Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0K029006.9ON43843822820.0
NCAS0F001906.9ON41143115610.0
TDEL0G046206.9ON39240614330.0
ZYRO0F00462g6.9ON39340413850.0
Suva_5.126.9ON40141113420.0
Skud_5.336.9ON40141113290.0
Kpol_1045.786.9ON39240713160.0
Smik_5.316.9ON42741113171e-180
YEL056W (HAT2)6.9ON40141213121e-180
SAKL0E00814g6.9ON39840712841e-176
KNAG0E009806.9ON41442912751e-174
TPHA0M001906.9ON39140212591e-172
CAGL0B03575g6.9ON41942412611e-172
Ecym_30126.9ON39738812041e-164
KLTH0C11550g6.9ON39838811871e-161
ACR017W6.9ON42338911871e-161
KLLA0D00814g6.9ON40839311731e-159
TBLA0A071206.9ON40741511341e-153
KAFR0L003206.9ON39140211081e-149
Kwal_56.223456.9ON39638910971e-147
TBLA0H036508.548ON4194153853e-41
NDAI0C055108.548ON4194233775e-40
TPHA0L017208.548ON4194213582e-37
Kpol_1024.398.548ON4174153555e-37
Suva_4.4498.548ON4244343522e-36
Smik_2.3358.548ON4224283471e-35
KNAG0A036708.548ON4264293471e-35
CAGL0M05291g8.548ON4194093461e-35
ZYRO0A13068g8.548ON3974063442e-35
YBR195C (MSI1)8.548ON4224183452e-35
KAFR0I008408.548ON4134093424e-35
AEL250C8.548ON4174103408e-35
SAKL0H09900g8.548ON4254293401e-34
KLTH0E12694g8.548ON4184153382e-34
Skud_2.3218.548ON4224143382e-34
Ecym_70428.548ON4144013362e-34
TDEL0B029808.548ON4124093284e-33
KLLA0E23541g8.548ON4174113232e-32
NCAS0B021708.548ON4144223143e-31
Kwal_27.120708.548ON4184073135e-31
TPHA0G026502.401ON5164061918e-15
Skud_4.637.310ON12732261822e-13
KAFR0A003802.401ON5164081802e-13
KNAG0E021802.401ON5174051793e-13
CAGL0K03861g2.401ON5134531774e-13
ZYRO0A08690g2.401ON5164061758e-13
Suva_13.3112.401ON5104051758e-13
YMR131C (RRB1)2.401ON5114041722e-12
Skud_13.2912.401ON5094081712e-12
TDEL0G033402.401ON5144031712e-12
Sklu_YGOB_Anc_2.4012.401ON5204081712e-12
TBLA0B092502.401ON5264051694e-12
Smik_4.457.310ON12702261696e-12
NCAS0G011206.276ON4941791677e-12
Suva_4.537.310ON12712981697e-12
YDL195W (SEC31)7.310ON12732261689e-12
KLTH0E09394g2.401ON5224091642e-11
Suva_16.1598.672ON4512181642e-11
Smik_13.3292.401ON5094041642e-11
KLLA0F17237g2.401ON5234031623e-11
TDEL0C023607.310ON12642701643e-11
TDEL0A061808.672ON4342311613e-11
ADR242C2.401ON5214011623e-11
NDAI0H027502.401ON5124451623e-11
NCAS0E037507.310ON12762201625e-11
NCAS0F019702.401ON5114061596e-11
Kwal_47.178272.401ON5234431571e-10
Kpol_1041.202.401ON5154051552e-10
Kpol_1060.246.276ON4861781543e-10
ADR090W7.310ON12332401544e-10
KAFR0H024508.672ON4172231507e-10
KLLA0E08449g2.283ON4222321508e-10
Kpol_1048.598.544ON8502391519e-10
ZYRO0F07282g8.672ON4272381491e-09
ZYRO0E08184g6.276ON5063571482e-09
SAKL0H06666g8.672ON4412231472e-09
TDEL0A068906.276ON4472241462e-09
YPL151C (PRP46)8.672ON4511681463e-09
AER263C6.340ON5133001463e-09
NDAI0E024008.672ON4342241453e-09
Ecym_60672.401ON5224061453e-09
TBLA0C018408.672ON4232381444e-09
NDAI0F012406.276ON5241761444e-09
ZYRO0G20152g2.431ON3192431416e-09
CAGL0H00781g6.276ON5132021437e-09
YPL247C6.276ON5231801437e-09
AAR078W7.356ON5621821438e-09
Ecym_80617.310ON12282401448e-09
ZYRO0F05808g7.310ON12822081448e-09
Skud_16.1318.672ON4511671428e-09
Kpol_1019.307.310ON12522731439e-09
KAFR0L013207.310ON12402091431e-08
Kwal_56.244787.310ON12962001411e-08
TPHA0D035906.276ON5983441402e-08
TBLA0F041306.340ON5143021392e-08
Smik_6.3488.672ON4511671392e-08
AEL269C7.534ON4552031382e-08
SAKL0F10384g7.310ON12612381393e-08
TBLA0A023106.276ON5311971373e-08
KLLA0F05159g7.310ON12311881383e-08
NDAI0J018504.122ON5751651374e-08
TBLA0F021407.310ON13002071384e-08
KNAG0J016808.672ON3982191355e-08
KLTH0A06754g6.340ON5143001355e-08
SAKL0H15708g8.316ON3682481346e-08
KLLA0A08822g4.122ON5822141356e-08
Ecym_55285.429ON4712051356e-08
Kpol_1036.658.316ON3712821346e-08
TPHA0F007704.122ON6311551357e-08
KLLA0C08547g6.340ON5153001357e-08
SAKL0A02970g6.276ON4152511347e-08
Ecym_21396.276ON4352691347e-08
KLTH0D11132g8.672ON4371821348e-08
NDAI0I003506.340ON5151711331e-07
SAKL0E07766g2.283ON3981441321e-07
ADL186C3.22ON13612091341e-07
Smik_6.4516.276ON5231771321e-07
TBLA0A038908.316ON3622381302e-07
ACR137W8.672ON4252171302e-07
Suva_14.3112.283ON3892131302e-07
CAGL0A00605g4.122ON6401551312e-07
TBLA0B059202.283ON4031791302e-07
KAFR0A064804.122ON5683411312e-07
ZYRO0G10472g4.122ON5601571303e-07
TDEL0F022304.122ON5561551303e-07
KLTH0B03410g5.201ON4772401303e-07
Skud_16.326.276ON5221831303e-07
Kpol_1028.416.340ON5123001303e-07
NCAS0D046106.340ON5152101303e-07
TPHA0G031002.469ON5092191303e-07
TPHA0G016108.672ON4142111293e-07
Skud_14.2982.283ON3892041283e-07
KAFR0F043506.340ON5153001293e-07
NCAS0F018502.431ON3182391274e-07
Kwal_33.151365.201ON4731701284e-07
NCAS0A042702.431ON3182391274e-07
TPHA0C008608.316ON3782981284e-07
Kwal_27.120538.544ON7552361294e-07
KLTH0G12430g8.316ON3672481274e-07
ZYRO0D08206g6.340ON5152511284e-07
NCAS0B035508.316ON3752561274e-07
TPHA0M018306.340ON5153001275e-07
YNL035C2.283ON3892021265e-07
CAGL0D05588g5.201ON4771521275e-07
KLTH0H02134g7.310ON12992391285e-07
KNAG0B028007.310ON13071981286e-07
Kpol_2002.995.201ON4871981276e-07
Suva_16.606.276ON5262231276e-07
AGL234W6.363ON6292571276e-07
Kwal_26.87768.672ON4331721266e-07
Ecym_47177.356ON6031771277e-07
AGL190W8.316ON3702541257e-07
Skud_13.2492.469ON5132181267e-07
KAFR0F010606.276ON5531751267e-07
NCAS0D027305.201ON4752451267e-07
Suva_3.1096.340ON5153001267e-07
TPHA0C033702.283ON4131911258e-07
Skud_3.1456.340ON5153001259e-07
TDEL0F044308.316ON3672541249e-07
Kwal_23.63246.340ON5143001259e-07
KLLA0F15598g5.201ON4782111259e-07
TDEL0A075506.340ON5151741259e-07
TBLA0G014904.122ON7321521261e-06
Kpol_1061.364.122ON5892051251e-06
YMR093W (UTP15)2.469ON5132191251e-06
NCAS0C016808.672ON4312511241e-06
ZYRO0D06556g8.288ON11472591261e-06
YCR072C (RSA4)6.340ON5153001241e-06
Smik_14.2962.283ON3892041241e-06
Smik_13.2772.469ON5132191241e-06
TPHA0G023802.431ON3182521221e-06
NCAS0F033405.429ON4481931231e-06
TPHA0A031007.310ON12653081251e-06
Ecym_25236.363ON6462571232e-06
Skud_12.565.201ON4891681232e-06
Smik_3.1726.340ON5151711232e-06
KNAG0A012303.22ON13212031242e-06
KAFR0E012303.259ON3692211212e-06
YLL011W (SOF1)5.201ON4891681222e-06
TDEL0H003707.534ON4652181213e-06
SAKL0H09988g8.544ON7492371223e-06
SAKL0G12892g5.201ON4761791213e-06
ADL184W3.25ON4492301203e-06
KLLA0E04093g8.316ON3722561204e-06
SAKL0G02398g5.429ON4712041204e-06
AFR199C2.431ON3342491194e-06
Smik_12.525.201ON4891681204e-06
NDAI0C054908.544ON8592291214e-06
Ecym_60982.431ON3182431184e-06
Skud_11.2711.247ON6462761205e-06
NCAS0D047806.363ON6212521205e-06
YGL003C (CDH1)4.122ON5661551195e-06
CAGL0E00561g6.363ON8362211205e-06
KLTH0H01122g7.356ON5791891195e-06
SAKL0E03960g2.431ON3202501185e-06
SAKL0A01276g6.340ON5153001196e-06
SAKL0H22396g4.122ON5552061196e-06
TPHA0E030805.201ON4881541186e-06
TPHA0B005904.309ON5881421196e-06
TDEL0A020702.431ON3192471176e-06
SAKL0F15972g7.534ON470851186e-06
Smik_7.2874.122ON5661551196e-06
KAFR0E039005.429ON4391931187e-06
KNAG0I028406.340ON5191791187e-06
Smik_4.3868.316ON3762541177e-06
Skud_7.2844.122ON5661551188e-06
NDAI0J011808.288ON11341231188e-06
TDEL0E042805.201ON4811781178e-06
NCAS0B036908.288ON11451921188e-06
KAFR0L013907.322ON12062361188e-06
KLLA0E12277g2.431ON3262441169e-06
KAFR0E031808.544ON8142451181e-05
Smik_4.907.322ON12012381181e-05
Ecym_42498.316ON3742451161e-05
KLLA0F11231g8.672ON4341681161e-05
NDAI0H027102.431ON3182421151e-05
YCR084C (TUP1)6.363ON7132231171e-05
Kwal_56.238958.316ON3672501161e-05
CAGL0J03476g6.340ON5173011161e-05
SAKL0A00660g6.363ON6602591171e-05
Smik_3.1836.363ON7092231171e-05
Ecym_70388.544ON8002371171e-05
KLTH0E12606g8.544ON7552381161e-05
Kpol_297.72.431ON3182521151e-05
CAGL0C03608g6.363ON6432441161e-05
KNAG0M017505.201ON4852101161e-05
Skud_3.1566.363ON7132231161e-05
AAL157C5.201ON4791521151e-05
Suva_4.4528.544ON8002241161e-05
KNAG0I010508.288ON11591251161e-05
KLTH0H02772g6.276ON4202551152e-05
KAFR0C047406.363ON6652351162e-05
KLLA0E07085g3.25ON4522291152e-05
TBLA0D040208.288ON11781231162e-05
Kwal_56.246617.356ON5611851152e-05
SAKL0H16390g8.288ON11401401162e-05
Kwal_27.115502.283ON4071811142e-05
Suva_3.1216.363ON7002231152e-05
Skud_4.1097.322ON12012381152e-05
KLLA0F19734g8.288ON1133701152e-05
Suva_4.997.322ON12012381152e-05
KNAG0D007406.276ON5041741142e-05
KNAG0B055504.122ON6171571142e-05
NCAS0J011104.122ON5951671142e-05
KLTH0A00880g7.534ON4711791142e-05
Ecym_33212.283ON4091801132e-05
CAGL0E01485g3.22ON13362041152e-05
KLTH0E08162g4.122ON5561531142e-05
NDAI0B051901.247ON6682581142e-05
AEL246C8.544ON8152371143e-05
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0K02900
         (438 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9     883   0.0  
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...   605   0.0  
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...   556   0.0  
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...   538   0.0  
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)   521   0.0  
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)   516   0.0  
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...   511   0.0  
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)   511   e-180
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...   509   e-180
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...   499   e-176
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...   495   e-174
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...   489   e-172
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...   490   e-172
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...   468   e-164
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...   461   e-161
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...   461   e-161
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...   456   e-159
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...   441   e-153
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...   431   e-149
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...   427   e-147
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...   152   3e-41
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...   149   5e-40
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....   142   2e-37
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...   141   5e-37
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...   140   2e-36
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...   138   1e-35
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...   138   1e-35
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...   137   1e-35
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...   137   2e-35
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...   137   2e-35
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...   136   4e-35
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...   135   8e-35
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...   135   1e-34
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...   134   2e-34
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...   134   2e-34
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...   134   2e-34
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...   130   4e-33
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...   129   2e-32
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...   125   3e-31
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...   125   5e-31
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    78   8e-15
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    75   2e-13
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    74   2e-13
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    74   3e-13
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    73   4e-13
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    72   8e-13
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    72   8e-13
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    71   2e-12
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    70   2e-12
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    70   2e-12
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    70   2e-12
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    70   4e-12
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    70   6e-12
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    69   7e-12
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    70   7e-12
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    69   9e-12
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    68   2e-11
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    68   2e-11
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    68   2e-11
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    67   3e-11
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    68   3e-11
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    67   3e-11
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    67   3e-11
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    67   3e-11
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    67   5e-11
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    66   6e-11
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    65   1e-10
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    64   2e-10
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    64   3e-10
ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic h...    64   4e-10
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    62   7e-10
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    62   8e-10
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    63   9e-10
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    62   1e-09
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    62   2e-09
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    61   2e-09
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    61   2e-09
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    61   3e-09
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    61   3e-09
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     60   3e-09
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    60   3e-09
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    60   4e-09
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    60   4e-09
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    59   6e-09
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    60   7e-09
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    60   7e-09
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    60   8e-09
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    60   8e-09
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    60   8e-09
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    59   8e-09
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    60   9e-09
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    60   1e-08
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    59   1e-08
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    59   2e-08
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    58   2e-08
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    58   2e-08
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    58   2e-08
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    58   3e-08
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    57   3e-08
KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} simil...    58   3e-08
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    57   4e-08
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    58   4e-08
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    57   5e-08
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    57   5e-08
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    56   6e-08
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    57   6e-08
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    57   6e-08
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    56   6e-08
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    57   7e-08
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    57   7e-08
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    56   7e-08
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    56   7e-08
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    56   8e-08
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       56   1e-07
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...    55   1e-07
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    56   1e-07
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    55   1e-07
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    55   2e-07
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    55   2e-07
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...    55   2e-07
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    55   2e-07
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    55   2e-07
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    55   2e-07
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    55   3e-07
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    55   3e-07
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    55   3e-07
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    55   3e-07
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    55   3e-07
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     55   3e-07
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    55   3e-07
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    54   3e-07
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...    54   3e-07
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    54   3e-07
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    54   4e-07
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    54   4e-07
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    54   4e-07
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    54   4e-07
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    54   4e-07
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    54   4e-07
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    54   4e-07
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    54   4e-07
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    54   5e-07
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...    53   5e-07
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    54   5e-07
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    54   5e-07
KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7....    54   6e-07
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    54   6e-07
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    54   6e-07
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    54   6e-07
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    53   6e-07
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    54   7e-07
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    53   7e-07
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    53   7e-07
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    53   7e-07
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     53   7e-07
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    53   7e-07
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...    53   8e-07
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    53   9e-07
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    52   9e-07
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    53   9e-07
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    53   9e-07
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    53   9e-07
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    53   1e-06
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    53   1e-06
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    53   1e-06
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     52   1e-06
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    53   1e-06
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    52   1e-06
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...    52   1e-06
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    52   1e-06
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    52   1e-06
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    52   1e-06
TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7....    53   1e-06
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    52   2e-06
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    52   2e-06
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    52   2e-06
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    52   2e-06
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    51   2e-06
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    52   2e-06
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    51   3e-06
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    52   3e-06
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    51   3e-06
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    51   3e-06
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    51   4e-06
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    51   4e-06
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    50   4e-06
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    51   4e-06
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             51   4e-06
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    50   4e-06
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    51   5e-06
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     51   5e-06
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    50   5e-06
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    51   5e-06
KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} simila...    50   5e-06
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    50   5e-06
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    50   6e-06
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    50   6e-06
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    50   6e-06
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    50   6e-06
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    50   6e-06
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    50   6e-06
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    50   6e-06
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    50   7e-06
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    50   7e-06
Smik_4.386 Chr4 complement(701174..702304) [1131 bp, 376 aa] {ON...    50   7e-06
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    50   8e-06
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    50   8e-06
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    50   8e-06
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    50   8e-06
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    50   8e-06
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    49   9e-06
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    50   1e-05
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    50   1e-05
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    49   1e-05
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    49   1e-05
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    49   1e-05
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    50   1e-05
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    49   1e-05
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    49   1e-05
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    50   1e-05
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    50   1e-05
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    50   1e-05
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    49   1e-05
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    49   1e-05
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    49   1e-05
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    49   1e-05
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    49   1e-05
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    49   1e-05
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    49   1e-05
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    49   1e-05
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    49   2e-05
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    49   2e-05
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    49   2e-05
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    49   2e-05
Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]...    49   2e-05
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    49   2e-05
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    49   2e-05
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    49   2e-05
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    49   2e-05
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    49   2e-05
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    49   2e-05
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    49   2e-05
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    49   2e-05
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              49   2e-05
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    49   2e-05
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...    48   2e-05
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    49   2e-05
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    49   2e-05
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    49   2e-05
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    49   3e-05
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    48   3e-05
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    48   3e-05
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    48   3e-05
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    49   3e-05
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    47   3e-05
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    48   3e-05
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    47   3e-05
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    47   3e-05
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    47   3e-05
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    47   3e-05
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    48   3e-05
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    48   4e-05
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    47   4e-05
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    47   4e-05
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               47   4e-05
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    48   4e-05
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    47   4e-05
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    48   4e-05
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    47   4e-05
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    48   4e-05
CAGL0M02563g Chr13 complement(295156..296529) [1374 bp, 457 aa] ...    47   5e-05
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    48   5e-05
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    47   5e-05
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    48   5e-05
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    47   5e-05
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    47   5e-05
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    47   6e-05
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    47   6e-05
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    47   6e-05
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    47   6e-05
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    47   6e-05
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    47   6e-05
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    47   6e-05
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    47   7e-05
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    47   7e-05
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    47   7e-05
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    47   7e-05
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    47   7e-05
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    47   8e-05
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    46   8e-05
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    47   8e-05
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    47   8e-05
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    47   8e-05
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    47   8e-05
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    47   8e-05
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    47   9e-05
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    47   1e-04
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    47   1e-04
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    46   1e-04
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    47   1e-04
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    47   1e-04
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    47   1e-04
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    47   1e-04
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    46   1e-04
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    46   1e-04
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    47   1e-04
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    46   1e-04
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    47   1e-04
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    46   1e-04
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    46   1e-04
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    46   1e-04
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    47   1e-04
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    46   1e-04
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    46   1e-04
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    46   1e-04
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    46   1e-04
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    46   1e-04
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    46   1e-04
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    46   1e-04
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    46   1e-04
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    46   2e-04
Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa...    46   2e-04
YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}  ...    45   2e-04
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    46   2e-04
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...    45   2e-04
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    46   2e-04
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    46   2e-04
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    45   2e-04
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    46   2e-04
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    45   2e-04
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    45   2e-04
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    46   2e-04
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    45   2e-04
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    46   2e-04
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    45   2e-04
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    45   2e-04
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    45   2e-04
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    45   2e-04
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    45   2e-04
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    45   3e-04
CAGL0I03542g Chr9 (299881..301485) [1605 bp, 534 aa] {ON} simila...    45   3e-04
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    45   3e-04
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...    45   3e-04
Ecym_4649 Chr4 (1264219..1265784) [1566 bp, 521 aa] {ON} similar...    45   3e-04
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    45   3e-04
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    45   3e-04
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    45   3e-04
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    45   3e-04
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    45   3e-04
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    44   4e-04
NCAS0A00740 Chr1 (143564..144946) [1383 bp, 460 aa] {ON} Anc_1.1...    45   4e-04
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    45   4e-04
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...    44   4e-04
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    45   4e-04
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    44   4e-04
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...    45   4e-04
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    45   4e-04
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    45   4e-04
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    44   5e-04
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    44   5e-04
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    44   5e-04
ACR194C Chr3 complement(690186..691727) [1542 bp, 513 aa] {ON} S...    44   5e-04
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...    44   5e-04
KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {O...    44   5e-04
ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} simila...    44   6e-04
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    44   6e-04
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    44   6e-04
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    44   6e-04
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    44   6e-04
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    44   6e-04
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    44   6e-04
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    44   6e-04
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    44   6e-04
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    44   7e-04
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    44   7e-04
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    44   7e-04
CAGL0F07337g Chr6 complement(714870..716735) [1866 bp, 621 aa] {...    44   7e-04
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    44   7e-04
NCAS0H00700 Chr8 (125259..126152) [894 bp, 297 aa] {ON} Anc_7.33...    43   7e-04
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    44   8e-04
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      44   8e-04
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    44   8e-04
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    44   8e-04
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    44   8e-04
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    44   8e-04
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    44   8e-04
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    44   8e-04
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    44   8e-04
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    44   8e-04
Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON...    43   8e-04
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    44   8e-04
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    44   8e-04
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    44   9e-04
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    44   0.001
Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782...    44   0.001
Kwal_33.15475 s33 complement(1123396..1125747) [2352 bp, 783 aa]...    44   0.001
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    44   0.001
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    43   0.001
CAGL0J08998g Chr10 (884779..888624) [3846 bp, 1281 aa] {ON} high...    44   0.001
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    43   0.001
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...    43   0.001
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    43   0.001
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    43   0.001
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    43   0.001
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    43   0.001
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    43   0.001
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    43   0.001
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    43   0.001
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    43   0.001
NDAI0D00630 Chr4 (139065..139967) [903 bp, 300 aa] {ON} Anc_7.33...    42   0.001
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    43   0.001
Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W ...    43   0.001
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    43   0.001
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    43   0.001
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    43   0.001
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...    42   0.001
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    43   0.002
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    43   0.002
Smik_12.266 Chr12 (506562..507455) [894 bp, 297 aa] {ON} YLR208W...    42   0.002
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    43   0.002
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    43   0.002
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    43   0.002
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...    43   0.002
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    43   0.002
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    42   0.002
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    42   0.002
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    43   0.002
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    42   0.002
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    42   0.002
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       43   0.002
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    42   0.002
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    42   0.002
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    42   0.002
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    42   0.002
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    42   0.002
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    42   0.002
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    42   0.002
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    42   0.002
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    42   0.002
Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to A...    42   0.002
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    42   0.002
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    42   0.002
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    42   0.002
YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}  SEC13Struc...    42   0.002
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    42   0.002
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    42   0.002
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    42   0.002
NCAS0B01440 Chr2 (236104..237390) [1287 bp, 428 aa] {ON}               42   0.002
KNAG0B02670 Chr2 (517131..518042) [912 bp, 303 aa] {ON} Anc_7.33...    42   0.003
