD ES S +EEL  FY  S   +   LVGITEILLS++AQKKA+LR+L+L VW
Sbjct: 617 TILQMYSGDAESASILEELTTFY-KSIDTKPNGLVGITEILLSMVAQKKAVLRRLTLIVW 675

Query: 700 EHFISDIGKNELNVLLAVLPVRENKQGFAHLF 731
           E  I  I  +ELN+L  +L VRENKQGFA LF
Sbjct: 676 ESLIDKIEGDELNLLFDILSVRENKQGFAALF 707

 Score =  196 bits (499), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 116/283 (40%), Positives = 157/283 (55%), Gaps = 26/283 (9%)

Query: 784  NGDIANIDKEATSALAKALNLPENIVNEKGEVDLAKLEXXXXXXXXXXXXXXXXXXXXXX 843
            N  I  I+KE TSALA AL LPEN+++E G+V                            
Sbjct: 762  NEYIDKINKETTSALADALKLPENMIDENGDVGFED------------FDDGDEEEEEEE 809

Query: 844  XXXXXXXXXXXXQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYM 903
                        QLSEIFKRRKEALS + TGN+RK+EV+ESRE+VI+FKHRV+DML IY 
Sbjct: 810  SMDDEAMMELDGQLSEIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLEIYC 869

Query: 904  KYVEGLTLTTENGE--KFGNLLLFIEPMIKCVKQTLDKSXXXXXXXXXXXXXXXXXSSNF 961
            KYV  L   ++  E  K  N+   I+P++KC++QT+D+                      
Sbjct: 870  KYVVRLAGKSQQCEASKLLNIHSMIDPLLKCIQQTIDRPLAEKAAKLLKNHI-----CKL 924

Query: 962  QIESLNADDDRVMEL----LQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESN 1017
            ++E      D V E+    L+  H S+L  K GQF  LY+  CST S+FLGKILV  + +
Sbjct: 925  KLEPFKGCVDEVSEIVFLSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLGKILVVTKPD 984

Query: 1018 DKEIAYGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQR 1060
              E+ Y ++ID+Y ++ K+W + KGKFG N F DF NWL+S+R
Sbjct: 985  --EVTYNRIIDIYSQSIKNWTV-KGKFGPNFFIDFINWLASKR 1024

>Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C
           (POL5) - DNA polymerase V [contig 186] FULL
          Length = 1008

 Score =  485 bits (1248), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 314/749 (41%), Positives = 436/749 (58%), Gaps = 71/749 (9%)

Query: 1   MAG-KVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDR 59
           M G ++NRDLFYKLASDL EERLQ+ + L+ +LS+L    D  EW YVL+RLIKGL+S R
Sbjct: 1   MGGIEINRDLFYKLASDLSEERLQATIDLVTQLSKLE--KDSSEWQYVLDRLIKGLSSSR 58

Query: 60  NSARLGFSLCLTEAINLALGMGDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKK 119
           N ARLGFSLCLTE + LAL  G  A      +++++ LL   L       + EN      
Sbjct: 59  NGARLGFSLCLTEVVALALEKGVLA-----RVDQYMHLLISAL-------SKENV----- 101

Query: 120 KKGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWI 179
           K G++ERG+LFGKLF LQ LLNEPLFS +F + D+ +++  L   Y+  L  +   K WI
Sbjct: 102 KNGKEERGLLFGKLFGLQVLLNEPLFSKVF-TPDENQLNVELMSSYMSYLIDIALAKTWI 160

Query: 180 RESCFFTLYQTIEKLLPY-ADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQL 238
           RES  FTL+Q +EKL P     +  + VL LLD   LT + EGLAIYL +++R ++   +
Sbjct: 161 RESSLFTLFQAVEKLAPLLGSRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPV 220

Query: 239 EKT---LSDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPAN 295
            +    L ++ L N  WK+N+PL RGNLPA++N L+DS   +       P+   K     
Sbjct: 221 LRKKGFLDELNLKNP-WKNNDPLKRGNLPAISNALKDSGARD------DPSLTQK---GV 270

Query: 296 WAPRLHFVWDILLPILXXXXXXXXXNXXXXXXXXXXXXXXXNQDSNEFIRFPEFWQMAID 355
           WAPRLHF WDI+L  L                          ++   FI+FPEFW+  +D
Sbjct: 271 WAPRLHFAWDIVLQTLLHA------ENSEITTMQPPSKKRKKEEKEAFIKFPEFWKSVVD 324

Query: 356 ESFFNEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHK 415
           ESFFNEK+SSERKYLG L+F+KT Q    +  + +   F++N +R LINQ    +R LHK
Sbjct: 325 ESFFNEKSSSERKYLGILVFEKTFQL---SPPRYLPQLFSKNLIRCLINQCGSAERNLHK 381

Query: 416 MSQIAIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVXXXXXXXXXXX 475
           +SQ A+ TIV+VC+  P  K  P    L F     G+INFD LTK+KTV           
Sbjct: 382 ISQKALATIVEVCKAQP-EKTAPSFVGLSFGEY--GTINFDHLTKTKTVNSLLSNKSLRS 438

Query: 476 XTLRQLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLVK 535
             L  L +  IS  N     KE++   +F LD ILH+VR+HK+  D +  ++P+L  LV 
Sbjct: 439 DDLMILEESLIS--NLFGNLKELSRA-RFILDAILHLVRAHKAHAD-EVWLKPVLKALVC 494

Query: 536 LAFFS-------KDNE----ALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQL 584
           L FF        KD++    +L+ +A ERL+SIL++L        S      W +  +QL
Sbjct: 495 LGFFQQSELKDVKDSQESFHSLSSIASERLFSILADLLTVEQDTYSV----CWPFIAVQL 550

Query: 585 ILELEKSGNQE-LVNKLDADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQ 643
              L+   NQ+ L+  +D +L  I ++ + VL+ IS    +    Q +GL+LL S+ ILQ
Sbjct: 551 ---LKTDTNQKTLLQSMDEELGDILDSSMTVLSSISQKANEANLSQFQGLQLLFSVNILQ 607

Query: 644 LFSGDTESLSTIEELVEFYSNSKQ-EESTSLVGITEILLSLLAQKKAILRKLSLSVWEHF 702
            ++G+ ES+S +E+LV F +  +   +S  L G  EILLSL AQKKA+ RK SL  WE F
Sbjct: 608 AYAGEVESISVLEDLVSFCNEFEDGAKSAPLAGFIEILLSLAAQKKALSRKSSLLAWESF 667

Query: 703 ISDIGKNELNVLLAVLPVRENKQGFAHLF 731
           ++D+ + +L VLL VLP RENK+GF++LF
Sbjct: 668 VADVTEKDLTVLLNVLPTRENKEGFSNLF 696

 Score =  183 bits (464), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 111/276 (40%), Positives = 152/276 (55%), Gaps = 17/276 (6%)

Query: 787  IANIDKEATSALAKALNLPENIVNEKGEVDLAKLEXXXXXXXXXXXXXXXXXXXXXXXXX 846
            +  IDKEATSALAKALNLP++IV++KGEV                               
Sbjct: 745  MGKIDKEATSALAKALNLPDSIVDDKGEVRFED-----------LGDTDEEEEESEEDLD 793

Query: 847  XXXXXXXXXQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYMKYV 906
                     QLSEIFKRRKEALS I TGN+RK EVKESRENVIAFKHRV+DML I ++++
Sbjct: 794  DEKMMELDGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWI 853

Query: 907  EGLTLTTENGEK--FGNLLLFIEPMIKCVKQTLDKSXXXXXXXXXXXXXXXXXSSNFQIE 964
            E       + EK     +   I P++ C++ TLDK                   S F   
Sbjct: 854  ESKMKKDGHIEKSVLDKVFAIILPLLDCIRTTLDKPLAEKIAKLLKNKICKLKPS-FSST 912

Query: 965  SLNADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESNDKEIAYG 1024
            +   D   V+ LL+  HE++L  KAGQF +LY+S CST S+FL +++  V++  +   Y 
Sbjct: 913  TEKVDKKAVLSLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARLV--VDTFPELETYE 970

Query: 1025 KLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQR 1060
            +L  +Y +T   W ++ GKFG++ F +F NWLS ++
Sbjct: 971  ELTGIYHKTLDGWFVT-GKFGVSMFVEFLNWLSVKK 1005

>KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa]
           {ON} similar to uniprot|P39985 Saccharomyces cerevisiae
           YEL055C
          Length = 1006