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    42   0.003
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283     42   0.003
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    42   0.003
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    42   0.003
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    41   0.003
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    42   0.003
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    42   0.003
Skud_12.272 Chr12 (506157..507050) [894 bp, 297 aa] {ON} YLR208W...    41   0.003
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    42   0.003
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    42   0.004
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    42   0.004
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    41   0.004
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    42   0.004
TDEL0C02080 Chr3 (360056..360940) [885 bp, 294 aa] {ON} Anc_7.33...    41   0.004
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    41   0.004
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    41   0.004
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    42   0.004
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    41   0.004
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    42   0.004
CAGL0I03454g Chr9 (292823..293734) [912 bp, 303 aa] {ON} similar...    41   0.004
TPHA0E03760 Chr5 complement(791726..794116) [2391 bp, 796 aa] {O...    42   0.004
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    42   0.004
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    41   0.004
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    41   0.004
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    41   0.005
Kpol_526.37 s526 complement(88726..89769) [1044 bp, 347 aa] {ON}...    41   0.005
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    41   0.005
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    41   0.005
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    41   0.005
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    41   0.005
KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} simila...    41   0.005
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    41   0.005
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    41   0.005
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    41   0.005
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    41   0.005
CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 a...    41   0.005
KAFR0L01440 Chr12 complement(266463..267377) [915 bp, 304 aa] {O...    40   0.006
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    41   0.006
KLTH0H01628g Chr8 (144953..146488) [1536 bp, 511 aa] {ON} simila...    41   0.006
Suva_10.302 Chr10 (532343..533236) [894 bp, 297 aa] {ON} YLR208W...    40   0.006
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    40   0.006
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    41   0.006
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    41   0.006
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    41   0.007
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    41   0.007
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    40   0.007
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    41   0.007
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    40   0.007
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...    41   0.007
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    40   0.008
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    41   0.008
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    40   0.008
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    40   0.008
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      40   0.008
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    40   0.009
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    40   0.009
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...    40   0.009
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    40   0.010
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    40   0.010
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    40   0.010
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    40   0.010
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    40   0.010
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    40   0.010
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    40   0.010
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    40   0.010
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    40   0.011
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    40   0.011
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...    40   0.011
Smik_2.112 Chr2 (202544..205069) [2526 bp, 841 aa] {ON} YBL008W ...    40   0.011
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    40   0.011
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    40   0.012
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    40   0.012
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    40   0.012
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    40   0.012
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    40   0.013
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    40   0.013
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    40   0.013
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    40   0.013
KLLA0C16643g Chr3 complement(1457590..1458498) [909 bp, 302 aa] ...    39   0.013
Suva_13.325 Chr13 complement(536805..537848) [1044 bp, 347 aa] {...    39   0.013
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    40   0.014
Suva_3.173 Chr3 (262525..262587,262614..264791) [2241 bp, 746 aa...    40   0.015
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    40   0.015
TBLA0D01190 Chr4 complement(301525..302820) [1296 bp, 431 aa] {O...    39   0.015
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    40   0.015
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    40   0.015
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    40   0.016
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    39   0.016
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    39   0.016
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    39   0.017
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    40   0.017
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    40   0.017
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    39   0.018
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    39   0.018
KAFR0B04210 Chr2 (874621..875803,875906..876507) [1785 bp, 594 a...    39   0.018
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    39   0.018
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    39   0.018
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    39   0.019
ZYRO0F11374g Chr6 complement(934451..935983) [1533 bp, 510 aa] {...    39   0.019
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    39   0.019
CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly...    39   0.020
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    39   0.020
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    39   0.020
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    39   0.020
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    39   0.020
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    39   0.020
Suva_2.117 Chr2 (203652..206174) [2523 bp, 840 aa] {ON} YBL008W ...    39   0.021
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    39   0.021
YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subuni...    39   0.023
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    39   0.023
Smik_4.518 Chr4 complement(935380..936372) [993 bp, 330 aa] {ON}...    39   0.023
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    39   0.023
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    39   0.024
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    39   0.025
Kpol_2002.33 s2002 (67641..69998) [2358 bp, 785 aa] {ON} (67641....    39   0.026
Kpol_530.43 s530 (97335..98945) [1611 bp, 536 aa] {ON} (97335..9...    39   0.026
TDEL0D03660 Chr4 (671946..673298) [1353 bp, 450 aa] {ON} Anc_3.2...    39   0.026
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    39   0.027
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    39   0.027
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    39   0.027
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     39   0.027
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    38   0.027
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    39   0.029
TPHA0G01740 Chr7 complement(357600..358946) [1347 bp, 448 aa] {O...    39   0.029
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    39   0.029
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    39   0.030
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...    39   0.030
KLTH0E08096g Chr5 complement(743809..745041) [1233 bp, 410 aa] {...    39   0.030
YGR200C Chr7 complement(899904..902270) [2367 bp, 788 aa] {ON}  ...    39   0.030
TDEL0E00950 Chr5 (197384..200206) [2823 bp, 940 aa] {ON} Anc_4.2...    39   0.031
KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa] ...    38   0.031
Skud_3.23 Chr3 (40457..42805) [2349 bp, 782 aa] {ON} YCL039W (REAL)    39   0.031
Kwal_33.13148 s33 (94593..96614) [2022 bp, 673 aa] {ON} YCL039W ...    39   0.031
Kpol_1032.61 s1032 (141357..143825) [2469 bp, 822 aa] {ON} (1413...    39   0.032
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    38   0.032
TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}...    39   0.035
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    39   0.035
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    38   0.035
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    39   0.035
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    39   0.036
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    38   0.036
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...    39   0.036
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    39   0.037
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    39   0.037
Suva_2.435 Chr2 complement(769135..770127) [993 bp, 330 aa] {ON}...    38   0.037
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...    39   0.038
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    38   0.039
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    38   0.039
CAGL0L06952g Chr12 complement(782790..783833) [1044 bp, 347 aa] ...    38   0.039
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     38   0.040
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    38   0.040
Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON...    38   0.040
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    38   0.041
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    38   0.041
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    38   0.042
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    38   0.043
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    38   0.043
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    38   0.043
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    38   0.044
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    38   0.044
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    38   0.045
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    38   0.045
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    38   0.045
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...    38   0.045
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    38   0.045
ADL135C Chr4 complement(454163..454761,454819..456085) [1866 bp,...    38   0.047
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    38   0.047
NDAI0E01320 Chr5 complement(262712..263995) [1284 bp, 427 aa] {O...    38   0.048
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    38   0.048
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    38   0.048
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    38   0.050
NCAS0A04400 Chr1 (888188..890743) [2556 bp, 851 aa] {ON} Anc_2.4...    38   0.050
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    38   0.050
TDEL0A01730 Chr1 complement(310640..312433) [1794 bp, 597 aa] {O...    38   0.050
CAGL0J08778g Chr10 (868299..869195) [897 bp, 298 aa] {ON} highly...    37   0.052
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    38   0.053
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    37   0.053
KNAG0A03070 Chr1 complement(378279..379604) [1326 bp, 441 aa] {O...    38   0.054
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    38   0.055
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      38   0.056
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    38   0.056
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    38   0.058
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    38   0.058
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    38   0.058
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    38   0.059
Smik_12.495 Chr12 complement(873068..875887) [2820 bp, 939 aa] {...    38   0.061
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    38   0.061
KAFR0A04550 Chr1 complement(901244..903100) [1857 bp, 618 aa] {O...    38   0.064
Smik_3.37 Chr3 (53956..56256) [2301 bp, 766 aa] {ON} YCL039W (REAL)    38   0.065
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    37   0.065
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...    38   0.068
ZYRO0C14564g Chr3 (1135755..1137491) [1737 bp, 578 aa] {ON} simi...    37   0.068
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    38   0.068
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    37   0.068
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    37   0.068
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    37   0.069
Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200...    37   0.070
Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON} (90456..91...    37   0.070
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    38   0.071
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    37   0.071
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    37   0.071
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    37   0.071
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    37   0.072
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    37   0.072
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    38   0.072
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    37   0.073
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...    37   0.074
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    37   0.076
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    37   0.077
Skud_2.103 Chr2 (193155..195677) [2523 bp, 840 aa] {ON} YBL008W ...    37   0.077
TBLA0C02090 Chr3 complement(495831..498683) [2853 bp, 950 aa] {O...    37   0.079
TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON...    37   0.079
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    37   0.080
CAGL0K12188g Chr11 (1192017..1193624) [1608 bp, 535 aa] {ON} sim...    37   0.080
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    37   0.082
Smik_13.344 Chr13 complement(540043..541086) [1044 bp, 347 aa] {...    37   0.084
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    37   0.084
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    37   0.084
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    37   0.088
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    37   0.089
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    37   0.090
TPHA0I00460 Chr9 (89882..91564) [1683 bp, 560 aa] {ON} Anc_8.817...    37   0.091
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    37   0.094
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      37   0.10 
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    37   0.10 
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...    37   0.10 
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    37   0.11 
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    37   0.11 
TDEL0F02260 Chr6 (414020..415309) [1290 bp, 429 aa] {ON} Anc_4.1...    37   0.11 
KNAG0B05540 Chr2 (1079174..1080511) [1338 bp, 445 aa] {ON} Anc_4...    37   0.12 
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    37   0.12 
NCAS0C01570 Chr3 (289762..291063) [1302 bp, 433 aa] {ON}               37   0.12 
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    37   0.12 
KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly ...    36   0.13 
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    37   0.13 
Suva_14.89 Chr14 (164766..166034) [1269 bp, 422 aa] {ON} YNL253W...    36   0.14 
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     37   0.14 
CAGL0J03960g Chr10 complement(375780..377087) [1308 bp, 435 aa] ...    36   0.14 
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     37   0.14 
TBLA0G03080 Chr7 complement(817595..818923) [1329 bp, 442 aa] {O...    36   0.14 
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    36   0.15 
YCL039W Chr3 (52645..54882) [2238 bp, 745 aa] {ON}  GID7Protein ...    37   0.15 
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    36   0.15 
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    36   0.15 
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    37   0.15 
NCAS0B01430 Chr2 (233965..235317) [1353 bp, 450 aa] {ON}               36   0.16 
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    37   0.16 
Kwal_14.1675 s14 (419094..420215) [1122 bp, 373 aa] {ON} YBR234C...    36   0.16 
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    36   0.16 
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    36   0.17 
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    36   0.17 
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    36   0.17 
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    36   0.17 
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    36   0.17 
YMR146C Chr13 complement(557481..558524) [1044 bp, 347 aa] {ON} ...    36   0.17 
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    36   0.17 
NCAS0F00640 Chr6 complement(123774..124396,124484..125543) [1683...    36   0.18 
TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {...    36   0.18 
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    36   0.18 
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    36   0.18 
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    36   0.18 
YDR267C Chr4 complement(1002510..1003502) [993 bp, 330 aa] {ON} ...    36   0.19 
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       36   0.19 
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    36   0.19 
Skud_13.307 Chr13 complement(530776..531819) [1044 bp, 347 aa] {...    36   0.19 
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    36   0.19 
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...    36   0.19 
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    36   0.19 
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    36   0.20 
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    36   0.20 
YBR281C Chr2 complement(764970..767606) [2637 bp, 878 aa] {ON}  ...    36   0.21 
Smik_15.414 Chr15 (720454..721767) [1314 bp, 437 aa] {ON} YOR230...    36   0.21 
Smik_2.377 Chr2 complement(671569..672723) [1155 bp, 384 aa] {ON...    36   0.22 
TPHA0D01130 Chr4 (236199..237554) [1356 bp, 451 aa] {ON} Anc_8.6...    36   0.22 
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    36   0.22 
Ecym_7373 Chr7 complement(776909..779269) [2361 bp, 786 aa] {ON}...    36   0.23 
SAKL0F11022g Chr6 (863614..864504) [891 bp, 296 aa] {ON} highly ...    35   0.24 
KAFR0H00750 Chr8 (140330..141574) [1245 bp, 414 aa] {ON} Anc_3.3...    35   0.24 
Ecym_6167 Chr6 complement(309181..310437) [1257 bp, 418 aa] {ON}...    35   0.24 
YOR229W Chr15 (768409..769812) [1404 bp, 467 aa] {ON}  WTM2Trans...    35   0.24 
YBR234C Chr2 complement(685438..686592) [1155 bp, 384 aa] {ON}  ...    35   0.25 
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    36   0.25 
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    35   0.25 
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    35   0.26 
NDAI0E01330 Chr5 complement(266071..267363) [1293 bp, 430 aa] {O...    35   0.26 
KLTH0C06358g Chr3 (556638..557741) [1104 bp, 367 aa] {ON} highly...    35   0.26 
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    36   0.27 
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    36   0.27 
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...    36   0.27 
ZYRO0C09724g Chr3 (738113..739588) [1476 bp, 491 aa] {ON} simila...    35   0.27 
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    35   0.27 
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    35   0.28 
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     35   0.28 
NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4....    35   0.29 
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    35   0.29 
AER337W Chr5 (1256750..1258087) [1338 bp, 445 aa] {ON} Syntenic ...    35   0.30 
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    35   0.31 
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    35   0.32 
Suva_4.491 Chr4 complement(855726..856880) [1155 bp, 384 aa] {ON...    35   0.32 
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    35   0.33 
Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008...    35   0.34 
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    35   0.35 
KAFR0D01700 Chr4 complement(339178..340785) [1608 bp, 535 aa] {O...    35   0.35 
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...    35   0.36 
Smik_14.148 Chr14 complement(275170..276837) [1668 bp, 555 aa] {...    35   0.36 
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    35   0.36 
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    35   0.38 
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    35   0.39 
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    35   0.39 
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    35   0.39 
Suva_13.43 Chr13 (68221..68556,68574..69404) [1167 bp, 388 aa] {...    35   0.39 
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...    35   0.42 
Smik_15.413 Chr15 (718053..719462) [1410 bp, 469 aa] {ON} YOR229...    35   0.42 
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    35   0.43 
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    35   0.43 
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    35   0.44 
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    35   0.45 
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    35   0.46 
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    35   0.47 
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    35   0.47 
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    35   0.47 
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    35   0.47 
KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {...    35   0.50 
NDAI0F03380 Chr6 (813767..815455) [1689 bp, 562 aa] {ON} Anc_2.7...    35   0.51 
NCAS0B07540 Chr2 complement(1422115..1424745) [2631 bp, 876 aa] ...    35   0.53 
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    35   0.53 
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    35   0.53 
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...    35   0.54 
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    35   0.54 
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    35   0.54 
KLLA0B02827g Chr2 (254447..257275) [2829 bp, 942 aa] {ON} highly...    35   0.57 
CAGL0K11836g Chr11 complement(1143042..1144610) [1569 bp, 522 aa...    34   0.57 
TBLA0A05690 Chr1 (1412275..1413546) [1272 bp, 423 aa] {ON} Anc_1...    34   0.57 
Kpol_1055.64 s1055 (170524..173340) [2817 bp, 938 aa] {ON} (1705...    35   0.58 
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    35   0.58 
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    35   0.58 
Suva_8.280 Chr8 (507390..508796) [1407 bp, 468 aa] {ON} YOR229W ...    34   0.58 
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    34   0.62 
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    34   0.63 
SAKL0G01628g Chr7 complement(133626..136505) [2880 bp, 959 aa] {...    34   0.64 
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    34   0.65 
NDAI0J01840 Chr10 (459174..460466) [1293 bp, 430 aa] {ON} Anc_4....    34   0.66 
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    34   0.67 
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    34   0.73 
Skud_4.530 Chr4 complement(945231..946247) [1017 bp, 338 aa] {ON...    34   0.75 
NCAS0J01650 Chr10 complement(294247..297069) [2823 bp, 940 aa] {...    34   0.76 
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    34   0.76 
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    34   0.77 
KLTH0C04378g Chr3 (381355..382860) [1506 bp, 501 aa] {ON} simila...    34   0.79 
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    34   0.80 
ACR116W Chr3 (555946..557307) [1362 bp, 453 aa] {ON} Syntenic ho...    34   0.80 
Kwal_56.23207 s56 (446947..449748) [2802 bp, 933 aa] {ON} YOL087...    34   0.82 
ZYRO0C15994g Chr3 (1255015..1256529) [1515 bp, 504 aa] {ON} simi...    34   0.83 
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    34   0.84 
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    34   0.85 
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    34   0.85 
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    33   0.85 
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    33   0.85 
ACL099W Chr3 (165316..166389) [1074 bp, 357 aa] {ON} Syntenic ho...    34   0.86 
KNAG0E02020 Chr5 (416909..417949) [1041 bp, 346 aa] {ON} Anc_2.3...    33   0.86 
Skud_14.152 Chr14 complement(286929..288704) [1776 bp, 591 aa] {...    34   0.87 
KLTH0C00748g Chr3 (72171..73157) [987 bp, 328 aa] {ON} highly si...    33   0.88 
YOR230W Chr15 (770800..772113) [1314 bp, 437 aa] {ON}  WTM1Trans...    34   0.89 
Kwal_23.4118 s23 (579251..582070) [2820 bp, 939 aa] {ON} YLR409C...    34   0.91 
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    34   0.92 
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...    34   0.93 
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    34   0.93 
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    33   0.96 
KLTH0H05038g Chr8 complement(449230..452217) [2988 bp, 995 aa] {...    34   0.97 
TBLA0I00360 Chr9 (56206..57300) [1095 bp, 364 aa] {ON} Anc_7.405...    33   1.0  
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    33   1.0  
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    33   1.1  
ZYRO0D00616g Chr4 complement(47163..48347) [1185 bp, 394 aa] {ON...    33   1.1  
Suva_2.181 Chr2 complement(312873..314396) [1524 bp, 507 aa] {ON...    33   1.1  
KNAG0C00410 Chr3 (69301..71367) [2067 bp, 688 aa] {ON} Anc_1.34 ...    33   1.1  
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    33   1.1  
KAFR0G01890 Chr7 (400922..402274) [1353 bp, 450 aa] {ON}               33   1.1  
Suva_14.159 Chr14 complement(292113..293789) [1677 bp, 558 aa] {...    33   1.2  
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    33   1.2  
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    33   1.2  
CAGL0J03806g Chr10 (363777..365039) [1263 bp, 420 aa] {ON} simil...    33   1.2  
TBLA0I00920 Chr9 complement(174544..177504) [2961 bp, 986 aa] {O...    33   1.2  
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    33   1.2  
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    33   1.3  
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    33   1.3  
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      33   1.3  
Kwal_27.10385 s27 (317980..319590) [1611 bp, 536 aa] {ON} YML102...    33   1.3  
TDEL0C06690 Chr3 complement(1221419..1223716) [2298 bp, 765 aa] ...    33   1.3  
Suva_8.281 Chr8 (509873..511183) [1311 bp, 436 aa] {ON} YOR230W ...    33   1.3  
YOR038C Chr15 complement(402761..405388) [2628 bp, 875 aa] {ON} ...    33   1.3  
Skud_15.203 Chr15 complement(362659..365292) [2634 bp, 877 aa] {...    33   1.4  
Kwal_27.11126 s27 (651113..654103) [2991 bp, 996 aa] {ON} YPL183...    33   1.4  
TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.4...    33   1.4  
ZYRO0C03190g Chr3 (245542..249363) [3822 bp, 1273 aa] {ON} simil...    33   1.4  
Ecym_5498 Chr5 (1016519..1019092) [2574 bp, 857 aa] {ON} similar...    33   1.4  
KLTH0F01166g Chr6 (90708..92939) [2232 bp, 743 aa] {ON} similar ...    33   1.5  
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    33   1.5  
TPHA0L02130 Chr12 complement(441224..445750) [4527 bp, 1508 aa] ...    33   1.5  
NCAS0A04540 Chr1 (910773..912539) [1767 bp, 588 aa] {ON} Anc_6.3...    33   1.5  
NDAI0A07070 Chr1 complement(1610054..1612360) [2307 bp, 768 aa] ...    33   1.5  
Ecym_3389 Chr3 (736712..737695) [984 bp, 327 aa] {ON} similar to...    33   1.5  
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    33   1.6  
NDAI0A01560 Chr1 (352038..353129) [1092 bp, 363 aa] {ON} Anc_5.6...    33   1.6  
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    33   1.6  
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    33   1.6  
ZYRO0G10494g Chr7 complement(846835..848133) [1299 bp, 432 aa] {...    33   1.6  
Smik_15.217 Chr15 complement(368813..371440) [2628 bp, 875 aa] {...    33   1.7  
Ecym_5584 Chr5 complement(1199282..1200238) [957 bp, 318 aa] {ON...    33   1.7  
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    33   1.7  
KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]...    33   1.7  
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    33   1.7  
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    33   1.7  
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    33   1.8  
Kpol_1025.38 s1025 (90229..90465,90467..91492) [1263 bp, 420 aa]...    33   1.8  
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    33   1.8  
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    32   1.8  
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    33   1.9  
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    33   1.9  
Skud_15.395 Chr15 (707395..708789) [1395 bp, 464 aa] {ON} YOR229...    33   1.9  
Ecym_1039 Chr1 (72890..75073) [2184 bp, 727 aa] {ON} similar to ...    33   2.0  
Smik_2.423 Chr2 complement(750642..753278) [2637 bp, 878 aa] {ON...    33   2.0  
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    33   2.0  
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    33   2.1  
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    33   2.1  
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    33   2.2  
Skud_2.412 Chr2 complement(733900..736536) [2637 bp, 878 aa] {ON...    33   2.2  
Skud_13.39 Chr13 (67722..69146) [1425 bp, 474 aa] {ON} YML102W (...    32   2.2  
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    33   2.2  
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...    33   2.2  
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    33   2.3  
TDEL0C02130 Chr3 (366855..368435) [1581 bp, 526 aa] {ON} Anc_7.3...    33   2.3  
SAKL0G19536g Chr7 complement(1683650..1684636) [987 bp, 328 aa] ...    32   2.3  
Suva_8.91 Chr8 complement(165427..168063) [2637 bp, 878 aa] {ON}...    33   2.4  
CAGL0C02937g Chr3 (290289..291692) [1404 bp, 467 aa] {ON} simila...    32   2.4  
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    32   2.4  
TBLA0A01480 Chr1 (344851..346026) [1176 bp, 391 aa] {ON} Anc_6.1...    32   2.5  
Smik_13.32 Chr13 (64435..65841) [1407 bp, 468 aa] {ON} YML102W (...    32   2.5  
YER107C Chr5 complement(373448..374545) [1098 bp, 365 aa] {ON}  ...    32   2.5  
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    32   2.5  
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    32   2.5  
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    32   2.6  
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    32   2.6  
TDEL0A05970 Chr1 (1047306..1048733) [1428 bp, 475 aa] {ON} Anc_8...    32   2.6  
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    32   2.6  
ZYRO0G20988g Chr7 complement(1723533..1726193) [2661 bp, 886 aa]...    32   2.7  
ZYRO0B04444g Chr2 complement(363742..365469) [1728 bp, 575 aa] {...    32   2.7  
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    32   2.7  
Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa] ...    32   2.7  
TDEL0C04860 Chr3 (881043..882584) [1542 bp, 513 aa] {ON} Anc_3.3...    32   2.9  
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    32   2.9  
Kpol_1044.27 s1044 complement(63632..65197) [1566 bp, 521 aa] {O...    32   3.0  
YNL182C Chr14 complement(295960..297627) [1668 bp, 555 aa] {ON} ...    32   3.0  
SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [132...    32   3.0  
TPHA0B02080 Chr2 (477775..480600) [2826 bp, 941 aa] {ON} Anc_4.2...    32   3.0  
ZYRO0B05984g Chr2 (483249..486374) [3126 bp, 1041 aa] {ON} simil...    32   3.0  
NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa] ...    32   3.0  
KAFR0A07550 Chr1 (1523221..1524804) [1584 bp, 527 aa] {ON} Anc_2...    32   3.2  
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    32   3.2  
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    32   3.2  
NDAI0A05790 Chr1 (1315884..1317374) [1491 bp, 496 aa] {ON}             32   3.2  
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    32   3.2  
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    32   3.3  
TPHA0C00320 Chr3 (53120..54184) [1065 bp, 354 aa] {ON} Anc_5.631...    32   3.3  
NCAS0A07850 Chr1 complement(1561758..1563596) [1839 bp, 612 aa] ...    32   3.3  
KLTH0F16764g Chr6 complement(1358483..1359478) [996 bp, 331 aa] ...    32   3.3  
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    32   3.5  
Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196...    32   3.6  
ZYRO0D00748g Chr4 (56274..57251) [978 bp, 325 aa] {ON} highly si...    32   3.6  
KLTH0D14960g Chr4 complement(1223765..1226584) [2820 bp, 939 aa]...    32   3.6  
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    32   3.7  
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    32   3.7  
Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196...    32   3.8  
Skud_2.366 Chr2 complement(654186..655340) [1155 bp, 384 aa] {ON...    32   3.8  
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    32   3.8  
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    32   3.9  
ADR176W Chr4 (1012411..1013796) [1386 bp, 461 aa] {ON} Syntenic ...    32   3.9  
Ecym_2695 Chr2 complement(1343162..1344724) [1563 bp, 520 aa] {O...    32   4.0  
SAKL0F13596g Chr6 (1082310..1085321) [3012 bp, 1003 aa] {ON} hig...    32   4.1  
SAKL0G01694g Chr7 (142556..145099) [2544 bp, 847 aa] {ON} simila...    32   4.2  
TBLA0C01740 Chr3 (409315..410889) [1575 bp, 524 aa] {ON} Anc_8.6...    32   4.2  
KLTH0B07040g Chr2 (567756..569276) [1521 bp, 506 aa] {ON} simila...    32   4.3  
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...    32   4.3  
KLLA0C07513g Chr3 complement(656060..657379) [1320 bp, 439 aa] {...    32   4.3  
SAKL0F12782g Chr6 complement(999031..1000134) [1104 bp, 367 aa] ...    32   4.3  
NCAS0G01830 Chr7 complement(326874..328520) [1647 bp, 548 aa] {O...    32   4.3  
CAGL0B03289g Chr2 (319012..321624) [2613 bp, 870 aa] {ON} simila...    32   4.6  
Suva_13.218 Chr13 complement(352704..355115) [2412 bp, 803 aa] {...    32   4.7  
NCAS0G00690 Chr7 (116505..119162) [2658 bp, 885 aa] {ON} Anc_5.6...    32   4.8  
Ecym_7402 Chr7 complement(827224..829044) [1821 bp, 606 aa] {ON}...    32   4.8  
YMR049C Chr13 complement(368094..370517) [2424 bp, 807 aa] {ON} ...    32   4.8  
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    32   4.9  
ACR088W Chr3 (515561..518113) [2553 bp, 850 aa] {ON} Syntenic ho...    32   4.9  
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    31   5.1  
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      31   5.1  
Smik_11.233 Chr11 complement(384291..385538) [1248 bp, 415 aa] {...    31   5.4  
KLLA0E06469g Chr5 complement(581935..584832) [2898 bp, 965 aa] {...    32   5.6  
Skud_15.396 Chr15 (709746..711059) [1314 bp, 437 aa] {ON} YOR230...    31   5.8  
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    31   5.8  
Kwal_55.20615 s55 complement(490932..492209) [1278 bp, 425 aa] {...    31   5.9  
CAGL0I10989g Chr9 complement(1083728..1084882) [1155 bp, 384 aa]...    31   5.9  
Skud_13.261 Chr13 complement(445193..447697) [2505 bp, 834 aa] {...    31   5.9  
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    31   6.1  
NDAI0A00750 Chr1 complement(144773..151225) [6453 bp, 2150 aa] {...    31   6.1  
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    31   6.2  
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    31   6.3  
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    31   6.3  
TBLA0B09660 Chr2 (2292300..2297510) [5211 bp, 1736 aa] {ON} Anc_...    31   6.3  
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    31   6.4  
YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON} ...    31   6.6  
Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {O...    31   6.7  
TDEL0A02460 Chr1 (439489..441321) [1833 bp, 610 aa] {ON} Anc_2.4...    31   6.8  
NDAI0C00390 Chr3 complement(63036..65537) [2502 bp, 833 aa] {ON}...    31   6.8  
KLLA0D07282g Chr4 (621115..622467) [1353 bp, 450 aa] {ON} simila...    31   6.9  
TPHA0F00240 Chr6 complement(44772..46340) [1569 bp, 522 aa] {ON}...    31   6.9  
Smik_13.219 Chr13 complement(356393..358813) [2421 bp, 806 aa] {...    31   6.9  
SAKL0C03344g Chr3 (315639..317087) [1449 bp, 482 aa] {ON} weakly...    31   7.1  
KAFR0B00940 Chr2 (172801..174357) [1557 bp, 518 aa] {ON} Anc_7.3...    31   7.1  
NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {O...    31   7.1  
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    31   7.2  
TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa]...    31   7.3  
TDEL0C02650 Chr3 complement(460884..461978) [1095 bp, 364 aa] {O...    31   7.4  
CAGL0B00748g Chr2 (65727..68165) [2439 bp, 812 aa] {ON} similar ...    31   7.6  
Smik_5.253 Chr5 complement(382390..383487) [1098 bp, 365 aa] {ON...    31   7.8  
TDEL0B00800 Chr2 (152025..153452) [1428 bp, 475 aa] {ON} Anc_8.8...    31   7.8  
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    30   7.9  
NDAI0F04030 Chr6 complement(958364..959839) [1476 bp, 491 aa] {O...    31   8.1  
TDEL0A04970 Chr1 complement(877816..878817) [1002 bp, 333 aa] {O...    30   8.2  
Ecym_3619 Chr3 (1183531..1185666) [2136 bp, 711 aa] {ON} similar...    31   8.3  
CAGL0M09845g Chr13 (975007..977817) [2811 bp, 936 aa] {ON} highl...    31   8.4  
KNAG0E02460 Chr5 complement(488247..490064) [1818 bp, 605 aa] {O...    31   8.6  
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    31   8.9  
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    31   9.5  
KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {...    31   9.6  
Kpol_242.8 s242 (12067..13335) [1269 bp, 422 aa] {ON} (12067..13...    30   9.8  
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    30   9.8  
Kwal_14.906 s14 (105782..106768) [987 bp, 328 aa] {ON} YKL018W (...    30   9.9  