 Score =  459 bits (1180), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 302/750 (40%), Positives = 430/750 (57%), Gaps = 73/750 (9%)

Query: 1   MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRN 60
           +A +V+RDLFYKLASDL EERLQ+ + L+ +LS+  V  +  EW YVLNRLIKGL+S RN
Sbjct: 2   VAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSK--VEKESREWEYVLNRLIKGLSSSRN 59

Query: 61  SARLGFSLCLTEAINLALGMGDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKKK 120
            ARLG+ LCLTE +  AL          +S+    D   + L +  +T++ EN      K
Sbjct: 60  GARLGYCLCLTEVVASALE---------KSVLAHAD---EYLRLLLSTLSRENI-----K 102

Query: 121 KGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWIR 180
            G++ERGILFGKLF LQ LLNEPLFS +F +ED+  I+    + YV  L  +   K WIR
Sbjct: 103 NGKEERGILFGKLFGLQVLLNEPLFSQVFKAEDE--INLEFMLTYVGTLIDVALAKTWIR 160

Query: 181 ESCFFTLYQTIEKLLP-YADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRS------A 233
           ES  FTLYQ IEKL P     +  + +LTLLD   LT + EGLA+YL + ++S       
Sbjct: 161 ESSMFTLYQAIEKLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGAL 220

Query: 234 NKKQLEKTLSDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPP 293
            KK L   L D++L NS WK+N+PL++GNLPA+ N L++ N +E           + +  
Sbjct: 221 RKKGL---LEDLKL-NSPWKNNDPLSKGNLPAIANALKEINSSE---------DLSVKQK 267

Query: 294 ANWAPRLHFVWDILLPILXXXXXXXXXNXXXXXXXXXXXXXXXNQDSNEFIRFPEFWQMA 353
             W PRLHFVWDI+L                            +Q     I+FPEFW+  
Sbjct: 268 GIWMPRLHFVWDIILTSFFEGGEYEDKASEPAKKKRKKSSEERHQQ----IKFPEFWKSV 323

Query: 354 IDESFFNEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLL 413
           +DESFFNEK+SSERKYLGFL+F+K   +          T  ++N  R LINQ   ++R L
Sbjct: 324 VDESFFNEKSSSERKYLGFLVFEK---AFSLAPVSYTHTLLSKNLTRCLINQCGSSERNL 380

Query: 414 HKMSQIAIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVXXXXXXXXX 473
           HK+SQ  + TIV VC++ P  K  P  + L    +  GSI+FD+LTKSKT+         
Sbjct: 381 HKVSQRVLTTIVDVCKNQP-EKTAPSFETLALKEH--GSISFDQLTKSKTLNLLLSGKSL 437

Query: 474 XXXTLRQLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPL 533
               L  L ++  + +   ++ ++ + V +F LD +LH+VR+HKS  D    + PLL+ L
Sbjct: 438 TDQQLTLLGEVLTNHL--FTSLRDHSRV-RFLLDAMLHLVRAHKSAAD-KVWLAPLLDSL 493

Query: 534 VKLAFFSKDNE-----------ALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTL 582
           V+  FF  D              +++LA ERLYSIL++L  A    KS      W  +T+
Sbjct: 494 VQQGFFELDENDRQPEVGDETFTVSKLAVERLYSILADLISADY--KSEKVC--WPRFTV 549

Query: 583 QLILELEKSGNQELVNKLDADLETIKNNGLKVLNEI-SMTNTDEMTQQSKGLELLLSMCI 641
           ++++   K    +L+N +D +L  I N+ +K    I S         Q++G +L+ S+ I
Sbjct: 550 EILMS--KLKKNKLLNPMDEELTEILNSSIKTFKTICSEAEKGGKQMQARGFQLIFSVNI 607

Query: 642 LQLFSGDTESLSTIEELVEFYSNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEH 701
           LQ +SG+T+S+  +++L  F+   ++ +S S  G  EILLSL AQKKA+LRK SL VWE 
Sbjct: 608 LQAYSGETDSIPVLQDLNSFHQTLEENKSGSYAGFIEILLSLAAQKKALLRKASLLVWEL 667

Query: 702 FISDIGKNELNVLLAVLPVRENKQGFAHLF 731
           F+ +  ++++ VLL +LP RENK+GF+ LF
Sbjct: 668 FVGEASQDDIAVLLEILPARENKEGFSKLF 697