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score =  883 bits (2282), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/438 (98%), Positives = 430/438 (98%)

Query: 1   MDQANAKLLEKLAADPSMLAQLTNQEETGNGDENKELTIDEEYDLWKSNVPLMYDFVSET 60
           MDQANAKLLEKLAADPSMLAQLTNQEETGNGDENKELTIDEEYDLWKSNVPLMYDFVSET
Sbjct: 1   MDQANAKLLEKLAADPSMLAQLTNQEETGNGDENKELTIDEEYDLWKSNVPLMYDFVSET 60

Query: 61  KLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGEEDNYLKIAAIDLPDEVVQPSTNSL 120
           KLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGEEDNYLKIAAIDLPDEVVQPSTNSL
Sbjct: 61  KLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGEEDNYLKIAAIDLPDEVVQPSTNSL 120

Query: 121 KAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQ 180
           KAQR        QKQKPRSNIKIVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQ
Sbjct: 121 KAQREDDEDEDDQKQKPRSNIKIVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQ 180

Query: 181 SNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIW 240
           SNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIW
Sbjct: 181 SNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIW 240

Query: 241 DSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHS 300
           DSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHS
Sbjct: 241 DSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHS 300

Query: 301 QYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMW 360
           QYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMW
Sbjct: 301 QYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMW 360

Query: 361 DINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCS 420
           DINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCS
Sbjct: 361 DINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCS 420

Query: 421 HKLPIVGGTPEVSVSILE 438
           HKLPIVGGTPEVSVSILE
Sbjct: 421 HKLPIVGGTPEVSVSILE 438

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/431 (67%), Positives = 352/431 (81%), Gaps = 23/431 (5%)

Query: 8   LLEKLAADPSMLAQLTNQEETGNGDENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTL 67
           L+EK+AA       +  +EE    D NKEL+IDEEY+LW+SNVPLMYDFVSET+LTWP+L
Sbjct: 4   LMEKMAA-------VQGEEE----DPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSL 52

Query: 68  TVEWLPSSHSSTPVSNRQELILGTHTSGEEDNYLKIAAIDLPDEVVQPSTNSLKAQRXXX 127
           ++EWLP   S+    NRQELI+GTHTSGEEDNYLKIAAIDLP++++ PST  L+ Q+   
Sbjct: 53  SLEWLPQEKSAQ-APNRQELIIGTHTSGEEDNYLKIAAIDLPNDII-PSTEKLEDQQKGE 110

Query: 128 XXXXXQKQKPRSNIKIVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSA 187
                     +SNIKI+KKFKHEEEITRAR+MPQN++++ATINGSG VF+Y++S DK S 
Sbjct: 111 TTT-------KSNIKIIKKFKHEEEITRARYMPQNSNLVATINGSGKVFLYDRSKDKHSG 163

Query: 188 LISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI 247
           L+ST  +HKENGYGLSFN ND GKLLSGSDDGTIALW++  +++    P+ +W SVH+DI
Sbjct: 164 LVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNSNS---SPIYVWSSVHSDI 220

Query: 248 VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAA 307
           VNDCKW+ F+ NVF SVSEDSTLQLHDQRE++T  +  K   PFNTLAFSKHSQYL AAA
Sbjct: 221 VNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAA 280

Query: 308 GTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGA 367
           GTDS VYL+D R++S PL+SM GH+ ++TN+EFSP  DG+L++SG DRR I+WDI DIG 
Sbjct: 281 GTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGV 340

Query: 368 EQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIVG 427
           EQIPDDAEDGAPEV+MIHAGHRSA+NDFS+NPNIPWLMAS+EEENIIQVWKCSHKLP VG
Sbjct: 341 EQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKLPRVG 400

Query: 428 GTPEVSVSILE 438
           GTP VSVS LE
Sbjct: 401 GTPTVSVSQLE 411

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/406 (66%), Positives = 323/406 (79%), Gaps = 21/406 (5%)

Query: 34  NKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPS-SHSSTPVSNRQELILGTH 92
           +K L+IDEEY+LW+SNVPLMYDFVSET LTWPTLT+EWLP  SHS     NRQELILGTH
Sbjct: 7   DKPLSIDEEYELWRSNVPLMYDFVSETNLTWPTLTLEWLPGNSHS-----NRQELILGTH 61

Query: 93  TSGEEDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEE 152
           TS EE NYLKIAAIDLPDE+V       K  R        +    +SNIKI+KKFKHE+E
Sbjct: 62  TSEEEPNYLKIAAIDLPDEIVPG-----KEDRE-------RDGFTKSNIKIIKKFKHEQE 109

Query: 153 ITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKL 212
           +TRAR+MPQ++++IATINGSGTVF+Y++S D    L+S+L FH++NGYGLSFNP DKGKL
Sbjct: 110 VTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKL 169

Query: 213 LSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQL 272
           LSGSDD  IALWDI  NST   KP+  W+S H D VNDCKW+E N N F SVSED TLQL
Sbjct: 170 LSGSDDSKIALWDITTNST---KPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQL 226

Query: 273 HDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHE 332
           HDQR ++++ + IKT   FNT+AFSKHS  L AAAGTDSL+YLYDSR     L++M+GHE
Sbjct: 227 HDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHE 286

Query: 333 DSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAV 392
            ++TNLEF    DG+++SSG DRRVIMWD+ +IGAEQ+PDDA+DG+PEV+MIHAGHRS V
Sbjct: 287 SNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPV 346

Query: 393 NDFSINPNIPWLMASAEEENIIQVWKCSHKLPIVGGTPEVSVSILE 438
           NDFS+NPNIPWLMASAEEENI+QVWKCS KLP VGG P+V  S+LE
Sbjct: 347 NDFSMNPNIPWLMASAEEENIVQVWKCSSKLPRVGGLPKVDDSVLE 392

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/404 (62%), Positives = 318/404 (78%), Gaps = 19/404 (4%)

Query: 35  KELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTS 94
           K L+IDEEYDLWKSNVPLMYDFVSET LTWP+LT+EWLP S SS    NRQE+ILGTHTS
Sbjct: 9   KPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSS----NRQEMILGTHTS 64

Query: 95  GEEDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEIT 154
            EE NYLKIAAI LPDEVV  +                +++  +SN+KI+KKF+HE E+T
Sbjct: 65  DEEQNYLKIAAIYLPDEVVPDA------------EPKEEEEVLKSNVKIIKKFEHENEVT 112

Query: 155 RARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLS 214
           RAR+MPQ+ ++IATI+G GT+++YN++N+ +S L+ST +FH ENGYGLSFNPN+KGKLLS
Sbjct: 113 RARYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLS 172

Query: 215 GSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHD 274
           GSDD  I LWD+   S   ++P+  +   H+DIVNDCKW+ F+ N+F SVSEDSTLQLHD
Sbjct: 173 GSDDSNIVLWDVTGKS---QEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD 229

Query: 275 QREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDS 334
           QR ++  +  ++   P+NTLAFS HS  L AAAGTDS+VYLYD R  S PL+ M GHED+
Sbjct: 230 QRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDA 289

Query: 335 ITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVND 394
           +T+LEF P  DGVLIS+G+DRR I+WD+ +IGAEQ+PDDA+DG+PEV+MIHAGHRS++ND
Sbjct: 290 VTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSIND 349

Query: 395 FSINPNIPWLMASAEEENIIQVWKCSHKLPIVGGTPEVSVSILE 438
           FS+NPNIPWL A+AEEENI+QVWK S KLP +GGTP V   +LE
Sbjct: 350 FSMNPNIPWLTATAEEENIVQVWKPSSKLPRIGGTPSVDTQLLE 393

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  521 bits (1342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/411 (61%), Positives = 313/411 (76%), Gaps = 20/411 (4%)

Query: 33  ENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSN------RQE 86
           + K L++DEEYDLWKSNVPLMYDFVSET+LTWP+LTV+WLP     TPV        +QE
Sbjct: 4   QEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLP-----TPVQEPEGGFIKQE 58

Query: 87  LILGTHTSGEEDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKK 146
           LI+GTHTSGEE+NYLK A I+LP E++    N+   Q             PRSNIKI  K
Sbjct: 59  LIIGTHTSGEEENYLKFAEINLPKEIL----NNEDPQEEAGEDDEVSAPAPRSNIKITAK 114

Query: 147 FKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNP 206
           +KHEEEITRAR+MPQN   +ATING GTVFIY++S      L STL+FH+ENGY LSF+P
Sbjct: 115 YKHEEEITRARYMPQNPGTVATINGQGTVFIYSRS----EGLQSTLKFHEENGYALSFSP 170

Query: 207 NDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSE 266
             +G LLSGSDD T+ALWD+  NS  + +P++ W  +H+DIVND KW+ FN ++F +VSE
Sbjct: 171 LVEGLLLSGSDDHTVALWDVNGNSD-STRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSE 229

Query: 267 DSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLY 326
           DS L+++D R +NT   + K  +PFNTLAFS HS  L+AAAGTDS VYLYD RN+  PL+
Sbjct: 230 DSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLH 289

Query: 327 SMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHA 386
            M+GHED++TNLEFSPH DGV++SSG+D R+IMWD+  IGAEQ PDDAEDG PE+IM+HA
Sbjct: 290 HMSGHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHA 349

Query: 387 GHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIVGGTPEVSVSIL 437
           GH+SAVNDF +N  IPWL+AS EEENI+QVWKCSH LP+VGG P+VS+ ++
Sbjct: 350 GHKSAVNDFDLNAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSMDMI 400

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  516 bits (1329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/411 (60%), Positives = 314/411 (76%), Gaps = 20/411 (4%)

Query: 33  ENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSN------RQE 86
           + K L++DEEYDLWKSNVPLMYDFVSET+LTWP+LTV+WLP     TPV        +QE
Sbjct: 4   QEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLP-----TPVQQPKGGFIKQE 58

Query: 87  LILGTHTSGEEDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKK 146
           LI+GTHTSGEE+NYLK A I+LP EV+    N+   Q             PRSNI+I  K
Sbjct: 59  LIIGTHTSGEEENYLKFAEINLPKEVL----NNENPQEQAEMGDEASLPPPRSNIRITAK 114

Query: 147 FKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNP 206
           ++HEEEITRAR+MPQ+ +++ATING GTVF+Y++S+     L STL+FHK+NGY LSF+P
Sbjct: 115 YEHEEEITRARYMPQDPNMVATINGQGTVFLYSRSD----GLQSTLKFHKDNGYALSFSP 170

Query: 207 NDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSE 266
             KG LLSGSDD ++ALWD+   S  +  P++ WD +H+DIVND KW+ FN ++F +VSE
Sbjct: 171 LIKGHLLSGSDDHSVALWDVSGGSD-STTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSE 229

Query: 267 DSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLY 326
           DS L+++D R +NT I++ K   PFNTLAFS HS  ++AAAG DS VYLYD RN+  PL+
Sbjct: 230 DSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLH 289

Query: 327 SMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHA 386
            M+GHED++TNLEFSPH DGV++SSG+D R+IMWD+  IGAEQ PDDAEDG PE+IM+HA
Sbjct: 290 HMSGHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHA 349

Query: 387 GHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIVGGTPEVSVSIL 437
           GHRSAVNDF +N  +PWL+AS EEENI+QVWKCSH LPIVGG P+++  I+
Sbjct: 350 GHRSAVNDFDLNAQVPWLIASTEEENILQVWKCSHSLPIVGGLPKINKDIV 400

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score =  511 bits (1316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 238/407 (58%), Positives = 309/407 (75%), Gaps = 20/407 (4%)

Query: 32  DENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGT 91
           ++ + LT+D+EY+LWK+NVPLMYDFVSET+LTWP+LT +WLP S   T    RQ +ILGT
Sbjct: 6   EQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDT----RQYMILGT 61

Query: 92  HTSGEEDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEE 151
           HTSGEE +YLK+AA+DLPDEVV    N                ++ +SNIKIVKKF+H+ 
Sbjct: 62  HTSGEEVDYLKVAALDLPDEVVTGEAND-------------DNRRTKSNIKIVKKFEHDG 108

Query: 152 EITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGK 211
           EI RAR+MP++++IIATING G V IY++S  +   L +TL++HKENGYGLSFNPN   +
Sbjct: 109 EINRARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNE 168

Query: 212 LLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQ 271
           L+SGSDD TIALWDI   S   K P  +WD++H+DIVNDC W+ F+ N+F SVSEDSTL+
Sbjct: 169 LISGSDDFTIALWDIDSGS---KSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLK 225

Query: 272 LHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGH 331
           LHD+R  + +IN+I+    FNTLAFSKHS  L AAAG D+ +YLYD R  + PL+ M GH
Sbjct: 226 LHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGH 285

Query: 332 EDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSA 391
           ED+IT L+F P  DG+L+S G DRRVI+WD+ +IGAEQ PD+A+DG+PE++MIHAGHRSA
Sbjct: 286 EDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSA 345

Query: 392 VNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIVGGTPEVSVSILE 438
           +NDF+++P IPWL AS EE+N++QVWKCS  L  VGGTPE+   +L+
Sbjct: 346 INDFTLHPTIPWLSASVEEDNVVQVWKCSKNLSRVGGTPEIDTKMLQ 392

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score =  511 bits (1317), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 243/411 (59%), Positives = 311/411 (75%), Gaps = 20/411 (4%)

Query: 33  ENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSN------RQE 86
           + K L++DEEYDLWKSNVPLMYDFVSET+LTWP+L+V+WLP     TP+        RQE
Sbjct: 30  QEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLP-----TPIQEAEGGFIRQE 84

Query: 87  LILGTHTSGEEDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKK 146
           LI+GTHTSGEE+NYLK A I++P E++    N+   Q             P+SNI+I  K
Sbjct: 85  LIIGTHTSGEEENYLKFAEINIPKEIL----NNQDPQEEAEEDDKATLNAPKSNIRITAK 140

Query: 147 FKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNP 206
           + HEEEITRAR+MPQN D +AT+NG GTVF+Y++S      L STL+FHK+NGY LSFN 
Sbjct: 141 YVHEEEITRARYMPQNPDFVATLNGQGTVFLYSRS----GGLQSTLKFHKDNGYALSFNA 196

Query: 207 NDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSE 266
             +G+LLSGSDD T+ALW++  NST +  P++ W+ +H+DIVND KW+ FN  +F +VSE
Sbjct: 197 LVEGQLLSGSDDHTVALWEVGSNST-SISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSE 255

Query: 267 DSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLY 326
           DS L+++D R  N  I+++K   PFNTLAFS HS  L+AAAG DS VYLYD RN+  PL+
Sbjct: 256 DSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLH 315

Query: 327 SMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHA 386
            M+GHED++TN+EFS H DGV++SSG+D R+IMWD+  IGAEQ PDDAEDG PE+IM+HA
Sbjct: 316 HMSGHEDAVTNIEFSTHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHA 375