 Score =  166 bits (420), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 114/279 (40%), Positives = 147/279 (52%), Gaps = 20/279 (7%)

Query: 786  DIANIDKEATSALAKALNLPENIVNEKGEVDLAKLEXXXXXXXXXXXXXXXXXXXXXXXX 845
            D   IDKEATSAL KALNLPE+IVN+ GEV                              
Sbjct: 741  DTEQIDKEATSALVKALNLPESIVNDNGEVHFED------------LEDTEDEEISDEDL 788

Query: 846  XXXXXXXXXXQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYMKY 905
                      QLSEIFKRRKEALS I TGN+RK EVKESRENVIAFKHRV+DML I++++
Sbjct: 789  DDEKMMELDGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVRW 848

Query: 906  VEGLTLTTENGEK--FGNLLLFIEPMIKCVKQTLDKSXXXXXXXXXXXXXXXXXSSNFQI 963
             E         EK     ++  I P+I CV+ TLDK                   +    
Sbjct: 849  AESELKQGGRPEKSVTSKIISIILPLISCVRTTLDKPLAEKVTKLLKNKICKLKITT--D 906

Query: 964  ESLNADDDRVME-LLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESNDKEIA 1022
             SL+  ++ + E  L+  HE++L  K GQF +LY+S CST S+FL K+ VH   + +   
Sbjct: 907  TSLDGLEENLFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFVH--RSPRPET 964

Query: 1023 YGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQRQ 1061
            Y  L ++Y +T   W +  GKF  N F +F NWLS ++Q
Sbjct: 965  YFTLTEVYHKTLNEWFVG-GKFSANLFIEFLNWLSIKKQ 1002

>Kwal_56.22629 s56 complement(211300..212181) [882 bp, 293 aa] {ON}
           YOL093W - Hypothetical ORF [contig 184] FULL
          Length = 293

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 41/94 (43%), Gaps = 1/94 (1%)

Query: 609 NNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDTESLSTIEELVEFYSNSKQE 668
           + G +V  E+       M Q+  G+ ++L  C       D E +S   ++   YS +K+E
Sbjct: 66  DRGEEVPEELRRKPRKNMDQRDSGINIILD-CAFDDLMNDKEVVSLSTQITRAYSYNKRE 124

Query: 669 ESTSLVGITEILLSLLAQKKAILRKLSLSVWEHF 702
              S + +T     L  + +  L+    + W+HF
Sbjct: 125 NHFSNIKVTSFNKRLRTRFEEGLKDAHHTEWKHF 158

>SAKL0G12694g Chr7 (1081452..1084490) [3039 bp, 1012 aa] {ON} some
           similarities with uniprot|Q07798 Saccharomyces
           cerevisiae YLL005C SPO75 Meiosis-specific protein of
           unknown function required for spore wall formation
           during sporulation dispensable for both nuclear
           divisions during meiosis
          Length = 1012

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 38/66 (57%), Gaps = 3/66 (4%)

Query: 199 DIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSA-NKKQLEKTLSDIQLSNSHWKSNNP 257
           D  F+   L +L  + LTL+   + I + I Y S  N  ++++ +  +  S+SHWK NNP
Sbjct: 157 DAFFFLRFLKILGIFFLTLAVINIPILVPIHYTSGYNPDEIQEWVPRMN-SSSHWK-NNP 214

Query: 258 LARGNL 263
           +AR N+
Sbjct: 215 IARNNI 220

>Ecym_2060 Chr2 complement(98095..99525) [1431 bp, 476 aa] {ON}
           similar to Ashbya gossypii ADL150C
          Length = 476

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 1/66 (1%)

Query: 535 KLAFFSKDNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELEKSGNQ 594
           + +  S DN   +++ K+R  ++  EL GAT   +    AH+ H  +L+ + E  +  + 
Sbjct: 383 RSSLSSSDNGGASQVQKQRKENVDIELIGATKW-RRPPPAHTRHVDSLKFVREEREDTDT 441

Query: 595 ELVNKL 600
           ELVN+L
Sbjct: 442 ELVNEL 447

>Suva_10.124 Chr10 complement(226980..230063,230067..230138) [3156
           bp, 1051 aa] {ON} YLR039C (REAL)
          Length = 1051