Query: 387 GHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIVGGTPEVSVSIL 437
           GHRS+VNDF +N  IPWL+AS+EEENI+QVWKCSH LPIVGG P+V+  I+
Sbjct: 376 GHRSSVNDFDLNAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKVNKDII 426

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score =  509 bits (1312), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 244/412 (59%), Positives = 313/412 (75%), Gaps = 20/412 (4%)

Query: 32  DENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSN------RQ 85
           ++ K L++DEEYDLWKSNVPLMYDFVSET+LTWP+LTV+WLP     TPV        +Q
Sbjct: 3   NQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLP-----TPVQELDGGFIKQ 57

Query: 86  ELILGTHTSGEEDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVK 145
           ELI+GTHTSGEE+NYLK A I+LP E++    ++   Q             PRSNI+I  
Sbjct: 58  ELIIGTHTSGEEENYLKFAEINLPKEIL----SNEDPQEEAGEEYQSSLPAPRSNIRITA 113

Query: 146 KFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFN 205
           K++HEEEITRAR+MPQ+ +I+ATING GTVF+Y++S      L STL+FHK+NGY LSF+
Sbjct: 114 KYEHEEEITRARYMPQDPNIVATINGQGTVFLYSRS----EGLQSTLKFHKDNGYALSFS 169

Query: 206 PNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVS 265
              KG+LLSGSDD T+ALW++        KP++ W+ +H+DI+ND KW+ FN ++F +VS
Sbjct: 170 TLVKGRLLSGSDDHTVALWEVGSGGD-PTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVS 228

Query: 266 EDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPL 325
           EDS L+++D R  NT I+++K   PFNTLAFS HS  L+AAAG DS VYLYD RN+  PL
Sbjct: 229 EDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPL 288

Query: 326 YSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIH 385
           + M+GHED++ NLEFS H DGV++SSG+D R++MWD+  IGAEQ PDDAEDG PE+IM+H
Sbjct: 289 HHMSGHEDAVNNLEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVH 348

Query: 386 AGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIVGGTPEVSVSIL 437
           AGHRS+VNDF +NP IPWL+ASAEEENI+QVWKCSH LPIVGG P+V+  I+
Sbjct: 349 AGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDII 400

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score =  499 bits (1284), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 243/407 (59%), Positives = 309/407 (75%), Gaps = 13/407 (3%)

Query: 32  DENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGT 91
           +ENK L+I+EEY+LWK+NVPLMYDFVSETKLTWP+LT++WLP + SST    +QE+ILGT
Sbjct: 5   EENKLLSIEEEYELWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSST----KQEMILGT 60

Query: 92  HTSGEEDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEE 151
           HTSGE+DNYLKIA+I+LP++++    +              Q++  +S IKI KK KHEE
Sbjct: 61  HTSGEDDNYLKIASIELPEDILGAEFSETPESTEETE----QQRNVQSRIKITKKIKHEE 116

Query: 152 EITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGK 211
           EITRARFMPQ+ + IATING G VF++++S DK  AL+S   FHK+NGYGLSFNP  KG+
Sbjct: 117 EITRARFMPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGE 176

Query: 212 LLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQ 271
           LLS SDDGTIALW++   +T   K +    + H DIVNDC W+EFN N+F SVSED TLQ
Sbjct: 177 LLSCSDDGTIALWNVMGTNTSPSKAV----TTHEDIVNDCTWHEFNENLFGSVSEDKTLQ 232

Query: 272 LHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGH 331
           +HD+R  N+ ++ +  + PFNTL FSKHSQ L AAAGTDSLVYLYD RN +  L++M+GH
Sbjct: 233 IHDKR-TNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGH 291

Query: 332 EDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSA 391
           EDS+T+LEFSPH DG+L SSG+DRRV++WD+  IG+EQ  +DA DG PE++M+HAGH+SA
Sbjct: 292 EDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSA 351

Query: 392 VNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIVGGTPEVSVSILE 438
           VNDFS N NIPWLMAS EE+NI+ VWK S KL   G   +  +  LE
Sbjct: 352 VNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSPGLIQDYDIRSLE 398

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score =  495 bits (1275), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 240/429 (55%), Positives = 324/429 (75%), Gaps = 22/429 (5%)

Query: 14  ADPSMLA---QLTNQE-ETGNGDENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTV 69
           +DP +LA   QLT  + +    DEN+ L   EEYDLWKSNVP+MYDFVSET+L WP+LTV
Sbjct: 4   SDPKLLAAAAQLTGIDLQQLPSDENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTV 63

Query: 70  EWLPSSHSSTPVSNRQELILGTHTSGEEDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXX 129
           +WLP S +  PV+ RQELILGTHTS EE NYLKIA +DLP EV   S             
Sbjct: 64  QWLPHS-APNPVT-RQELILGTHTSDEEQNYLKIAVVDLPTEVTDTSN-----------L 110

Query: 130 XXXQKQKPRSNIKIVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALI 189
               +++ RSNI++ +KFKH+ E+TRAR+MPQ+ +I+ATI+G+GTV+IY++SN++ +A I
Sbjct: 111 TESDEEQVRSNIRVTRKFKHDSEVTRARYMPQDPNILATISGTGTVYIYDRSNERDTASI 170

Query: 190 STLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVN 249
            TL++H +NGYGL+FNP  KG LLSGSDD  +ALWD+  +     +P++ W+++H+DIVN
Sbjct: 171 -TLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDR---NEPVQKWENIHSDIVN 226

Query: 250 DCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGT 309
           DC+W+ F  ++F +VSEDS+LQ+HD RE   +  +I  T PFNTL+FS HS+ L+A  G 
Sbjct: 227 DCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVA-TINGTKPFNTLSFSHHSENLLATGGV 285

Query: 310 DSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQ 369
           +S VYLYD R +  PL+ M+GH D++T+L+FS   DG+++S+G D+RVI+WDINDIGAEQ
Sbjct: 286 NSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQ 345

Query: 370 IPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIVGGT 429
           + +DAED   EV+MIHAGHRS +NDF+INP+IPWL+ASAEEENI+Q+WKCSHKLP + GT
Sbjct: 346 VLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENIVQLWKCSHKLPRISGT 405

Query: 430 PEVSVSILE 438
           P V V +L+
Sbjct: 406 PPVRVDMLQ 414

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score =  489 bits (1259), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 238/402 (59%), Positives = 303/402 (75%), Gaps = 21/402 (5%)

Query: 37  LTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGE 96
           LT+D+EYDLWKSNVPL+YDFVSET+LTWP+LT++WLP   +ST    RQ LILGT TSG 
Sbjct: 11  LTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTST----RQHLILGTLTSGA 66

Query: 97  EDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRA 156
           E +YLKIAA+DLPDE++                     +  +SN+K+VKKF H+ EI RA
Sbjct: 67  ETDYLKIAALDLPDEII---------------IGKKSDKVVKSNLKVVKKFAHDGEINRA 111

Query: 157 RFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGS 216
           R+MPQNT+IIAT+NG GT+FIY+ S DKQSAL+STL++HK+N YGL+FNPN +G+L+SGS
Sbjct: 112 RYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGS 171

Query: 217 DDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQR 276
           DD TIALWD   +    K+P++ W + H+DIVNDC+W+ FN+N+F SVSEDSTLQL D+R
Sbjct: 172 DDSTIALWDATNDK--LKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKR 229

Query: 277 EQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSIT 336
                   I +   +N++AFS  S+ L AAAGT + +YLYD RN    L+SM GHE+ +T
Sbjct: 230 NGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVT 289

Query: 337 NLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFS 396
           +LEFS   DG+LIS  +DRRVIMWD+ +IGAEQ PD+A+DG PEV+MIHAG RSA+ND S
Sbjct: 290 SLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDIS 349

Query: 397 INPNIPWLMASAEEENIIQVWKCSHKLPIVGGTPEVSVSILE 438
            +P+IPWL AS EE NI+QVWKCS KLP + GTPEVS+S LE
Sbjct: 350 THPSIPWLNASVEENNIVQVWKCSSKLPRISGTPEVSISDLE 391

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score =  490 bits (1261), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 239/424 (56%), Positives = 310/424 (73%), Gaps = 10/424 (2%)

Query: 15  DPSMLAQLTNQEETGNGDENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPS 74
           DPS L ++           N+ +T+DEEY+LWKSNVP++YDFVSET+LTWPTLTVEWLP 
Sbjct: 6   DPSALQKMAEVAAAAEQQSNEPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQ 65

Query: 75  SHSSTPVSNRQELILGTHTSGEEDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQK 134
            +       RQ+LILGTHTSGEE NYLKI A+DLP EV + S       +         +
Sbjct: 66  KNL-VAARTRQQLILGTHTSGEEQNYLKIGAVDLPVEVTENS-------KKDREIDEEDE 117

Query: 135 QKPRSNIKIVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRF 194
               SN+KIVKKF H+ EITRAR+MPQ+ +IIATING G +FIY++S +   AL+STL +
Sbjct: 118 DMVLSNVKIVKKFPHDGEITRARYMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEY 177

Query: 195 HKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWN 254
           H ENGYGL+FN N+K  LLSGSDD  IALWDI  N     KP   ++  H DI+ND KW+
Sbjct: 178 HTENGYGLAFNANEKYSLLSGSDDSNIALWDIS-NFEKNIKPTITFEDAHTDIINDVKWH 236

Query: 255 EFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVY 314
              +++F SVSEDST++L D+R  + II++I T  P+NTLAFS  S  L AAAGTD+LVY
Sbjct: 237 SSEAHIFGSVSEDSTMKLFDKR-SSQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVY 295

Query: 315 LYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDA 374
           LYD R++S PLY+M GHED++T +EF P+ DG+L SSG+DRR I+WD+ +IGAEQ  D+ 
Sbjct: 296 LYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEI 355

Query: 375 EDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIVGGTPEVSV 434
           EDG PEV+MIHAGH++++ND ++NPNI WL+ASAEE+NI+Q+WKCS  +P +GG PEV +
Sbjct: 356 EDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEEDNIVQIWKCSSNIPRIGGEPEVDL 415

Query: 435 SILE 438
           SIL+
Sbjct: 416 SILD 419

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score =  468 bits (1204), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 225/388 (57%), Positives = 295/388 (76%), Gaps = 20/388 (5%)

Query: 37  LTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGE 96
           LT+D+EY+LWKSNV LMYDFVSETKLTWP+L+++WLPS  ++ P+  +QE+ILGTHTSG+
Sbjct: 14  LTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPL-KQQEMILGTHTSGD 72

Query: 97  EDNYLKIAAIDLPDEVVQ-PSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITR 155
           E+NYLKIAAIDLP EVV  P  ++               +  +S IK+ KKF+HE+E+ R
Sbjct: 73  ENNYLKIAAIDLPYEVVGLPDEDN-------------SSEPVKSMIKVTKKFEHEDEVIR 119

Query: 156 ARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSG 215
           AR+MP+N  IIATING G +FIY++S  K   L  TL +HK+NGYGL+FNP  +G+LLS 
Sbjct: 120 ARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSA 179

Query: 216 SDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQ 275
           SDD T+ALWDI  NST   +P+ I  + H DIVND KW+EF+ N+F +VSED TLQ+HD+
Sbjct: 180 SDDTTVALWDI--NST--DRPVSIVMN-HTDIVNDSKWHEFDENIFGTVSEDKTLQVHDK 234

Query: 276 REQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSI 335
           R  +     +    P N LAFSKHS+ L+AAAGTD+ VYLYD R LS PL++M GH+D++
Sbjct: 235 RSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAV 294

Query: 336 TNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDF 395
           T++EFS H DG+L SSG+DRR+ +WD+  IGAEQ  +DA+DG PE++M+HAGHRSA+NDF
Sbjct: 295 TSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDF 354

Query: 396 SINPNIPWLMASAEEENIIQVWKCSHKL 423
           S NP +PWL+ASAEE+N++QVWK S KL
Sbjct: 355 SFNPQVPWLIASAEEDNVVQVWKISKKL 382

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score =  461 bits (1187), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 223/388 (57%), Positives = 292/388 (75%), Gaps = 13/388 (3%)

Query: 36  ELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSG 95
           E+++DEEYDLWKSNVPLMYDFVSETKL WP+LT++WLPS+  S    N QELILGTHTSG
Sbjct: 9   EVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRS----NEQELILGTHTSG 64

Query: 96  EEDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITR 155
            E NYLKIA++ LPDEVV    + +K              +P+S IKIV+KF+H +E+TR
Sbjct: 65  TEQNYLKIASVHLPDEVV----SDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTR 120

Query: 156 ARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSG 215
           AR+ P N ++IATI+GSG VF+Y++S D  SAL +   FHKENGYGL+F+    G+LLS 
Sbjct: 121 ARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSC 180

Query: 216 SDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQ 275
           SDDG+IA+WD+    +    P+K+ D+ HN+IVN+CKW+E +  +F SVS+DSTL +HD+
Sbjct: 181 SDDGSIAIWDV---CSGKNTPVKV-DTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236

Query: 276 REQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSI 335
           R    ++  I  ++P+NTLAFSKHS  L AAAGTDS V LYD R    P++SM+GH DS+
Sbjct: 237 RIDKPVVK-ILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSV 295

Query: 336 TNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDF 395
           T+LEF+PH DG+L S  +DRRV++WD+  IGAEQ  +DA+DG PE++M+HAGH+S VNDF
Sbjct: 296 TSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDF 355

Query: 396 SINPNIPWLMASAEEENIIQVWKCSHKL 423
           S +PNIPWLMAS EEEN++Q+WK S KL
Sbjct: 356 SCSPNIPWLMASVEEENVVQIWKASKKL 383

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score =  461 bits (1187), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 222/389 (57%), Positives = 286/389 (73%), Gaps = 20/389 (5%)

Query: 35  KELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTS 94
           + LT++EEY+LW SNVP+MY+FVSETKLTWP+LT++WLPS   S      Q LI GTHT+
Sbjct: 40  QSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSP----EQSLIFGTHTA 95

Query: 95  GEEDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEIT 154
           GEE NYLK+A I+LP  +                     +    S+  I  KF H EE+ 
Sbjct: 96  GEEVNYLKVATINLPAGIA-----------GLDQGDEEDEANDHSSFAIANKFPHIEEVI 144

Query: 155 RARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLS 214
           RAR+MP N++IIATING GT+ I++++ ++  A +STL FHKENGYGL+FNP+  G+LLS
Sbjct: 145 RARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLS 204

Query: 215 GSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHD 274
           GSDD T+ALWDI+     AKKP  I  S H+DIVND KW+EF SNVF +VSED TLQ+HD
Sbjct: 205 GSDDTTVALWDIEA----AKKPKSILTS-HDDIVNDVKWHEFESNVFGTVSEDKTLQVHD 259

Query: 275 QREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDS 334
           +R +   +  + T  PFNTL+FSKHS+ L+AAAG DS +YLYD R++S PL+ M+GH+DS
Sbjct: 260 KRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDS 319

Query: 335 ITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVND 394
           +T +EFSPHTDG++ SSG+DRR I+WD+  IGAEQ  DDA+DGAPE++M+HAGHRS VN+
Sbjct: 320 VTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNE 379

Query: 395 FSINPNIPWLMASAEEENIIQVWKCSHKL 423
           FS NP IPWL+AS EE+N+IQ WK S KL
Sbjct: 380 FSFNPQIPWLLASTEEDNVIQAWKVSMKL 408

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score =  456 bits (1173), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 225/393 (57%), Positives = 292/393 (74%), Gaps = 19/393 (4%)

Query: 38  TIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSN----RQELILGTHT 93
           TI+EEYDLW SNVP+MYDFVSET+LTWP+LTV+WLP+      V      RQEL++GT T
Sbjct: 12  TINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELLIGTLT 71

Query: 94  SGEEDNYLKIAAIDLPDEVV--QPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEE 151
           +  E NYLKIAAIDLP+ V   +PS +    +         +    +S IKIV+KFKHE+
Sbjct: 72  TDNEPNYLKIAAIDLPENVTSSKPSVSDDAKEN--------ELSHRQSKIKIVRKFKHEQ 123

Query: 152 EITRARFMPQNTDIIATINGSGTVFIYNQS-NDKQSALISTLRFHKENGYGLSFNPNDKG 210
           E+TRAR+MPQ+ +IIAT+NG+G V+I++++  +K    I++  +HKENGYGL+FNP   G
Sbjct: 124 EVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSG 183

Query: 211 KLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTL 270
           +LLS SDDGT+ALWD+   ST  K P + +D VH DIVNDCKW+EF S++F +VSED+TL
Sbjct: 184 QLLSASDDGTVALWDV--TSTANKSPSQTFD-VHTDIVNDCKWHEFQSSLFGTVSEDNTL 240

Query: 271 QLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNG 330
            +HD    +  I  +  +  FNTLAFSK S+ L+AAAGTDS VYLYD R L  PL+SM G
Sbjct: 241 IIHDTN-SDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAG 299

Query: 331 HEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRS 390
           HEDS+T+LEFSPH DG+L SSG+DRR+IMWD+ +IGAEQ PDDA DG PE+ M+H GHRS
Sbjct: 300 HEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRS 359

Query: 391 AVNDFSINPNIPWLMASAEEENIIQVWKCSHKL 423
            VN+FS N N+PWLM S EEEN++Q+WK ++K+
Sbjct: 360 PVNEFSHNSNVPWLMCSVEEENVLQIWKPANKI 392

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score =  441 bits (1134), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 223/415 (53%), Positives = 293/415 (70%), Gaps = 30/415 (7%)

Query: 23  TNQEETGNGDENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVS 82
           TN++++   +E + LT D+EY+LWKSNVPL+YDFVSETKL WP+LTVEWLPS+ ++   S
Sbjct: 6   TNEQKSTIKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPS 65

Query: 83  NRQELILGTHTSGEEDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIK 142
           N Q L+LGTHTSGEE NYLKIA I LPD+++   T                 +  +SNI+
Sbjct: 66  NEQRLLLGTHTSGEEQNYLKIAEITLPDQIINEKTED------------NSDKHVKSNIR 113

Query: 143 IVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSA--LISTLRFHKENGY 200
           I+KKFKHE E+TRA +MPQ++ IIATING GTVFIY+ S D+  +  +IS L  HKENGY
Sbjct: 114 IIKKFKHELEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGY 173

Query: 201 GLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNV 260
           GL+FNP DKGKLLS SDDG++A W+IQ       K + +       I+ND +WN+FN N+
Sbjct: 174 GLAFNPLDKGKLLSSSDDGSVAYWNIQ-------KSIPLLTLQETSIINDVRWNQFNQNL 226

Query: 261 FASVSEDSTLQLHDQREQNTII-----NSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYL 315
           F  V+E S L L D R  N  +     + IKT   FN +AFS HS+YLMAA+G DSL+YL
Sbjct: 227 FGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYL 286

Query: 316 YDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAE 375
           YD+RNL+ PL+ M GHEDS+T+L+F    DG++IS G+D+RV +WD+  IG EQ  D+ E
Sbjct: 287 YDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIE 346

Query: 376 DG-APEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKL---PIV 426
           DG  PE++MIHAGHRS +NDFS++ N+ WL AS EE+NI+QVWK ++ L   P+V
Sbjct: 347 DGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSLREDPLV 401

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score =  431 bits (1108), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 215/402 (53%), Positives = 293/402 (72%), Gaps = 23/402 (5%)

Query: 29  GNGDENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELI 88
           G  +E +EL+IDEEY LWKSNVPLMYDFVSETKLTWP+LTVEWLP  H       +QE+I
Sbjct: 2   GPQEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLP--HDPQAPLTQQEMI 59

Query: 89  LGTHTSGEEDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFK 148
           +GTHTS +E NY+KIA+I+LP+EV+ P   S                  +SN++I KKFK
Sbjct: 60  IGTHTSDQEPNYVKIASIELPNEVIDPHNVS--------------DAPVKSNVRITKKFK 105

Query: 149 HEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPND 208
            E+EITR+R+M Q+ +II+TI+G+GTV I+++  +   + + T  +HK+NGYGLSFNP  
Sbjct: 106 LEKEITRSRYMVQDPNIISTIDGNGTVSIFDR--NSSDSPVKTYSYHKDNGYGLSFNPIS 163

Query: 209 KGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSED- 267
           KG+LLS +DDG IA++DI   S   + P++ W S  N I+ND KW+ F++ +F +VSE+ 
Sbjct: 164 KGQLLSAADDGYIAMYDINAES---EDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEK 220

Query: 268 STLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYS 327
           +TL ++D R ++ +  SI+   PFN+LAFSKHS+ L +AAGTD  VYLYD RN    L+S
Sbjct: 221 NTLSIYDLRTKDKV-TSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHS 279

Query: 328 MNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAG 387
           M+GHE  +TNLEF    DG+L+SS  DRR+I+WD+ +IG+EQ+ +DA+D  PE++MIHAG
Sbjct: 280 MSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAG 339

Query: 388 HRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIVGGT 429
           HRS+VNDFS+N +IPWL+AS EEENIIQVWK S +LP +  +
Sbjct: 340 HRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRLPRISNS 381

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score =  427 bits (1097), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 212/389 (54%), Positives = 295/389 (75%), Gaps = 15/389 (3%)

Query: 35  KELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTS 94
           +EL+ID+EYDLWKSNVPLMYDFVSET+L WP+LT++WLP +  ST     QEL++GTHTS
Sbjct: 8   RELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDST----EQELLVGTHTS 63

Query: 95  GEEDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEIT 154
             E NYLKIA I+LP E++      L+            +Q P S IKI+KKFKHE E+T
Sbjct: 64  DSEQNYLKIAEINLPQEILSNEGPVLQNDNNGS-----DEQVP-SKIKIIKKFKHENEVT 117

Query: 155 RARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLS 214
           RAR+ P ++++IATI+G+GTVF+Y+++ D ++AL     +HKENGYGL+F+    G+L+S
Sbjct: 118 RARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELIS 177

Query: 215 GSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHD 274
            SDDG+IA+WDI+   T+   P  + +S+H+DIVN+CKW+E + N++ SVSEDS L +HD
Sbjct: 178 CSDDGSIAIWDIKSGKTV---PTSV-NSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233

Query: 275 QREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDS 334
           +R +  +   +   +PFNT+AFSKHS  L AAAGTD++VYL+DSR  +  L+SM+GH+++
Sbjct: 234 KRSEKPL-QKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEA 292

Query: 335 ITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVND 394
           +T+LEF+ H DG+L S G+DRRV++WD+  IG EQ  +DA+DG PE++M+HAGH+SA+ND
Sbjct: 293 VTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAIND 352

Query: 395 FSINPNIPWLMASAEEENIIQVWKCSHKL 423
           FS +PN+PWLMAS EEENI+Q+WK S KL
Sbjct: 353 FSFSPNVPWLMASVEEENIVQIWKPSRKL 381

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  152 bits (385), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 109/415 (26%), Positives = 202/415 (48%), Gaps = 53/415 (12%)

Query: 39  IDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGE-- 96
           + + Y  WK N  L+YD+++     WP+LT ++ P    S   ++   L+L T TS +  
Sbjct: 13  LQQRYSHWKKNTKLLYDYLNTNSNKWPSLTCQFFPDIDKS---NDTHRLLLSTFTSSQIP 69

Query: 97  EDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRA 156
           +D  + I+ I   + +   S N+              K   ++ I  +     E +  +A
Sbjct: 70  DDESIYISHISTLNHLDWSSLNNFDMDEMEFKPDNRIKFPSKNLITDISITFPEGDCNKA 129

Query: 157 RFMPQNTDIIATINGSGTVFIYNQ------------------SNDKQSALISTLRFHKEN 198
           R+MPQN DII   + +G ++I+++                  S   ++ L    +F  E+
Sbjct: 130 RYMPQNPDIIGCASSNGCIYIFDRTKRGSKLSTTTSARFSSGSKAYEAKLAKQRKFVIED 189

Query: 199 G--------YGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLK--IWDSVHNDI- 247
           G          +++NP  +G+LLS   +G I LWD Q+  +   + +   IWD+  +D+ 
Sbjct: 190 GTKNDEFECLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREINNTIWDTNFDDLG 249

Query: 248 VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTD---PFNTLAFSKHSQYLM 304
            N+  W   ++++FA+  E++ + + D R++  I+NSI+  +     N+  F+  +  L+
Sbjct: 250 CNEVTWMNGHNSIFATCGENNKMAVFDTRKEG-IVNSIEQGNHNGGINSCKFNYENAMLL 308

Query: 305 AAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGN-DRRVIMWDIN 363
           A+  ++ ++ L+D R L+ P+ ++  H  SI+ +E+SP  + ++ S G  D  V +WDI+
Sbjct: 309 ASGDSNGIINLWDIRKLNKPIRNLY-HGSSISTIEWSPLMNEMIASGGQEDGLVKLWDIS 367

Query: 364 DIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
           +               E I IH GH   +ND S + + PWL+ S   +N IQ+WK
Sbjct: 368 N-------------EEEPIFIHGGHMLGINDLSWDLHDPWLLCSVGSDNSIQIWK 409

>NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON}
           Anc_8.548
          Length = 419

 Score =  149 bits (377), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 113/423 (26%), Positives = 204/423 (48%), Gaps = 65/423 (15%)

Query: 39  IDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGE-- 96
           + + Y  WK N  L+YD+++     WP+LT ++ P   ++   S+   +++ + TS +  
Sbjct: 17  LQQRYSNWKKNTKLLYDYLNTNATKWPSLTCQFFPDLDTT---SDTHRILISSFTSSQLP 73

Query: 97  EDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEE----- 151
           ED  + I+ I     +   S N+              + KP +N+K+  K    +     
Sbjct: 74  EDEAIHISKISTLKHLNWASVNNFDMDE--------MEFKPDTNLKLPSKHLVNDLTIKF 125

Query: 152 ---EITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSAL-------------------I 189
              +  RAR++PQN D+IA  + +G+V+I++++    S +                   +
Sbjct: 126 PNGDCNRARYLPQNPDVIAAASSNGSVYIFDRTKHGSSRIRQSKNLKPYDAVLFNNSETV 185

Query: 190 STLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQE----NSTLAKKPLKI-WDSVH 244
             L  +      L++N   +G L S    G + +WDI++    N  L K  L I +D++ 
Sbjct: 186 EELHENTNEAISLAWNYQKEGTLASCYLQGQVQIWDIKQYFHSNPVLDKPVLNIQFDALG 245

Query: 245 NDIVNDCKWNEFNSNVFASVSEDSTLQLHDQR--EQNTIINSIKTTDPFNTLAFSKHSQY 302
              VND  W   + ++F +  E  TL L DQR  ++ + I   +     N+  F+  +  
Sbjct: 246 ---VNDVSWMPSHDSLFVACGESDTLALFDQRIGKEVSRIAQNRHNGGVNSCKFNYQNNM 302

Query: 303 LMAAAGTDSLVYLYDSRNL-SVPLYSMNGHEDSITNLEFSPHTDGVLISSG-NDRRVIMW 360
           L+A+A ++ LV ++D RNL   P+ S+N H  SI+ +E++P+ D ++ ++G ND  V +W
Sbjct: 303 LLASADSEGLVNMWDIRNLDQYPIKSIN-HGSSISTIEWNPNLDTIIATAGQNDGLVKLW 361

Query: 361 DINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCS 420
           D+++   E            ++ +H GH   VND S + +  WLM S   +N IQ+WK +
Sbjct: 362 DVSNTDNE------------LLFVHGGHMLGVNDISWDLHDSWLMCSVSNDNSIQIWKPA 409

Query: 421 HKL 423
           H L
Sbjct: 410 HNL 412

>TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  142 bits (358), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 113/421 (26%), Positives = 194/421 (46%), Gaps = 65/421 (15%)

Query: 39  IDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSG--E 96
           + E Y  WK N  L+YD+++     WP+L+ ++    ++    ++   ++L + TSG   
Sbjct: 23  LQERYTHWKKNTRLLYDYLNTNSTKWPSLSCQFFQDVNTK---NDSHRILLSSFTSGLMP 79

Query: 97  EDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEE---- 152
           E   + I +I     V   S N+              + KP +N+K+  K  H E+    
Sbjct: 80  EQESINIMSISTLKHVPWASLNNFDMDE--------MEFKPDNNLKLPPKNLHTEQTITF 131

Query: 153 ----ITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGY-------- 200
                 RAR++PQN DIIA  +  GTV+I+N++    S L  T  F              
Sbjct: 132 PNGDCNRARYLPQNQDIIAGASSDGTVYIFNRTK-YGSTLRQTSSFQSYQARFAEPENTV 190

Query: 201 -GLSFNPND----------KGKLLSGSDDGTIALWDIQE----NSTLAKKPLKIWDSVHN 245
             +  NPN+          +G L +   DG I  WD+++    N+T+    + I   +  
Sbjct: 191 QSVDSNPNEALSIDWNVQREGLLAASYSDGEIKTWDLKKFSNANTTITTPTVSI--MMDT 248

Query: 246 DIVNDCKWNEFNSNVFASVSEDSTLQLHDQR--EQNTIINSIKTTDPFNTLAFSKHSQYL 303
           +  ND  W   + ++ A+  E + L ++D R   ++T I+S    D  N   F+  +  +
Sbjct: 249 NGANDVTWMPLHDSLLAACGESNKLIIYDIRGSREHTTISSGIHEDGINACRFNYANNLI 308

Query: 304 MAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVI-MWDI 362
           +A+A T   V+++D R  S  +     H  SI+ +E++P+ D +L ++G D  ++ +WD+
Sbjct: 309 VASADTVGNVHIWDIRK-SNEIVKTIPHGSSISTIEWNPNMDTILATAGQDDGLVKLWDV 367

Query: 363 NDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHK 422
            D               E+I  H GH   VND S N + PWLM S   +N +Q+W+ +H 
Sbjct: 368 TD--------------SELIFTHGGHMLGVNDISWNRHDPWLMCSVARDNSVQIWRPAHN 413

Query: 423 L 423
           L
Sbjct: 414 L 414

>Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa]
           {ON} complement(104336..105589) [1254 nt, 418 aa]
          Length = 417

 Score =  141 bits (355), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 112/415 (26%), Positives = 200/415 (48%), Gaps = 56/415 (13%)

Query: 41  EEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSG--EED 98
           + Y  WK N  L+Y++++     WP+LT ++ P  ++    ++   ++L + TS    ED
Sbjct: 23  DRYTTWKKNTKLLYEYLNTNSNKWPSLTCQFFPDVNTK---NDSHRILLSSFTSSLVPED 79

Query: 99  NYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNI--KIVKKFKHEEEITRA 156
             L I  I     +   S N+               + P  N+  ++V +F + +   RA
Sbjct: 80  ESLYITRISTLKHLSWASLNNFDLDEMEFKPDNSNIKLPPKNLTTELVIRFPNGD-CNRA 138

Query: 157 RFMPQNTDIIATINGSGTVFIYNQS------NDKQSALISTLR-----------FHKEN- 198
           R++PQN D+IA  +  G+V+I++++      + +QS    + +            + EN 
Sbjct: 139 RYLPQNPDLIAAASSDGSVYIFDRTKHGTAMHSRQSGFTQSYQAKLAVNNNSQSLNGENE 198

Query: 199 GYGLSFNPNDKGKLLSGSDDGTIALWDI---QENSTLAKKP---LKIWDSVHNDIVNDCK 252
              + +N   +G L+    DG +  WDI   + +  + K P    K+ +S  ND V    
Sbjct: 199 ALTIDWNHQKEGHLVVAYSDGHVKAWDITKYKRSDPVIKAPEYNYKLDESGCNDAV---- 254

Query: 253 WNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTT---DPFNTLAFSKHSQYLMAAAGT 309
           W   ++++FA+ SED+ L L D R+++ II+ I T+      N   F+  +  L+A+  +
Sbjct: 255 WMPEHNSLFAACSEDNRLSLFDTRDESNIID-ISTSVHKGGINACRFNPRNSLLLASGDS 313

Query: 310 DSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVI-MWDINDIGAE 368
              + L+D R    P+  ++ H  SI+ +E++P+   VL S+G D  ++ +WD       
Sbjct: 314 IGNICLWDIRKKETPINILD-HGSSISTIEWNPNLSTVLASAGQDDGLVKLWDA------ 366

Query: 369 QIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKL 423
                   G+ + + IH GH   VND S N + PWLM S  ++N IQ+WK +H L
Sbjct: 367 --------GSDKPVFIHGGHMLGVNDISWNMHDPWLMCSVSKDNSIQIWKPAHNL 413

>Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON}
           YBR195C (REAL)
          Length = 424

 Score =  140 bits (352), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 109/434 (25%), Positives = 192/434 (44%), Gaps = 57/434 (13%)

Query: 26  EETGNGDENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQ 85
           EET  G  N  + + E Y  WK N  L+YD+++     WP+LT ++ P   ++    +  
Sbjct: 6   EETAGGASNIPIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTL---DEH 62

Query: 86  ELILGTHTSGE--EDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKI 143
            ++L + TS +  ED  + I+ I     +   S N+              +  P   +  
Sbjct: 63  RILLSSFTSSQKPEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENTTRLPPSHLVND 122

Query: 144 VKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHK------- 196
           +  F    +  RAR++PQN DIIA  +  G ++I++++    + +  +   H        
Sbjct: 123 ISIFFPNGDCNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKNSHPFEAKLFG 182

Query: 197 ------------------ENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENS---TLAKK 235
                                  L++N   +  LLS   +G + +WDI++ S    L   
Sbjct: 183 SHGVIQDVEAMDTSSADVNEATSLAWNLQQEALLLSSHSNGQVQIWDIKQYSHENPLIDS 242

Query: 236 PLKIWDSVHNDI--VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKT--TDPF 291
           PL    S+ +D   VND  W   + ++FA+ +E + + L D R +   + S +   T   
Sbjct: 243 PLV---SIESDASGVNDVTWMPTHDSLFAACTEGNVVSLLDLRTKKEKLRSNRQNHTGGV 299

Query: 292 NTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS-VPLYSMNGHEDSITNLEFSPHTDGVLIS 350
           N+  F+  +  ++A+A ++  + L+D R ++  P+ +M  H  SI+ LE++P+   VL +
Sbjct: 300 NSCKFNYRNSLVLASADSNGRLNLWDIRKMNESPITTME-HGASISTLEWNPNFSTVLAT 358

Query: 351 SG-NDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAE 409
           +G  D  V +WD                  E I  H GH   VND S + + PWLM S  
Sbjct: 359 AGQQDGLVKLWDT--------------AREETIFTHGGHMLGVNDVSWDVHDPWLMCSVA 404

Query: 410 EENIIQVWKCSHKL 423
            +N + +WK +  L
Sbjct: 405 NDNSVHIWKPAENL 418

>Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  138 bits (347), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 109/428 (25%), Positives = 194/428 (45%), Gaps = 57/428 (13%)

Query: 27  ETGNGDENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQE 86
           +T N   N    + E Y  WK N  L+Y++++     WP+LT ++ P   ++    +   
Sbjct: 7   DTANEASNIPPNLQERYSHWKKNTKLLYEYLNTNSTKWPSLTCQFFPDLDTTL---DEHR 63

Query: 87  LILGTHTSGE--EDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIV 144
           ++L + TS +  ED  + I+ I     +   S N+              +  P+  +  +
Sbjct: 64  ILLSSFTSSQKPEDESIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRYPPKHLVNDI 123

Query: 145 KKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSND-----KQSALISTLRFHKENG 199
             F    E  RAR++PQN DIIA  +  G ++I++++       +QS +           
Sbjct: 124 SIFFPNGECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEAKLFGS 183

Query: 200 YG--------------------LSFNPNDKGKLLSGSDDGTIALWDIQENS---TLAKKP 236
           +G                    +++N   +  LLS   +G + +WDI++ S    +   P
Sbjct: 184 HGVIQDVETMDASSADINEATSIAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLP 243

Query: 237 LKIWDSVHND--IVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTII--NSIKTTDPFN 292
           L    S+++D   VND  W   + ++FA+ +E +T+ L D R +   +  N        N
Sbjct: 244 LV---SINSDGSGVNDVTWMPTHDSLFAACTEGNTVSLLDLRTKKEKLKSNCRSHNGGVN 300

Query: 293 TLAFSKHSQYLMAAAGTDSLVYLYDSRNLS-VPLYSMNGHEDSITNLEFSPHTDGVLISS 351
           +  F+  +  ++A+A ++  + L+D RN++  PL +M  H  S++ LE+SP+ D VL ++
Sbjct: 301 SCKFNYRNSLILASADSNGKLNLWDIRNMNDCPLTTME-HGGSVSTLEWSPNFDTVLATA 359

Query: 352 GN-DRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEE 410
           G  D  V +WD +                E I  H GH   VND S + + PWLM S   
Sbjct: 360 GQEDGLVKLWDTS--------------REENIFTHGGHMLGVNDISWDAHDPWLMCSVAN 405

Query: 411 ENIIQVWK 418
           +N + +WK
Sbjct: 406 DNSVHIWK 413

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score =  138 bits (347), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 113/429 (26%), Positives = 196/429 (45%), Gaps = 58/429 (13%)

Query: 31  GDENKELTIDEE----YDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQE 86
            DE    TI E+    Y  WK N  L+YD+++     WP+LT ++ P   ++T   +   
Sbjct: 3   ADEPGISTISEDLQTRYAYWKKNTKLLYDYLNTNTAKWPSLTCQFFPDVDANT---DTHR 59

Query: 87  LILGTHTSGE--EDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIV 144
           ++L ++TS +  ED  + +A+I     +   S N+              K  P++    V
Sbjct: 60  ILLSSYTSCQLPEDENVYVASISTLAHLDWASLNNFDMDEMEFKPDRTTKFPPKNLATNV 119

Query: 145 KKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQ-------------SNDKQSALIST 191
                  +  RAR+MPQN D+IA  + +G V+++N+             S+ +Q      
Sbjct: 120 SITFPRGDCNRARYMPQNPDVIAAASSNGAVYVFNRTKHGTRRIQKHAASDAEQDYGPYE 179

Query: 192 LRFHKEN------------GYGLSFNPNDKGKLLSGSDDGTIALWDIQ----ENSTLAKK 235
            RF+ E                L++N + +G L      G + +WD+Q    +N+T+++ 
Sbjct: 180 ARFYNEETDEARRTPVDNEAVSLAWNHHREGTLAVAYSHGAVKVWDLQRFNVDNTTISET 239

Query: 236 PLKIWDSVHNDI--VNDCKWNEFNSNVFASVSEDS-TLQLHDQREQNTI--INSIKTTDP 290
               W+  + D   VND  W   + ++ A+  E S +L L D R QN +  I +   ++ 
Sbjct: 240 E---WECSNFDSRGVNDVSWMSQHDSILAACGERSDSLALFDTRAQNAVAKIRNQFKSEG 296

Query: 291 FNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLIS 350
            N   F+  +  L+A+  +     L+D R LS        H  S++ LE++PH   VL +
Sbjct: 297 INACKFNWENNLLLASTDSTGRTNLWDVRKLSAEPIVHFDHGGSVSTLEWNPHDHSVLAT 356

Query: 351 SG-NDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAE 409
           +G +D  + +WD     + +I D       + I +H+GH   VND + + + PWLM S  
Sbjct: 357 AGQSDGLIKIWDT----SLEIED-------KTIFVHSGHMLGVNDIAWDLHDPWLMCSVS 405

Query: 410 EENIIQVWK 418
            +N + VWK
Sbjct: 406 NDNSVHVWK 414

>CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa]
           {ON} similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195c MSI1
          Length = 419

 Score =  137 bits (346), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 113/409 (27%), Positives = 187/409 (45%), Gaps = 49/409 (11%)

Query: 39  IDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGE-- 96
           +   Y  WK N  L+YD+++     WP+LT ++ P   +S   S++  L+L + TS +  
Sbjct: 21  VQTRYIHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTS---SDQHRLLLSSFTSSQLP 77

Query: 97  EDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRA 156
           ED  + I+ I     +   S N+              K  P++    V       +  R+
Sbjct: 78  EDESVYISKISTLKHLNWSSLNNFDMDEMEFKPDPSVKLPPKNLTTEVSIRFPNGDCNRS 137

Query: 157 RFMPQNTDIIATINGSGTVFIYNQ------------SNDKQSALISTLRFHKE-----NG 199
           R++PQN D+IA  +  G+V+I+N+            S+D Q+ L S     +        
Sbjct: 138 RYLPQNPDLIAAASSDGSVYIFNKTKHGNSVLRSKSSDDFQARLFSGSHDAQNLDNFNEA 197

Query: 200 YGLSFNPNDKGKLLSGSDDGTIALWDIQE----NSTLAKKPLKIWDSVHNDIVNDCKWNE 255
             LS+N + +G L      G   +WD+++    N  +++  L +  +  ++  ND  W  
Sbjct: 198 VSLSWNKHKEGILGVSYSQGQCNIWDVKKFSRSNILISQPELTV--TFDSNGCNDLDWMP 255

Query: 256 FNSNVFASVSEDSTLQLHDQR-----EQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTD 310
            + ++F +  E + L L D R     E N+I N  K  D  NT  F+  +  L+A+A T 
Sbjct: 256 MHDSMFIACGESNKLGLFDMRLNGEKEVNSISN-YKHEDGINTCKFNPGNSLLVASADTC 314

Query: 311 SLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGN-DRRVIMWDINDIGAEQ 369
             + L+D R L     S   H  SI+ +E++P+   V  S+G  D  V +WD + +G E 
Sbjct: 315 GRINLWDIRKLDQEPISTMQHGSSISTIEWNPNIGVVFASAGQEDGLVKLWDAS-VGKE- 372

Query: 370 IPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
                       I +H GH   VND S + + PWLMAS   +N IQ+W+
Sbjct: 373 ------------IFVHGGHMLGVNDISWDMHDPWLMASVSNDNTIQIWR 409

>ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 397

 Score =  137 bits (344), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 109/406 (26%), Positives = 188/406 (46%), Gaps = 43/406 (10%)

Query: 41  EEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGE--ED 98
           + Y LWK N  L+YD+++     WP+L+ ++ P   +S   S+   L+  + TS +  +D
Sbjct: 10  QRYTLWKKNTKLLYDYLNTNSFKWPSLSCQFFPDLDTS---SDTHRLLFTSFTSSQLPQD 66

Query: 99  NYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRS-NIKIVKKFKHEEEITRAR 157
             + IA+I     V   S N+              K  P++  I++   F H  +  RA 
Sbjct: 67  ENVTIASISTLRHVPWSSLNNFDMDEMEFKPDLSTKLPPKNLQIQLTINFPH-GDCNRAT 125

Query: 158 FMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKE-------NG------YGLSF 204
           ++PQN D+I+T +  G+V+I++++   +S  IS LR   E       NG        L +
Sbjct: 126 YLPQNPDLISTASSDGSVYIFDRTKRGKSP-ISHLRGPFEAQLLPNNNGSPIGETVALDW 184

Query: 205 NPNDKGKLLSGSDDGTIALWDI---QENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVF 261
           N   +G L S   +G + +WDI   ++ + +  +P   +    +   ND  W   +  + 
Sbjct: 185 NRQIEGILASTYSNGQLCIWDIKKFEKRNPIMSQPSADFIDTESQGFNDVSWMPSHDCLL 244

Query: 262 ASVSEDSTLQLHDQREQNTIINSIKTTD---PFNTLAFSKHSQYLMAAAGTDSLVYLYDS 318
           +   ED+ + L D R    I  +  +T+     N   F+     L+A A  D LV L+D 
Sbjct: 245 SIAREDNIMTLFDTRTNGNIAQTGPSTNHASGINCTKFNPSQPLLVATASGDGLVQLWDI 304

Query: 319 RNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGN-DRRVIMWDINDIGAEQIPDDAEDG 377
           R L  P+ ++N  E  ++ LE++P    VL + G  D  V +W            +A +G
Sbjct: 305 RKLHNPIKTINC-ESPLSALEWNPQLPTVLATGGQEDGLVKLW------------NASNG 351

Query: 378 APEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKL 423
             +++  H GH   VND + +P+  WLM S   +N   +WK + +L
Sbjct: 352 --QLLFTHGGHMLGVNDIAWSPHDKWLMCSVANDNSTHLWKPASRL 395

>YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}
           MSI1Subunit of chromatin assembly factor I (CAF-1);
           chromatin assembly by CAF-1 is important for multiple
           processes including silencing at telomeres, mating type
           loci, and rDNA; maintenance of kinetochore structure;
           deactivation of the DNA damage checkpoint after DNA
           repair; and chromatin dynamics during transcription;
           Msi1p localizes to both nucleus and cytoplasm and has an
           independent role as a negative regulator of the RAS/cAMP
           pathway via sequestration of Npr1p kinase
          Length = 422

 Score =  137 bits (345), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 107/418 (25%), Positives = 191/418 (45%), Gaps = 57/418 (13%)

Query: 37  LTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGE 96
           + + E Y  WK N  L+YD+++     WP+LT ++ P   ++   S+   ++L + TS +
Sbjct: 17  IDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTT---SDEHRILLSSFTSSQ 73

Query: 97  --EDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEIT 154
             ED  + I+ I     +   S N+              +   +  +  +  F    E  
Sbjct: 74  KPEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRFPSKHLVNDISIFFPNGECN 133

Query: 155 RARFMPQNTDIIATINGSGTVFIYNQSND-----KQSALISTLRFHKENGYG-------- 201
           RAR++PQN DIIA  +  G ++I++++       +QS +           +G        
Sbjct: 134 RARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFGSHGVIQDVEAM 193

Query: 202 ------------LSFNPNDKGKLLSGSDDGTIALWDIQENS---TLAKKPLKIWDSVHND 246
                       L++N   +  LLS   +G + +WDI++ S    +   PL    S+++D
Sbjct: 194 DTSSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLV---SINSD 250