 Score = 32.3 bits (72), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 45/96 (46%), Gaps = 17/96 (17%)

Query: 632 GLELLLSMCILQLFSGDTESLSTIEELVEFYSNSKQEESTSLV---GITEILLSLLAQKK 688
            LE +LS  ILQ      +SL  I +LV+ Y NS  E+ T +    G+ EI+        
Sbjct: 856 ALEKILSTKILQ-----NDSLDDILKLVKMYDNSDSEQDTPMPNHSGMLEII-------S 903

Query: 689 AILRKLSLSVWEHFISDIGKNELNVLLAVLPVRENK 724
             LRK+    W H  +++     ++L   L + EN+
Sbjct: 904 NCLRKIETKYWNHLFTNLKMTPRDLL--ALCIEENE 937

>TPHA0A03760 Chr1 (821355..824855) [3501 bp, 1166 aa] {ON} Anc_3.330
           YPR049C
          Length = 1166

 Score = 32.3 bits (72), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 56/116 (48%), Gaps = 18/116 (15%)

Query: 512 VVRSHKSEFDY-DSVVEPLLNPLVKLAFFSKDNEALNELAKERLYSILSELTGATSSPKS 570
           +V+  + E DY D +V+P+L+PLV L      NE  N+   +R+ SI++   G  S+   
Sbjct: 133 LVQLKRKERDYFDQLVKPMLSPLVDLNLNYFYNEDSNDSKHQRIVSIIATNLGWLSA--- 189

Query: 571 SNAAHSWHYYTLQLILELEKSGNQELVNKLDA----------DLETIKNNGLKVLN 616
                  +YY  Q ++E   SG Q ++  L            D+ET+ N+ +  LN
Sbjct: 190 --LEIDINYY--QRLIEDNLSGIQNILESLKVSQQYLQIYCYDVETLYNSNVTYLN 241

>Kpol_1018.49 s1018 (156124..157383) [1260 bp, 419 aa] {ON}
           (156124..157383) [1260 nt, 420 aa]
          Length = 419

 Score = 32.0 bits (71), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 79/175 (45%), Gaps = 29/175 (16%)

Query: 73  AINLALGMGDNAPQGVQSIN-------------EFL-DLLSKTLPIDSNTVATENKTALK 118
            I+  +G  DN  +G++ ++             EFL DL+ + L I+   +  ++K  + 
Sbjct: 134 TISYKIGDTDNYGKGIKDLSFIFFHMIFFTFLREFLMDLVIRPLTINKLKITAKHK--VN 191

Query: 119 KKKGRDERGILFG--KLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKK 176
           +   +    I +G    F L  + N  L+  +F + +  +    L+  Y+ +++ LG   
Sbjct: 192 RMMEQVYSIIYYGISSPFGLYIMYNSDLW--LFKTTEMYQTYPDLYNSYLMKIYYLGQAA 249

Query: 177 NWIRESCFFTLYQTIEKLLPYAD---IEFYQLVLTLL--DKYELTLSKEGLAIYL 226
            W +++C   L   +EK  P  D   + F+ +V  LL    Y    +K GL++Y+
Sbjct: 250 FWAQQACILVL--QLEK--PRKDHNELIFHHIVTLLLIWSSYVFHFTKIGLSVYI 300

>TPHA0D00590 Chr4 (103790..110053) [6264 bp, 2087 aa] {ON} Anc_8.69
            YFL007W
          Length = 2087

 Score = 32.3 bits (72), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 30/48 (62%), Gaps = 2/48 (4%)

Query: 417  SQIAIDTIVKVCEDD--PSNKLIPCLDALLFNTNVGGSINFDKLTKSK 462
            S+I +D I+K+CED+  P++K    L   +F++ + GS  FD+ T  K
Sbjct: 1579 SKIELDEILKICEDNYKPTDKASMVLSLEIFSSLIYGSKYFDEETNKK 1626

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 98,151,679
Number of extensions: 4065656
Number of successful extensions: 15357
Number of sequences better than 10.0: 80
Number of HSP's gapped: 15557
Number of HSP's successfully gapped: 119
Length of query: 1063
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 943
Effective length of database: 39,721,479
Effective search space: 37457354697
Effective search space used: 37457354697
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)