Query: 247 --IVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTII--NSIKTTDPFNTLAFSKHSQY 302
              VND  W   + ++FA+ +E + + L D R +   +  N  K     N+  F+  +  
Sbjct: 251 GTAVNDVTWMPTHDSLFAACTEGNAVSLLDLRTKKEKLQSNREKHDGGVNSCRFNYKNSL 310

Query: 303 LMAAAGTDSLVYLYDSRNLS-VPLYSMNGHEDSITNLEFSPHTDGVLISSGN-DRRVIMW 360
           ++A+A ++  + L+D RN++  P+ +M  H  S++ LE+SP+ D VL ++G  D  V +W
Sbjct: 311 ILASADSNGRLNLWDIRNMNKSPIATME-HGTSVSTLEWSPNFDTVLATAGQEDGLVKLW 369

Query: 361 DINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
           D +                E I  H GH   VND S + + PWLM S   +N + +WK
Sbjct: 370 DTS--------------CEETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWK 413

>KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {ON}
           Anc_8.548 YBR195C
          Length = 413

 Score =  136 bits (342), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 106/409 (25%), Positives = 191/409 (46%), Gaps = 50/409 (12%)

Query: 39  IDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGE-- 96
           + E Y  WK N  L+Y +++     WP+LT ++ P   ++T   +   ++L T TS +  
Sbjct: 16  LQERYSRWKKNTKLLYSYLNTNTSKWPSLTCQFFPDLDTTT---DTHRILLSTFTSSQLP 72

Query: 97  EDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRS-NIKIVKKFKHEEEITR 155
           ED  L IA +   + +   S N+              K   ++ N+ I   F + +   R
Sbjct: 73  EDESLYIANLSTSNHLNWSSLNNFDMDEMEFKPDNSTKFPSKNLNVDISIPFPNGD-CNR 131

Query: 156 ARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYG-------------- 201
           AR++PQN D++A  + +G+++I+N++      L S  R  +   Y               
Sbjct: 132 ARYLPQNPDLLAAASSNGSIYIFNRTKHGSRRLNSNQRSFEARLYSTDKMDENFTNSNEA 191

Query: 202 --LSFNPNDKGKLLSGSDDGTIALWDIQENS----TLAKKPLKIWDSVHNDIVNDCKWNE 255
             +++N    G L S    G+I +WDI + S    TL +  L I      +  N+  W  
Sbjct: 192 VSIAWNLQKNGTLASSYSQGSIKIWDITKYSCSDPTLRENELTI--PFDPEGCNEVTWMV 249

Query: 256 FNSNVFASVSEDSTLQLHDQREQNTIINSIKT----TDPFNTLAFSKHSQYLMAAAGTDS 311
            + ++FA+ SE + L L D R +  ++   +     +   N+  F+ ++  L+A+A +  
Sbjct: 250 NHDSIFAACSESNKLSLFDVRTKEEMLKMTENIGTHSGGINSCKFNYYNDMLLASADSTG 309

Query: 312 LVYLYDSRNLSV-PLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVI-MWDINDIGAEQ 369
            + ++D R L   P+ S N H  SI+ LE++P+ + +L+++G D  ++ +WD        
Sbjct: 310 KINMWDIRKLDKEPIKSFN-HNSSISTLEWNPNLETILVTAGQDDGLVKIWDT------- 361

Query: 370 IPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
                     + I +H GH   VND S + + PWL++S   +N I VWK
Sbjct: 362 -------ANGQNIFVHGGHMLGVNDVSWDLHDPWLLSSVSNDNSIHVWK 403

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score =  135 bits (340), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 105/410 (25%), Positives = 188/410 (45%), Gaps = 42/410 (10%)

Query: 39  IDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGE-- 96
           + + Y  WK N  L+YD+++     WP+LT +++P     T   ++  L+L + TS +  
Sbjct: 21  LQQRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFMPDLEVPT---DKHRLLLSSFTSSQLP 77

Query: 97  EDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRA 156
           ED  + I+ +     V   S N+              K   ++ ++ V+      +  RA
Sbjct: 78  EDEAVYISELSTMRHVPWSSLNNFDMDEMEFKVDNQAKLPNKNLVETVRIQFPSGDCNRA 137

Query: 157 RFMPQNTDIIATINGSGTVFIYNQSNDKQ-------SALISTLRFHKENGYG-------- 201
            +MPQN DII  I  +G V I++++           SA    ++ ++    G        
Sbjct: 138 CYMPQNPDIIGAIASTGAVNIFDRTKHGTNRPKLLGSAASYEIQLNEPESLGDADSAEAL 197

Query: 202 -LSFNPNDKGKLLSGSDDGTIALWDI----QENSTLAKKPLKIWDSVHNDIVNDCKWNEF 256
            L++N    G + S   +G I +WDI    +   T++   L+I         ND  W   
Sbjct: 198 SLAWNWQKAGIIASSYSNGLIKVWDITRYQKSQPTISNPELRILQDKAG--TNDVSWMVH 255

Query: 257 NSNVFASVSEDSTLQLHDQREQNTI--INSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVY 314
           +S++ A+  E +T+ L D R  +      +   T   N L F+  +  L+ AA ++  + 
Sbjct: 256 HSSILAACGESNTIGLLDTRAPDAFKPTKASPHTGGINALQFNYANDMLLCAADSNGGIA 315

Query: 315 LYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSG-NDRRVIMWDINDIGAEQIPDD 373
           L+D R  S PL   N H DS++ L+++P+   ++ ++G  D  + +WD +     + P+D
Sbjct: 316 LWDCRAFSKPLSVFN-HGDSVSALQWNPNLPTIVATAGQGDGLIKIWDTS-----REPED 369

Query: 374 AEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKL 423
           +      ++ +H GH   VND + N + PWLM S   +N + VWK +  L
Sbjct: 370 S------LLFVHGGHMLGVNDIAWNYHDPWLMCSVANDNSVHVWKPAANL 413

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score =  135 bits (340), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 106/429 (24%), Positives = 202/429 (47%), Gaps = 41/429 (9%)

Query: 19  LAQLTNQEETGNGDENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSS 78
           +A++   EE G         +   Y  WK N  L+YD+++     WP+LT ++ P   ++
Sbjct: 10  MAEVITTEEHGLDLPTIPEEVQTRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTT 69

Query: 79  TPVSNRQELILGTHTSGE--EDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQK 136
              +++  L+L + TS +  ED  + ++ +     +   S N+              K  
Sbjct: 70  ---NDQHRLLLSSFTSSQLPEDESIYVSRVSTLKHLPWSSLNNFDMDEMEFKLDNSSKLP 126

Query: 137 PRSNIKIVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQS---------NDKQSA 187
            ++ IK +       +   AR++PQN D+IA  + +G++++++++         +D  S 
Sbjct: 127 SKNLIKELNISFPMGDCNGARYLPQNPDVIAAASSNGSIYVFDRTKHGLTRQKLHDGGSM 186

Query: 188 L-----ISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDS 242
                  S+L  H+E    L++N   +G L +    G + +WD+++ S       K  D 
Sbjct: 187 FELEFQSSSLEEHQE-VVSLAWNWQREGLLAACYSGGDVKVWDVKKYSRNFPVIDKA-DY 244

Query: 243 VHN---DIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTD----PFNTLA 295
            HN      ND  W   ++++ A   E +++ + D R Q  +++S K T       N+  
Sbjct: 245 THNADPRGCNDVSWMVNHASILACCGESNSINVIDTRAQKGVLSSTKDTKHHSRGINSSQ 304

Query: 296 FSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSG-ND 354
           F+ H+  L+ +  +   V L+D R+L  PL S++ H  SI+  +++P+   +L ++  +D
Sbjct: 305 FNYHNDMLLCSGDSTGRVNLWDIRDLETPLKSLD-HGSSISKTQWNPNLSTILATADQSD 363

Query: 355 RRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENII 414
             V +WDI           A++   E++ +H GH   VND S N + PWLM S   +N +
Sbjct: 364 GLVKLWDI-----------AQEPGEELLFVHGGHMLGVNDISWNYHDPWLMCSVANDNSV 412

Query: 415 QVWKCSHKL 423
           Q+W+ +  L
Sbjct: 413 QLWRPARNL 421

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score =  134 bits (338), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 106/415 (25%), Positives = 192/415 (46%), Gaps = 45/415 (10%)

Query: 38  TIDEE----YDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHT 93
           TI EE    Y  WK N  L YD+++     WP+LT +  P    +T   +   ++L + T
Sbjct: 16  TIAEERQKRYTRWKKNSKLYYDYLNTNSTKWPSLTCQLFPDLDLAT---DEHRILLSSFT 72

Query: 94  SGE--EDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEE 151
           S +  ED  L +A +     +   S N+   +          K   +S ++ ++      
Sbjct: 73  SSQVPEDESLYVARLSSMKHIPWSSLNNFDMEEKEFKVDNSLKLPSKSLVEDLRIKFPAG 132

Query: 152 EITRARFMPQNTDIIATINGSGTVFIYNQSN--------------DKQ--SALISTLRFH 195
           +  +AR+ P N D+I + + +G++++++++               D Q    L ++L  H
Sbjct: 133 DCNKARYCPSNPDLIGSASSNGSIYVFDRTKHGFARQKLISAGDTDHQIHCQLSTSLEEH 192

Query: 196 KENGYGLSFNPNDKGKLLSGSDDGTIALWDIQE---NSTLAKKPLKIWDSVHNDIVNDCK 252
           K     L++N   +G L +    G + +WD+++   NS     PL +  +V     N+  
Sbjct: 193 KNEAVSLAWNWQRQGLLATSYSHGQVCVWDLEKYDKNSPTLINPLAM-STVDPRGSNEVS 251

Query: 253 WNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKT---TDPFNTLAFSKHSQYLMAAAGT 309
           W   + ++ A  SED+ + + D R      +S      ++  NT  F+ H   L+ +A +
Sbjct: 252 WMVRHDSLLAYCSEDNLVGIMDIRNPEKGQSSGSNPHHSNGINTCQFNYHRDMLLCSADS 311

Query: 310 DSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVI-MWDINDIGAE 368
              + L+D RN + PL ++  H DSI+ L+++P    VL + G D  ++ +WD+      
Sbjct: 312 AGRINLWDIRNFTQPLKTL-LHNDSISVLQWNPREPTVLATGGQDGGLVKIWDL------ 364

Query: 369 QIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKL 423
                ++    E+I  H GH   VND S +P+  W+M S   +N IQVW+ S+ L
Sbjct: 365 -----SQPEGQELIFTHGGHMLGVNDISWDPHDTWMMCSVANDNSIQVWRPSNSL 414

>Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  134 bits (338), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 107/414 (25%), Positives = 184/414 (44%), Gaps = 53/414 (12%)

Query: 39  IDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGE-- 96
           + E Y  WK N  L+YD+++     WP+LT ++ P   ++    N   ++L + TS +  
Sbjct: 19  LQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTL---NEHRILLSSFTSSQKP 75

Query: 97  EDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRA 156
           ED  + I+ I     +   S N+                  +  +  ++ F    E  RA
Sbjct: 76  EDETIYISRISTLGHIKWASLNNFDMDEMEFKPENTTTYPSKHLVDDIRIFFPNGECNRA 135

Query: 157 RFMPQNTDIIATINGSGTVFIYNQSND-----KQSALISTLRFHKENGYG---------- 201
           R++PQN DIIA  +  G ++I++++       +QS +           +G          
Sbjct: 136 RYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEIKLLGSHGVIQDVETMDT 195

Query: 202 ----------LSFNPNDKGKLLSGSDDGTIALWDIQENS---TLAKKPLKIWDSVHNDIV 248
                     L++N   +  LLS   +G I +WDI++ S    +   PL   DS     V
Sbjct: 196 SLVDINEATSLAWNLQQEALLLSSHSNGQIQVWDIKQYSHDNPIIDVPLMSIDS-DGSSV 254

Query: 249 NDCKWNEFNSNVFASVSEDSTLQLHDQREQNTII--NSIKTTDPFNTLAFSKHSQYLMAA 306
           ND  W   + ++FA+ +E + + L D R +   +  N        N+  F+  +  ++A+
Sbjct: 255 NDVTWMPTHDSLFAACTERNAVSLLDLRTKKEKLKSNCKIHGGGVNSCKFNYKNSLILAS 314

Query: 307 AGTDSLVYLYDSRNLSV-PLYSMNGHEDSITNLEFSPHTDGVLISSGN-DRRVIMWDIND 364
           A ++  + L+D RN++  P+ +M  H  S++ LE+SP+ D VL ++G  D  V +WD   
Sbjct: 315 ADSNGRLNLWDIRNMNENPIATME-HGASVSTLEWSPNFDTVLATAGQEDGLVKLWDTT- 372

Query: 365 IGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
                          E I  H GH   VND S + + PWLM S   +N + +WK
Sbjct: 373 -------------REESIFTHGGHMFGVNDISWDVHDPWLMCSVANDNSVHIWK 413

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score =  134 bits (336), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 100/401 (24%), Positives = 192/401 (47%), Gaps = 39/401 (9%)

Query: 39  IDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGE-- 96
           + + Y  WK N  L+Y++++     WP+LT +++P    +   S++  ++L + TS +  
Sbjct: 21  LQQRYTNWKKNTRLLYEYLNTNSTKWPSLTCQFMPDMDIA---SDKHRILLSSFTSAQLP 77

Query: 97  EDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRA 156
           ED  + I+ I     +   S N+   +          K        I  +F  E +  RA
Sbjct: 78  EDEAIYISEISTMKHIAWSSLNNFHMEEMEFKVDNQVKLSKNLTETIKIQFP-EGDCNRA 136

Query: 157 RFMPQNTDIIATINGSGTVFIYNQS---NDKQSALISTLRFHKE----------NGYGLS 203
           R+MPQN D+IA+ +  G+V+I++++   +++   L +T ++  E              L+
Sbjct: 137 RYMPQNPDVIASASSLGSVYIFDRTKHGSNRPKILGNTFKYDMELKEVESGCNYEASSLA 196

Query: 204 FNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWD---SVHNDIVNDCKWNEFNSNV 260
           +N    G L +   DG + +WDI + +  A+  L + D    V  +  N+  W   +S++
Sbjct: 197 WNYQRSGILAASYSDGDVKIWDITKYNK-AQPQLTVPDLRWQVDKEGANEVSWMVHHSSI 255

Query: 261 FASVSEDSTLQLHDQREQNTIINSIKT--TDPFNTLAFSKHSQYLMAAAGTDSLVYLYDS 318
            A   E + L + D R   T      +  T   N + F+  + +L+ +A ++  + + D 
Sbjct: 256 LAVCGEGNGLTILDTRTPTTFSTKRHSCHTGGINAVQFNYDNDFLLCSADSEGTLNICDI 315

Query: 319 RNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSG-NDRRVIMWDINDIGAEQIPDDAEDG 377
           R L  P+ + + H D+++ ++++P    V+ S+G ND  V +WD+           A++ 
Sbjct: 316 RQLEHPVKTWS-HLDAVSTIQWNPKFPTVIASAGQNDGLVKIWDL-----------AQED 363

Query: 378 APEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
            P ++ IH GH   VND + N + PW+M S   +N + +WK
Sbjct: 364 DP-LVFIHGGHMLGVNDIAWNHHDPWVMCSVSNDNSVHIWK 403

>TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {ON}
           Anc_8.548 YBR195C
          Length = 412

 Score =  130 bits (328), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 104/409 (25%), Positives = 186/409 (45%), Gaps = 45/409 (11%)

Query: 41  EEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGE--ED 98
           + Y  WK N  L+YD+++     WP+LT E+ P   ++T   +   L+L + TS +  ED
Sbjct: 17  QRYSNWKKNTKLLYDYLNTNSAKWPSLTCEFFPDLDTTT---DSHRLLLSSFTSSQLPED 73

Query: 99  NYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRARF 158
             + I+ I     +   S N+              K  PR+    +       +  RAR+
Sbjct: 74  ESIYISRISTLKHLHWSSLNNFDMDEMEFKPENSTKLPPRNLTDDISIRIPSGDSNRARY 133

Query: 159 MPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKE----------------NGYGL 202
           +PQN D+I+  +  G+++I++++    +   ST     E                    L
Sbjct: 134 LPQNPDVISAASSDGSIYIFDRTKHNSTISRSTTSRPYEIKLEVAPQVELMDSPNEVVSL 193

Query: 203 SFNPNDKGKLLSGSDDGTIALWDIQE----NSTLAKKPLKIWDSVHNDIVNDCKWNEFNS 258
            +N   +G L S    G + +WDI +    N T+ + P+   D       ND  W   + 
Sbjct: 194 DWNKRKEGILASCHSRGQLLVWDISQYLHSNPTI-QTPICSIDDFDPQGANDITWMPSHD 252

Query: 259 NVFASVSEDSTLQLHDQREQNTI--INSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLY 316
           ++ A+  E +T+ ++D R ++ +  I         N+  F+ H+ YL+A+A +   V+++
Sbjct: 253 SLLAACGESNTVAIYDTRSKSQVSKIQPGLHNGGINSCDFNAHNDYLLASADSIGTVHMW 312

Query: 317 DSRNLSV-PLYSMNGHEDSITNLEFSPHTDGVLISSGN-DRRVIMWDINDIGAEQIPDDA 374
           D R L   P+ S++ H  SI+ ++++P+   ++  +G  D  V +WD            A
Sbjct: 313 DIRKLDQDPIQSVS-HGSSISTVKWNPNVATIIAVAGQEDGLVKLWD------------A 359

Query: 375 EDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKL 423
            +G  ++I  H GH   VND + N + PWLM S   +N I +W+ S  L
Sbjct: 360 SNG--QLIFTHGGHMLGVNDIAWNAHDPWLMCSVSNDNSIHLWRPSSHL 406

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score =  129 bits (323), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 102/411 (24%), Positives = 202/411 (49%), Gaps = 32/411 (7%)

Query: 27  ETGNGDENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQE 86
           E G+G  N+   + + Y  WK N  L+YD+++     WP+L+ ++ P     T  +++Q 
Sbjct: 11  ELGSGISNE---VQQRYTNWKKNTKLLYDYLNTNTSKWPSLSCQFFPDR---TLTNDKQR 64

Query: 87  LILGTHTSGE--EDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIV 144
           ++L + TS +  +D  + I +I   + +   S N+              K   ++  + V
Sbjct: 65  ILLSSFTSQQLPQDESIYIGSISTMNHMKWSSINNFDMDEMEFKLDNSLKLNDKTLEEEV 124

Query: 145 KKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFH----KENG- 199
           +    + +  R R+MPQN DII T + +G+V+I++++  K    IST R      + NG 
Sbjct: 125 RITYPDGDCNRCRYMPQNPDIIGTASSNGSVYIFDRT--KHGNKISTGRKFEIECRNNGD 182

Query: 200 ------YGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKI--WDSVHN-DIVND 250
                   L++N   +G L +   +G + +WD+ +    +K+ ++I   +SV + + VND
Sbjct: 183 DEQDESLSLAWNYQLEGTLATCQSNGKVKVWDLTKFDK-SKQRMEIPERESVMDANGVND 241

Query: 251 CKWNEFNSNVFASVSEDSTLQLHDQREQNTI--INSIKTTDPFNTLAFSKHSQYLMAAAG 308
             W   ++++ AS  E + + L D R+   +  ++    TD  N + F+  +  ++    
Sbjct: 242 VSWMVNHTSILASCGESNVIGLIDIRQDTKMDTLHRTTHTDGINAIEFNYKNDMILCTGD 301

Query: 309 TDSLVYLYDSRNLSVPLYSM-NGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGA 367
           +   + ++D R+   P+    +G +D I+ ++++P    +L ++  D++  +  I D   
Sbjct: 302 SQGQLKIWDIRDFKEPIKEWEHGDQDPISAIQWNPQIPQILATA--DQQSGLVKIWDASG 359

Query: 368 EQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
           EQ   +AE+    ++ +H GH   VND S + + PW M S   +N I +WK
Sbjct: 360 EQEDSNAENNM--LLFVHGGHMLGVNDISWSQHDPWTMCSVSNDNSIHIWK 408

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score =  125 bits (314), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 109/422 (25%), Positives = 193/422 (45%), Gaps = 66/422 (15%)

Query: 39  IDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGE-- 96
           + + Y  WK N  L+YD+++     WP+LT ++    H     S+   ++L   TS +  
Sbjct: 18  LQQRYSNWKKNTRLLYDYLNTNSKKWPSLTCQFF---HDLDTTSDTHRILLSAFTSSQLP 74

Query: 97  EDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITR- 155
           ED  + IA +     +   S N+              + KP +NIK+  K    +   R 
Sbjct: 75  EDEAIYIAKLSTLKHLEWASINNFDMDE--------MEFKPENNIKLPSKNLTNDISIRF 126

Query: 156 -------ARFMPQNTDIIATINGSGTVFIYNQSNDKQSALIST--LRFHKENGY------ 200
                  AR++PQN D+IA  +  G+++I++++      +  +  L+ ++   Y      
Sbjct: 127 PDGDCNIARYLPQNPDVIAGASSHGSIYIFDRTKHGSLRMRQSKNLKPYEAALYCPPKGI 186

Query: 201 ----------GLSFNPNDKGKLLSGSDDGTIALWDIQE--NSTL-AKKPLKIWDSVHNDI 247
                      +S+N   +G L S    G I LWD+++  NS L    PL    +V  D 
Sbjct: 187 ENVENTNEATSISWNLQREGLLASCYSSGQIQLWDLKKYSNSKLEMDTPLL---NVDFDA 243

Query: 248 --VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKT--TDPFNTLAFSKHSQYL 303
             VND  W+  + ++ A+  E + + L D R    I+ S +       N+  F+ H   L
Sbjct: 244 LGVNDVNWHPSHDSILAASGESNIIGLFDNRLGTEILRSNEKMHNGGINSCKFNSHCDSL 303

Query: 304 MAAAGTDSLVYLYDSRNL-SVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVI-MWD 361
           + +  ++  + L+D R L   P+ +++ H  SI+ LE++P+ + ++ S+G D  ++ +WD
Sbjct: 304 LISGDSEGRINLWDLRKLDGEPIKTLH-HGSSISTLEWNPNLETIVASAGQDDGLVKLWD 362

Query: 362 INDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSH 421
           ++                E++  H GH   VND S N +  WLM S   +N +QVWK +H
Sbjct: 363 VS--------------TDELVFTHGGHMLGVNDISWNLHDTWLMCSVSNDNSVQVWKPAH 408

Query: 422 KL 423
            L
Sbjct: 409 NL 410

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score =  125 bits (313), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 94/407 (23%), Positives = 184/407 (45%), Gaps = 39/407 (9%)

Query: 41  EEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGE--ED 98
           + Y  WK N  L+Y++++     WP+LT +  P    +    +   ++L + TS +  ED
Sbjct: 23  QRYTHWKKNCKLLYEYLNTNNTKWPSLTCQLFPDLDLA---GDEHRILLSSFTSSQLPED 79

Query: 99  NYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRARF 158
             + +A +     +   S N+              K  P++ ++ ++      +  +AR+
Sbjct: 80  EAIYVARLSSMKHIPWSSLNNFDTDEMEFKMDNSLKLPPKNIVEDLRIKFPAGDCNKARY 139

Query: 159 MPQNTDIIATINGSGTVFIYNQSN--------------DKQ--SALISTLRFHKENGYGL 202
            P N D+I++ + +G+V++++++               D Q    L ++L   +     L
Sbjct: 140 CPSNPDLISSASSNGSVYVFDRTKHGSARQKLISGGDPDHQIHCQLSTSLEERQNEALNL 199

Query: 203 SFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI--VNDCKWNEFNSNV 260
           ++N   +G L +    G + +WD+ +    +   +    S+  D    ND  W   + ++
Sbjct: 200 AWNWQQQGLLATCYSGGEVCVWDLAKYDKASPTLIDPHSSLLADPQGSNDISWMVNHDSL 259

Query: 261 FASVSEDSTLQLHDQREQNTIINSIKT---TDPFNTLAFSKHSQYLMAAAGTDSLVYLYD 317
            A   E + L + D R       S      ++  N   F+ +   L+ +A +   + L+D
Sbjct: 260 LAYCGEGNALGVLDTRITKQPPQSFSNPHHSNGVNACQFNYYKDLLLCSADSAGRINLWD 319

Query: 318 SRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVI-MWDINDIGAEQIPDDAED 376
            R+ S P+ S++ H  S++ L+++PH   +L ++G D  ++ +WD++       P D E 
Sbjct: 320 IRDFSSPIRSLD-HHGSVSALQWNPHHPTILATAGQDDGLVKIWDLSQ------PVDQE- 371

Query: 377 GAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKL 423
               +   H GH   VND S +PN PW+M S   +N IQ+WK S  L
Sbjct: 372 ----LKFTHGGHMLGVNDISWDPNDPWMMCSVSNDNSIQLWKPSQNL 414

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 78.2 bits (191), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 87/406 (21%), Positives = 177/406 (43%), Gaps = 50/406 (12%)

Query: 51  PLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHT--SGEEDNYLKIAAID- 107
           P +Y+ +    L WP LT++ +P +  S   +  Q +++ T T  S ++DN L +  +  
Sbjct: 119 PTVYEMLHNVNLPWPCLTLDIIPDNLGSERRNYPQSILMTTATQASKKKDNELMVLKLSH 178

Query: 108 LPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRARFMP----QNT 163
           L   +V+   N              +      ++ +       +   R R  P    Q  
Sbjct: 179 LTKTLVKDDDNVDNEDDDEDDDEAGEPILENESLPL------RDTTNRLRISPYATVQQE 232

Query: 164 DIIATINGSGTVFIYNQSNDKQS-------------ALISTLRFHKE-NGYGLSFNPNDK 209
            + +T++ +G VFIY+ +   ++               + T+R H    GYGL ++P  K
Sbjct: 233 ILTSTMSENGEVFIYDLTPQTRAFETPGYQIPKTAKRPLHTIRNHGNVEGYGLDWSPLIK 292

Query: 210 -GKLLSGSDDGTIALWDIQENSTLA-KKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSED 267
            G LL+G   G + L     +  +  K P  +    +N  + D +W+   S VFA+   D
Sbjct: 293 TGALLTGDCSGMVYLTQRHTSKWVTDKTPFTV---GNNKSIEDIQWSRTESTVFATAGCD 349

Query: 268 STLQLHDQR--EQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS--- 322
             +++ D R  +   +I+++ +    N +++++   YL+A+        ++D R  S   
Sbjct: 350 GYIRIWDTRSKKHKPVISTVVSNTDVNVISWNEKMGYLLASGDDKGTWGIWDLRQFSPNS 409

Query: 323 ---VPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN-DIGAEQIPD------ 372
              +P+   + H+ +IT++ F+P  + ++  +  D  V +WD++ +   E+I        
Sbjct: 410 EKALPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQKAEIK 469

Query: 373 DAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
           + E   P+++ +H   +  V D   +  IP  + S   +  + VWK
Sbjct: 470 ELEQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 512

>Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W
           (REAL)
          Length = 1273

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 114/226 (50%), Gaps = 20/226 (8%)

Query: 161 QNTDIIATINGSGTVFIYNQSNDKQSALISTLRF--HKENGYGLSFNPNDKGKLLSGSDD 218
            N +IIA    +GT+ +Y+ +N+    + ST +F  H  +   + FN      L SG ++
Sbjct: 72  HNNEIIAGALDNGTLELYS-TNEANDTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNN 130

Query: 219 GTIALWDIQE--NSTLAKKPLKIWDSVHN-DIVNDCKWNEFNSNVFASVSEDSTLQLHDQ 275
           G I +WD+ +   S     PL    S+ + D VN   WN+  ++VFAS    +   + D 
Sbjct: 131 GEIFIWDMNKCTESPSTYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDL 190

Query: 276 REQNTIINSIKTTDPFNTLA--------FSKHSQYLMAAAGTDS--LVYLYDSRNLSVPL 325
           + +  +I+ +  T P + +           K+S  +  A G+D+   + ++D RN + P+
Sbjct: 191 KAKKEVIH-LSYTSPSSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPM 249

Query: 326 YSMN-GHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQI 370
            ++N GH+  I +L++    + +L+SSG D  V++W  N   AEQ+
Sbjct: 250 QTLNQGHQKGILSLDWCDQDENLLLSSGRDNTVLLW--NPESAEQL 293

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 74/172 (43%), Gaps = 11/172 (6%)

Query: 260 VFASVSEDSTLQLHD--QREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYD 317
           V A+ S DS+L+L      +    + S++    FN L +S H+  ++A A  +  + LY 
Sbjct: 32  VDANFSTDSSLELWSLLATDSEKPLASLQVDSKFNDLDWS-HNNEIIAGALDNGTLELYS 90

Query: 318 SRNLSVPLYS---MNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDA 374
           +   +  + S      H  S+  ++F+   D VL S GN+  + +WD+N     + P   
Sbjct: 91  TNEANDTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNGEIFIWDMNK--CTESPSTY 148

Query: 375 EDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIV 426
               P   M        VN  + N ++  + ASA   N   +W    K  ++
Sbjct: 149 TPLTPGQSMSSVDE---VNSLAWNQSLAHVFASAGSSNFASIWDLKAKKEVI 197

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 89/408 (21%), Positives = 180/408 (44%), Gaps = 54/408 (13%)

Query: 51  PLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHT--SGEEDNYLKIAAIDL 108
           P +YD +    + WP LT++ +P +  S   +  Q L++ T T  S +++N L + ++  
Sbjct: 119 PTVYDMLHNVTMPWPCLTLDIIPDNLGSQRRNYPQSLLMTTATQASRKKENELMVLSLSQ 178

Query: 109 PDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRARFMP---QNTDI 165
             + +    + + +                 NI +       +   R R  P    N ++
Sbjct: 179 LAKTLVKDDDEVNSDEEDEDRDETDPIIENENISL------RDTTNRLRVSPFAQSNKEV 232

Query: 166 I-ATINGSGTVFIYN-------------QSNDKQSALISTLRFHKE-NGYGLSFNPNDK- 209
           + AT++ +G V+I++             Q        + T++ H    GY L ++P  K 
Sbjct: 233 LTATMSENGEVYIFDLGPQSKAFSSPGYQVPKSSKRPVHTIKNHGNVEGYALDWSPLIKT 292

Query: 210 GKLLSGSDDGTIALWDIQENST---LAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSE 266
           G LL+G   G I L   Q N++     K+P  +    +N  V D +W+   + VFAS   
Sbjct: 293 GALLTGDCSGQIYL--TQRNTSKWVTDKQPFTV---GNNKSVEDIQWSRTEATVFASCGC 347

Query: 267 DSTLQLHDQR-EQNTIINSIKTTDP-FNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS-- 322
           D  +++ D R +Q+    S+K ++   N +++++   YL+A+   +    ++D R  +  
Sbjct: 348 DGYVRIWDTRSKQHKPALSVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPD 407

Query: 323 -----VPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN-DIGAEQIPDDA-- 374
                 P+   + H+ +IT++ F+P  + ++  +  D  V +WD++ +   E+I   A  
Sbjct: 408 NINNVQPVAQYDFHKGAITSISFNPLEESIIAVASEDNTVTLWDLSVEADDEEIKQQAAE 467

Query: 375 ----EDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
               E   P+++ +H   +  V D   +  IP  + S   +  + +WK
Sbjct: 468 TKELESIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 512

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 89/405 (21%), Positives = 180/405 (44%), Gaps = 48/405 (11%)

Query: 51  PLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHT--SGEEDNYLKIAAIDL 108
           P +Y+ +    L WP +T++ +P    S   +  Q +++ T T  S +++N L + ++  
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDVIPDKLGSERRNYPQSILMTTATQASKKKENELMVLSLSQ 179

Query: 109 PDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRARFMP-QNTD--- 164
            ++ +  S                       NIK+       +   R +  P  +TD   
Sbjct: 180 LNKTLVKSEEDEDEDEDSDEEDDSDPIIENENIKL------NDTTNRLKVSPFASTDKEV 233

Query: 165 IIATINGSGTVFIYNQSNDKQS-------------ALISTLRFHKE-NGYGLSFNPNDK- 209
           + AT++ +G V+I++ +   ++               I T+R H    GY L ++P  K 
Sbjct: 234 LTATMSENGEVYIFDLAPQSKAFSTPGYQIPKTARRPIHTVRNHGNVEGYALDWSPMIKN 293

Query: 210 GKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDST 269
           G LL+G   G I       +  +  K  + + + +N  V D +W+   S VFAS   D  
Sbjct: 294 GALLTGDCSGQIYFTQRHTSKWITDK--QPFTAENNKSVEDIQWSRTESTVFASAGCDGY 351

Query: 270 LQLHDQR-EQNTIINSIKTTDP-FNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS----- 322
           +++ D R +++    S+K ++   N +++S+   YL+A+   + L  ++D R  S     
Sbjct: 352 IRIWDTRSKKHKPALSVKASNTDVNVISWSEKIGYLLASGDDNGLWGVWDLRQFSPDNIN 411

Query: 323 --VPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDI-----NDIGAEQIPD--D 373
              P+   + H+ +IT++ F+P  D ++  +  D  V +WD+     ++   +QI +  +
Sbjct: 412 DVQPVAQYDFHKGAITSINFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQIAETKE 471

Query: 374 AEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
            E   P+++ +H   +  V D   +  IP  + S   +  + +WK
Sbjct: 472 LEKIPPQLLFVH--WQKDVKDVKWHKQIPGCLVSTGTDG-LNIWK 513

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 95/453 (20%), Positives = 198/453 (43%), Gaps = 56/453 (12%)

Query: 6   AKLLEKLAADPSMLAQLTNQEETGNGDE------NKELTIDE--EYDLWKSNVPLMYDFV 57
           +  L+K  A      +  NQ+E G G+E      ++ L  DE  E D      P +Y+ +
Sbjct: 73  SAFLQKKEAKAKETIEKDNQQEKG-GEELYLPHMSRPLGPDEVLEAD------PTVYEML 125

Query: 58  SETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGEEDNYLKIAAIDLPDEVVQPST 117
               + WP L+++ +P +  S   +  Q +++ T T   +    ++  + L +     + 
Sbjct: 126 HNVNMPWPCLSLDIIPDTLGSERRNYPQSILMTTATQASKKKENELMVLSLSN----LTK 181

Query: 118 NSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRARFMPQNTDII-ATINGSGTVF 176
             LK +            +P    + +        I  + F  Q+ +++ AT++ +G V+
Sbjct: 182 TLLKDEEEEEEEEDDDDVEPIIENENIALRDTTNRIKVSPFASQSQEVLTATMSENGEVY 241

Query: 177 IYN-------------QSNDKQSALISTLRFHKE-NGYGLSFNPNDK-GKLLSGSDDGTI 221
           I++             Q   +    + T+R H    GYGL ++P  K G LLSG   G I
Sbjct: 242 IFDIGAQAKCFNSPGYQIPKQSKRPVHTIRNHGNVEGYGLDWSPLIKSGALLSGDCSGQI 301

Query: 222 ALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQR-EQNT 280
            L   Q +++      + +   +N  + D +W++  S VFA+   D  +++ D R +++ 
Sbjct: 302 YL--TQRHTSKWVTDKQAYSVGNNKSIEDIQWSKTESTVFATAGCDGYIRVWDTRSKKHK 359

Query: 281 IINSIKTTDP-FNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS-------VPLYSMNGHE 332
              S+K ++   N +++++   YL+A+   +    ++D R  +        P+   N H+
Sbjct: 360 PAISVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDNAANIQPVAQYNFHK 419

Query: 333 DSITNLEFSPHTDGVLISSGNDRRVIMWDIN-DIGAEQIPDDAEDGA------PEVIMIH 385
            +IT++ F+P  + ++     D  V +WD++ +   E+I    E+        P+++ +H
Sbjct: 420 GAITSIAFNPLEESIVAVGSEDNTVTLWDLSVEADDEEIKQQTEETKELKEIPPQLLFVH 479

Query: 386 AGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
              +  + D   +  IP  + S   +  + +WK
Sbjct: 480 --WQKEIKDVKWHKQIPGCLVSTGTDG-LNIWK 509

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 72.0 bits (175), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 90/406 (22%), Positives = 170/406 (41%), Gaps = 49/406 (12%)

Query: 51  PLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSG--EEDNYLKIAAI-D 107
           P +Y+ +    + WP +T++ +P +  S   S  Q L+L T T    ++DN L +  +  
Sbjct: 118 PSVYEMLHNVNMPWPCMTLDVIPDTLGSERRSYPQSLLLTTATQATRKKDNELMVLKLSQ 177

Query: 108 LPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRARFMPQNTD--- 164
           L   +V+  T                      NI +      ++   R +  P  T    
Sbjct: 178 LSKTLVKDDTEENDEDDEDDEDADSDPIIENENIAL------KDTTNRLKVSPFATHGQE 231

Query: 165 -IIATINGSGTVFIYN-------------QSNDKQSALISTLRFHKE-NGYGLSFNPNDK 209
            + AT+  +G V++++             Q        I T+R H    GYGL ++P  K
Sbjct: 232 VLTATMCENGEVYVFDLGAQTKAFETPGYQVPKTSRKAIHTIRNHGNVEGYGLDWSPLIK 291

Query: 210 -GKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDS 268
            G LL+G   G I L     +  +  K  + + + +N  V D +W+   S VFA+   D 
Sbjct: 292 TGALLTGDCSGQIFLTQRHTSKWITDK--QPFTAANNQSVEDIQWSPTESTVFATSGTDG 349

Query: 269 TLQLHDQR--EQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS---- 322
            +++ D R  +    I++  +    N +++++   YL+A+   +    ++D R  S    
Sbjct: 350 YVRIWDTRSKKHKPAISTRASNTDVNVISWNEKLGYLLASGDDNGSWGVWDLRQFSPANS 409

Query: 323 ---VPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDI-----NDIGAEQIPD-- 372
               P+   + H   IT++ F+P  D V+  +  D  V +WD+     +D   +Q  +  
Sbjct: 410 EGVQPVAQYDFHRGPITSISFNPLDDSVVAVASEDNTVTLWDLSVEADDDEIQQQTKEYK 469

Query: 373 DAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
           + +   P+++ +H   +  V D   +  IP  + S   +  + VWK
Sbjct: 470 ELQKIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 512

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 72.0 bits (175), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 86/405 (21%), Positives = 182/405 (44%), Gaps = 49/405 (12%)

Query: 51  PLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELIL--GTHTSGEEDNYLKIAAIDL 108
           P +Y+ +    + WP LT++ +P +  +   +  Q ++L   T +S +++N L + A+  
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGTERRNYPQSILLTTATQSSRKKENELMVLAL-- 171

Query: 109 PDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRARFMP---QNTDI 165
                   T +L            + ++    +   +     +   R +  P    N ++
Sbjct: 172 -----SNLTKTLLKDDNEEDDEEGEDEEDVDPVIENENIPLRDTTNRLKVSPFAVSNQEV 226

Query: 166 I-ATINGSGTVFIYNQSNDKQS-------------ALISTLRFHKE-NGYGLSFNPNDK- 209
           + AT++ +G V+IY+ +   ++               I T++ H    GYGL ++P  K 
Sbjct: 227 LTATMSENGDVYIYDLAAQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKT 286

Query: 210 GKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDST 269
           G LLSG   G I L   Q +++      + +   +N+ + D +W+   S VFA+ + D  
Sbjct: 287 GALLSGDCSGQIYL--TQRHTSRWVTDKQSFTVSNNESIEDIQWSRTESTVFATAACDGY 344

Query: 270 LQLHDQR-EQNTIINSIKTTDP-FNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS----- 322
           +++ D R +++    S+K ++   N +++S    YL+A+   +    ++D R  +     
Sbjct: 345 IRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNAD 404

Query: 323 --VPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN-DIGAEQIPDDA----- 374
              P+   + H+ +IT++ F+P  + ++     D  V +WD++ +   E+I   A     
Sbjct: 405 TVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKE 464

Query: 375 -EDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
            +D  P+++ +H   +  V D   +  IP  + S   +  + VWK
Sbjct: 465 LQDIPPQLLFVH--WQREVKDVKWHKQIPGCLVSTGTDG-LNVWK 506

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 87/404 (21%), Positives = 177/404 (43%), Gaps = 47/404 (11%)

Query: 51  PLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELIL--GTHTSGEEDNYLKIAAI-D 107
           P +Y+ +    + WP LT++ +P +  S   +  Q ++L   T +S +++N L + A+ +
Sbjct: 115 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 174

Query: 108 LPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRARFMPQNTDII- 166
           L   +++        +             P    + +        +  + F   N +++ 
Sbjct: 175 LAKTLLKDDNEGEDDEEDDE-----DDVDPVIENENIPLRDTTNRLKVSPFAISNQEVLT 229

Query: 167 ATINGSGTVFIYN-------------QSNDKQSALISTLRFHKE-NGYGLSFNPNDK-GK 211
           AT++ +G V+IYN             Q        I T++ H    GYGL ++P  K G 
Sbjct: 230 ATMSENGDVYIYNLAPQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGA 289

Query: 212 LLSGSDDGTIALWDIQENSTLA-KKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTL 270
           LLSG   G I       +  +  K+P  +    +N  + D +W+   S VFA+   D  +
Sbjct: 290 LLSGDCSGQIYFTQRHTSRWVTDKQPFTV---SNNKSIEDIQWSRTESTVFATAGCDGYI 346

Query: 271 QLHDQR-EQNTIINSIKTTDP-FNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS------ 322
           ++ D R +++    S+K ++   N +++S    YL+A+   +    ++D R  +      
Sbjct: 347 RIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADA 406

Query: 323 -VPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN-DIGAEQIPDDA------ 374
             P+   + H+ +IT++ F+P  + ++     D  V +WD++ +   E+I   A      
Sbjct: 407 VQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKEL 466

Query: 375 EDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
           ++  P+++ +H   +  V D   +  IP  + S   +  + VWK
Sbjct: 467 QEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 507

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 88/408 (21%), Positives = 178/408 (43%), Gaps = 56/408 (13%)

Query: 51  PLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHT--SGEEDNYLKIAAIDL 108
           P +Y+ +    + WP LT++ +P +  S   +  Q ++L T T  S + +N L + A+  
Sbjct: 114 PSVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLATATQSSRKRENELMVLAL-- 171

Query: 109 PDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRAR-----FMPQNT 163
                   +N  K            +++      +++      + T  R     F   N 
Sbjct: 172 --------SNLTKTLLKDDNEEDDDEEEEDDVDAVIENENMPLKDTTNRLKVSPFAASNQ 223

Query: 164 DII-ATINGSGTVFIYN-------------QSNDKQSALISTLRFHKE-NGYGLSFNPND 208
           +++ AT++ +G V+IY+             Q +      I T++ H    GYGL ++P  
Sbjct: 224 EVLTATMSENGDVYIYDLAPQSKAFSTPGYQISKSAKRPIHTVKSHGNVEGYGLDWSPLI 283

Query: 209 K-GKLLSGSDDGTIALWDIQENSTLA-KKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSE 266
           K G LLSG   G I       +  +  K+P  +    +N  + D +W+   S VFA+   
Sbjct: 284 KTGALLSGDCSGQIYFTQRHTSRWVTDKQPFTV---SNNKSIEDIQWSRTESTVFATAGC 340

Query: 267 DSTLQLHDQR-EQNTIINSIKTTDP-FNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS-- 322
           D  +++ D R +++    S+K ++   N +++S    YL+A+   +    ++D R  +  
Sbjct: 341 DGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPS 400

Query: 323 -----VPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN-DIGAEQIPD---- 372
                 P+   + H+ +IT++ F+P  + ++     D  V +WD++ +   E+I      
Sbjct: 401 NADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAE 460

Query: 373 --DAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
             + ++  P+++ +H   +  V D   +  IP  + S   +  + VWK
Sbjct: 461 TKELQEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 505

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 82/403 (20%), Positives = 169/403 (41%), Gaps = 45/403 (11%)

Query: 51  PLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGEEDNYLKIAAIDLPD 110
           P +Y+ +    + WP LT++ +P    +   +  Q +++ T T   +    ++  + L  
Sbjct: 118 PTVYEMLHNVNMPWPCLTLDIIPDGLGTERRNYPQSILMATATQASKKKENELMVLKLS- 176

Query: 111 EVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRARFMPQNTD---IIA 167
              Q +   +K            +      I   ++    +   R +  P  +    + A
Sbjct: 177 ---QLNKTLVKDDADEEEDDEDDEDNDSDPIIENEEISLRDTTNRLKISPFASSQEVLTA 233

Query: 168 TINGSGTVFIYN-------------QSNDKQSALISTLRFHKE-NGYGLSFNPNDK-GKL 212
           T++ +G V+I++             Q        + T+R H    GYGL ++P  K G L
Sbjct: 234 TMSENGEVYIHDLGPQTKAFETPGYQIPKSAKKPLHTIRNHGNVEGYGLDWSPLIKTGAL 293

Query: 213 LSGSDDGTIALWDIQENSTLA-KKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQ 271
           L+G   G + L     +  +  K+P       +N  + D +W+   S VFA+   D  ++
Sbjct: 294 LTGDCSGQVYLTQRHTSKWVTDKQPFTF---SNNKSIEDIQWSRTESTVFATSGCDGYIR 350

Query: 272 LHDQR--EQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS------- 322
           + D R  +    I++  +    N +++++   YL+A+   D    ++D R LS       
Sbjct: 351 IWDTRSKKHKPAISTRASATDVNVISWNEKIGYLLASGDDDGRWGVWDLRQLSPNNSENV 410

Query: 323 VPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN-DIGAEQIPDDAEDGA--- 378
            P+   + H+ +IT++ F+P  + ++  +  D  V +WD++ +   E+I   A +     
Sbjct: 411 QPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQ 470

Query: 379 ---PEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
              P+++ +H   +  V D   +  IP  + S   +  + VWK
Sbjct: 471 QIPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNVWK 510

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 85/408 (20%), Positives = 178/408 (43%), Gaps = 53/408 (12%)

Query: 51  PLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHT--SGEEDNYLKIAAIDL 108
           P +Y+ +    + WP +T++ +P S  S   +  Q +++ T T  S ++DN L +  +  
Sbjct: 122 PTVYEMLHNVNMPWPCMTLDIIPDSLGSERRNYPQSILMTTATQASKKKDNELMVLKLS- 180

Query: 109 PDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRARFMPQNTD---- 164
                   T +L  +                 I   +  +  +   R +  P  +     
Sbjct: 181 ------QLTKTLAKEDNGEDEEEEDDDDTVDPIIENENIQLRDTTNRLKVSPFASSSNSQ 234

Query: 165 --IIATINGSGTVFIYNQSNDKQS-------------ALISTLRFHKE-NGYGLSFNPND 208
             + AT++ +G V+I++ ++  ++               I T++ H    GY L ++P  
Sbjct: 235 EILTATMSENGEVYIFDLASQVKAFKTPGYQIPKAAKKPIHTIKSHGNVEGYALDWSPLI 294

Query: 209 K-GKLLSGSDDGTIALWDIQENSTLA-KKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSE 266
           K G LL+G   G + L     +  ++ K+P  +    +N  V D +W+   S VFAS   
Sbjct: 295 KTGALLTGDCSGQVYLTQRHTSKWISDKEPFTV---ANNQSVEDIQWSRTESTVFASCGC 351

Query: 267 DSTLQLHDQR-EQNTIINSIKTTDP-FNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS-- 322
           D  +++ D R +++    S+K ++   N +++S+   YL+A+   +    ++D R  S  
Sbjct: 352 DGYIRVWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDNGTWGVWDLRQFSPS 411

Query: 323 -----VPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN-DIGAEQIPDDAED 376
                 P+   + H+ +IT++ F+P  + ++  +  D  V +WD++ +   E+I   A +
Sbjct: 412 NSNNTSPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAAE 471

Query: 377 GA------PEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
                   P+++ +H   +  V D   +  IP  + S   +  + +WK
Sbjct: 472 TKELQQIPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNIWK 516

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 89/405 (21%), Positives = 181/405 (44%), Gaps = 50/405 (12%)

Query: 53  MYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHT--SGEEDNYLKIAAIDLPD 110
           +Y+ +    L+WP ++++ +P S  +   +  Q ++L T T  S ++DN L I       
Sbjct: 129 VYEMLHNVNLSWPCMSLDIIPDSLGNERRNYPQSILLTTATQASKKKDNELMIL------ 182

Query: 111 EVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVK--KFKHEEEITRARFMPQNTD---- 164
           ++ Q +   LK           +  + R +  I++       +   R +  P  T+    
Sbjct: 183 QLSQLTKTLLKEDDDDNDDEDDEDDEDRESDPILEDANVALRDTTNRLKVTPFATNNNQE 242

Query: 165 -IIATINGSGTVFIYNQSND------------KQSAL-ISTLRFHKE-NGYGLSFNPNDK 209
            + AT++ +G V+I++  N             KQS   I T+R H    G+GL ++P  K
Sbjct: 243 ILTATMSENGEVYIFDIINQVKSFQIPGYQVSKQSKRPIHTIRSHGNVEGFGLDWSPLIK 302

Query: 210 -GKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDS 268
            G LL+G   G I L     +  + +K  + +   +N  + D +W++    VFA+   D 
Sbjct: 303 SGALLTGDCSGEIFLTSRHTSKWITEK--QSFSVGNNKSIEDIQWSKTEQTVFATAGCDG 360

Query: 269 TLQLHDQR--EQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS---- 322
            +++ D R  +    I++  +    N +++++  +YL+A+     +  ++D R  S    
Sbjct: 361 YIRIWDTRSKKHKPAISTRASNVDVNVISWNEKMEYLLASGDDKGVWGVWDLRQFSPSQE 420

Query: 323 --VPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN-DIGAEQIPD------D 373
              P+   + H+ +IT++ F+P  +  +  +  D  V +WD++ +   E+I        +
Sbjct: 421 NASPVAQYDFHKGAITSISFNPLDESTVAVASEDNTVTLWDLSVEADDEEIKQQTHETKE 480

Query: 374 AEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
            E   P+++ +H   +  V D   +  IP  + S   +  + VWK
Sbjct: 481 LEQIPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNVWK 522

>Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W
           (REAL)
          Length = 1270

 Score = 69.7 bits (169), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 113/226 (50%), Gaps = 20/226 (8%)

Query: 161 QNTDIIATINGSGTVFIYNQSNDKQSALISTLRF--HKENGYGLSFNPNDKGKLLSGSDD 218
            N  IIA    +G++ +Y+ +N+   A+ S  +F  H  +   + FN      L SG ++
Sbjct: 72  HNNKIIAGALDNGSLELYS-TNEVNDAISSMAKFSNHSSSVKTVKFNAKQDNVLASGGNN 130

Query: 219 GTIALWDIQE--NSTLAKKPLKIWDSVHN-DIVNDCKWNEFNSNVFASVSEDSTLQLHDQ 275
           G I +WD+ +   S     PL    S+ + D VN   WN+  ++VFAS    +   + D 
Sbjct: 131 GEIFIWDMNKCTESPANYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDL 190

Query: 276 REQNTIINSIKTTDPFNTLA--------FSKHSQYLMAAAGTDS--LVYLYDSRNLSVPL 325
           + +  +I+ +  T P + +           K+S  +  A G+D+   + ++D RN + PL
Sbjct: 191 KAKKEVIH-LCYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPL 249

Query: 326 YSMN-GHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQI 370
            ++N GH+  I +L++    + +L+SSG D  V++W  N   AEQ+
Sbjct: 250 QTLNQGHQKGILSLDWCHQDENLLLSSGRDNTVLLW--NPELAEQL 293

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 78/172 (45%), Gaps = 11/172 (6%)

Query: 260 VFASVSEDSTLQLHD--QREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYD 317
           V A+ S DS+L+L      +    I S++    FN L +S H+  ++A A  +  + LY 
Sbjct: 32  VDANFSSDSSLELWSLLASDSEKPIASLQVDSKFNDLDWS-HNNKIIAGALDNGSLELYS 90

Query: 318 SRNLSVPLYSM---NGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDA 374
           +  ++  + SM   + H  S+  ++F+   D VL S GN+  + +WD+N     + P + 
Sbjct: 91  TNEVNDAISSMAKFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNK--CTESPANY 148

Query: 375 EDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIV 426
               P   M        VN  + N ++  + ASA   N   +W    K  ++
Sbjct: 149 TPLTPGQSMSSVDE---VNSLAWNQSLAHVFASAGSSNFASIWDLKAKKEVI 197

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 68.9 bits (167), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 86/179 (48%), Gaps = 16/179 (8%)

Query: 204 FNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFAS 263
           +NP D   L+S S D T  +WD+Q ++ +  + +      H+  V D ++   ++ +FAS
Sbjct: 240 WNPIDTNLLISSSIDTTCIVWDLQSSNYVKTQLI-----AHDSEVYDVRFLTQSTQLFAS 294

Query: 264 VSEDSTLQLHDQRE--QNTIINSIKTTD------PFNTLAF--SKHSQYLMAAAGTDS-L 312
              D ++++ D R    +TII     +D       F  L    S H   +MA    DS  
Sbjct: 295 CGGDGSVRVFDLRSLAHSTIIYEPPVSDLNPDTSQFALLRLEPSPHDPNVMATFAADSNK 354

Query: 313 VYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIP 371
           + + D RN   PL  + GH  S+  +++ P    VL+S G+D +V+ WD+N   A   P
Sbjct: 355 ILILDMRNPESPLMILEGHSASVNQIKWHPIKRNVLLSGGDDCQVLYWDLNKCTASSDP 413

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 66/158 (41%), Gaps = 13/158 (8%)

Query: 139 SNIKIVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKEN 198
           SN    +   H+ E+   RF+ Q+T + A+  G G+V +++  +   S +I        N
Sbjct: 265 SNYVKTQLIAHDSEVYDVRFLTQSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPVSDLN 324

Query: 199 GYGLSF-------NPNDKGKLLS-GSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVND 250
                F       +P+D   + +  +D   I + D++      + PL I +  H+  VN 
Sbjct: 325 PDTSQFALLRLEPSPHDPNVMATFAADSNKILILDMRN----PESPLMILEG-HSASVNQ 379

Query: 251 CKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTT 288
            KW+    NV  S  +D  +   D  +     + + TT
Sbjct: 380 IKWHPIKRNVLLSGGDDCQVLYWDLNKCTASSDPVATT 417

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 69.7 bits (169), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 139/298 (46%), Gaps = 39/298 (13%)

Query: 135 QKPRSNIKIVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRF 194
           +KP +++++  KF   +          N   IA    +GT+ +Y+   D    ++ST +F
Sbjct: 53  EKPMASLQVDSKFNDLD-------WSHNNKTIAGALDNGTLELYS-IGDAHDTIVSTAKF 104

Query: 195 --HKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQE--NSTLAKKPLKIWDSVHN-DIVN 249
             H  +   + FN      L SG ++G I +WD+ +   S  +  PL    S+ + D VN
Sbjct: 105 SNHSSSVKTVKFNSKQDNVLASGGNNGEIFIWDMNKCTESPSSYTPLTPGQSMSSVDEVN 164

Query: 250 DCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLA--------FSKHSQ 301
              WN+  ++VFAS    +   + D + +  +I+ +  T P + +           K+S 
Sbjct: 165 SLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIH-LSYTSPNSGIKQQLSVVEWHPKNST 223

Query: 302 YLMAAAGTDS--LVYLYDSRNLSVPLYSMN-GHEDSITNLEFSPHTDGVLISSGNDRRVI 358
            +  A G+D+   + ++D RN + PL +++ GH+  I +L++    + +L+SSG D  V+
Sbjct: 224 RVATATGSDNDPSILVWDLRNANTPLQTLSQGHQKGILSLDWCHQDENLLLSSGRDNTVL 283

Query: 359 MWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQV 416
           +W+         P+ AE+ +        G+      F+  P  P L A A  +N I+V
Sbjct: 284 LWN---------PESAEELS---QFPSRGNWCFKTKFA--PEAPDLFACASFDNRIEV 327

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 74/171 (43%), Gaps = 9/171 (5%)

Query: 260 VFASVSEDSTLQLHD--QREQNTIINSIKTTDPFNTLAFSKHSQYLMAAA--GTDSLVYL 315
           V A+ S DS+L+L      +    + S++    FN L +S +++ +  A   GT  L  +
Sbjct: 32  VDANFSTDSSLELWSLLTTDSEKPMASLQVDSKFNDLDWSHNNKTIAGALDNGTLELYSI 91

Query: 316 YDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAE 375
            D+ +  V     + H  S+  ++F+   D VL S GN+  + +WD+N     + P    
Sbjct: 92  GDAHDTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIFIWDMNK--CTESPSSYT 149

Query: 376 DGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIV 426
              P   M        VN  + N ++  + ASA   N   +W    K  ++
Sbjct: 150 PLTPGQSMSSVDE---VNSLAWNQSLAHVFASAGSSNFASIWDLKAKKEVI 197

>YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}
           SEC31Component of the Sec13p-Sec31p complex of the COPII
           vesicle coat, required for vesicle formation in ER to
           Golgi transport; mutant has increased aneuploidy
           tolerance
          Length = 1273

 Score = 69.3 bits (168), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 113/226 (50%), Gaps = 20/226 (8%)

Query: 161 QNTDIIATINGSGTVFIYNQSNDKQSALISTLRF--HKENGYGLSFNPNDKGKLLSGSDD 218
            N  IIA    +G++ +Y+ +N+  +A+ S  RF  H  +   + FN      L SG ++
Sbjct: 72  HNNKIIAGALDNGSLELYS-TNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLASGGNN 130

Query: 219 GTIALWDIQE--NSTLAKKPLKIWDSVHN-DIVNDCKWNEFNSNVFASVSEDSTLQLHDQ 275
           G I +WD+ +   S     PL    S+ + D V    WN+  ++VFAS    +   + D 
Sbjct: 131 GEIFIWDMNKCTESPSNYTPLTPGQSMSSVDEVISLAWNQSLAHVFASAGSSNFASIWDL 190

Query: 276 REQNTIINSIKTTDPFNTLA--------FSKHSQYLMAAAGTDS--LVYLYDSRNLSVPL 325
           + +  +I+ +  T P + +           K+S  +  A G+D+   + ++D RN + PL
Sbjct: 191 KAKKEVIH-LSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILIWDLRNANTPL 249

Query: 326 YSMN-GHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQI 370
            ++N GH+  I +L++    + +L+SSG D  V++W  N   AEQ+
Sbjct: 250 QTLNQGHQKGILSLDWCHQDEHLLLSSGRDNTVLLW--NPESAEQL 293

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 76/172 (44%), Gaps = 11/172 (6%)

Query: 260 VFASVSEDSTLQLHD--QREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYD 317
           V A+ S DS+L+L      +    I S++    FN L +S H+  ++A A  +  + LY 
Sbjct: 32  VDANFSTDSSLELWSLLAADSEKPIASLQVDSKFNDLDWS-HNNKIIAGALDNGSLELYS 90

Query: 318 SRNLSVPLYSM---NGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDA 374
           +   +  + SM   + H  S+  ++F+   D VL S GN+  + +WD+N     + P + 
Sbjct: 91  TNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNK--CTESPSNY 148

Query: 375 EDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIV 426
               P   M        V   + N ++  + ASA   N   +W    K  ++
Sbjct: 149 TPLTPGQSMSSVDE---VISLAWNQSLAHVFASAGSSNFASIWDLKAKKEVI 197

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 89/409 (21%), Positives = 176/409 (43%), Gaps = 57/409 (13%)

Query: 51  PLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHT--SGEEDNYLKIAAI-D 107
           P +Y+ +    L WP L+++ +P    S   +  Q L+L T T  S ++DN L +  +  
Sbjct: 126 PTVYEMLHNVNLPWPCLSLDIVPDKLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQ 185

Query: 108 LPDEVVQPSTNSLKAQRXXXXXXXXQKQKP---RSNIKIVKKFKHEEEITRARFMPQNTD 164
           L   +V+   N  +           + Q P     NI +      ++   R +  P  ++
Sbjct: 186 LAKTLVKDDNNEEEDDDDED-----EDQDPIVENENIPL------KDTTNRLKVSPFASE 234

Query: 165 ----IIATINGSGTVFIYN-------------QSNDKQSALISTLRFHKE-NGYGLSFNP 206
               + AT++ +G V+I++             Q        I T+R H    GY L ++P
Sbjct: 235 SPEKLTATMSENGEVYIFDLGPQVKAFEIPGYQLPKTAKKPIHTVRSHGNVEGYALDWSP 294

Query: 207 -NDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVS 265
            N  G LL+G   G + L     +  +  K    + + +N  + D +++   + VFAS  
Sbjct: 295 LNKSGSLLTGDCSGRVYLTQRHTSKWITDK--TAFSAGNNQSIEDIQFSRTEATVFASCG 352

Query: 266 EDSTLQLHDQR--EQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS- 322
            D  +++ D R  +    I+   +    N +++++   YL+A+   +    ++D R  S 
Sbjct: 353 CDGYIRIWDTRSKKHKPAISVKASATDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFSP 412

Query: 323 ------VPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN-DIGAEQIPDDA- 374
                  P+   N H+ +IT++ F+P  D ++  +  D  V +WD++ +   E+I   A 
Sbjct: 413 NTAASTSPVAQYNFHKGAITSISFNPLDDSIIAVASEDNTVSLWDLSVEADDEEIKQQAA 472

Query: 375 -----EDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
                ++  P+++ +H   +  V D   +  IP  + S   +  + +WK
Sbjct: 473 ETRELQEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 518

>Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 65/218 (29%), Positives = 107/218 (49%), Gaps = 39/218 (17%)

Query: 203 SFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFA 262
           + +P D    ++GS+D T+ +WD      LA   LK+  + H   V D   ++ +  +F 
Sbjct: 146 AIDPVDNEWFVTGSNDTTMKVWD------LASGKLKVTLTGHVMTVRDIAVSDRHPYLF- 198

Query: 263 SVSEDSTLQLHDQREQNTII-------NSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYL 315
           SVSED T++  D  E+N II       + ++T     TL        L+A AG DS+V L
Sbjct: 199 SVSEDKTVKCWDL-EKNQIIRDYHGHLSGVRTVSIHPTLD-------LIATAGRDSVVKL 250

Query: 316 YDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAE 375
           +D R   VP+ ++ GH+  I  +E +P  D  ++SS  D  V +WDI             
Sbjct: 251 WDIRT-RVPVITLVGHKGPINQVECAP-VDPQIVSSSTDATVRLWDIV------------ 296

Query: 376 DGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENI 413
             A + + +   H+ +V   +++PN  + MASA  ++I
Sbjct: 297 --AGKAMKVLTHHKRSVRAIALHPN-EFSMASACTDDI 331

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 47/100 (47%), Gaps = 16/100 (16%)

Query: 327 SMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHA 386
           ++ GH  ++ ++  S      L S   D+ V  WD+                 ++I  + 
Sbjct: 177 TLTGHVMTVRDIAVSDR-HPYLFSVSEDKTVKCWDLE--------------KNQIIRDYH 221

Query: 387 GHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIV 426
           GH S V   SI+P +  L+A+A  ++++++W    ++P++
Sbjct: 222 GHLSGVRTVSIHPTLD-LIATAGRDSVVKLWDIRTRVPVI 260

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 84/404 (20%), Positives = 181/404 (44%), Gaps = 48/404 (11%)

Query: 51  PLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELIL--GTHTSGEEDNYLKIAAI-D 107
           P +Y+ +    + WP LT++ +P +  S   +  Q ++L   T +S +++N L + A+ +
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 173

Query: 108 LPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRARFMPQNTDII- 166
           L   +++        +          + +   NI +         +  + F   N +++ 
Sbjct: 174 LTKTLLKDENEEEDEEEDDDDIDPIIENE---NIPLRDTTNR---LKVSPFAVSNQEVLT 227

Query: 167 ATINGSGTVFIYNQSNDKQSAL-------------ISTLRFHKE-NGYGLSFNPNDK-GK 211
           AT++ +G V+IY+ +   ++               I T++ H    GYGL ++P  K G 
Sbjct: 228 ATMSENGDVYIYDLAPQSKAFATPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGS 287

Query: 212 LLSGSDDGTIALWDIQENSTLA-KKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTL 270
           LLSG   G +       +  +  K+P  +    +N  + D +W+   S VFA+   D  +
Sbjct: 288 LLSGDCSGQVYFTQRHTSRWVTDKQPFTV---SNNKSIEDIQWSRSESTVFATAGCDGYI 344

Query: 271 QLHDQR-EQNTIINSIKTTDP-FNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS------ 322
           ++ D R +++    S+K ++   N +++S    YL+A+   +    ++D R  +      
Sbjct: 345 RIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADS 404

Query: 323 -VPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN-DIGAEQIPD------DA 374
             P+   + H+ +IT++ F+P  + ++     D  V +WD++ +   E+I        + 
Sbjct: 405 VQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAETKEL 464

Query: 375 EDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
           ++  P+++ +H   +  V D   +  IP  + S   +  + VWK
Sbjct: 465 QEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 505

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 82/403 (20%), Positives = 174/403 (43%), Gaps = 45/403 (11%)

Query: 51  PLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGEEDNYLKIAAIDLPD 110
           P +Y+ +    + WP +T++ +P +  S   +  Q L++ T T   + N  ++  + +  
Sbjct: 127 PTVYEMLHTVNVPWPCMTLDVIPDTLGSGRRNYPQSLLMATATQASKKNQNELMVLKMS- 185

Query: 111 EVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRARFMP----QNTDII 166
              Q +   +K            +      I+  +    ++   R +  P        + 
Sbjct: 186 ---QLAKTLVKEDEDENEGEDEDEDGTDPVIE-NENISLKDTTNRLKVSPFANAAQEVLC 241

Query: 167 ATINGSGTVFIYNQSND------------KQSAL-ISTLRFHKE-NGYGLSFNPNDK-GK 211
           +T++ +G V+I++ ++             KQ+   I T+R H    GY   ++P  K G 
Sbjct: 242 STMSENGEVYIFDLASQVKAFETPGYQIPKQAKRPIHTVRNHGSVEGYANDWSPIIKTGA 301

Query: 212 LLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQ 271
           +LSG   G + L     +  +  K  + +   +N  + D +W+   S VFAS   D  ++
Sbjct: 302 MLSGDCSGQVFLTQRHTSKWITDK--QAFTVANNKSIEDLQWSRTESTVFASCGIDGYIR 359

Query: 272 LHDQR-EQNTIINSIKTTDP-FNTLAFSKHSQYLMAAAGTDSLVYLYDSRNL-------S 322
           + D R +++    S+K ++   N +++S+   YL+A+   D    ++D R         +
Sbjct: 360 IWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDDGTWGVWDLRQFTPQNASTA 419

Query: 323 VPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN-DIGAEQIPDDAEDGA--- 378
            P+     H+ +IT++ F+P  + ++  +  D  V +WD++ +   E+I   A +     
Sbjct: 420 SPVAQYQFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQ 479

Query: 379 ---PEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
              P+++ +H   +  V D   +  IP  + S   +  + VWK
Sbjct: 480 QIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 519

>TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7.310
           YDL195W
          Length = 1264

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 73/270 (27%), Positives = 116/270 (42%), Gaps = 38/270 (14%)

Query: 165 IIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYG--LSFNPNDKGKLLSGSDDGTIA 222
           IIA    SG V +++ + D   +L S  RF +  G    + FN      L SG   G I 
Sbjct: 76  IIAGALDSGVVELFSSTGD---SLKSEARFQQHQGAAKTVKFNSKQNNVLASGGSKGEIY 132

Query: 223 LWDIQENSTL----AKKPLKIW-DSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQRE 277
           +WD+  N+ L       PL     S   + V    WN+  ++VFAS    S   + D + 
Sbjct: 133 IWDL--NTCLKNSEGYTPLTPGVASTPIEEVTSLAWNQSLAHVFASAGSTSYASIWDLKA 190

Query: 278 QNTIINSIKTTDPFNTLA--------FSKHSQYLMAAAGTDS--LVYLYDSRNLSVPLYS 327
           +  +I+ +    P   L           K+S  +  A G+D+  L+ ++D RN + PL  
Sbjct: 191 KKEVIH-LSYASPSTGLKSQLSVVEWHPKNSTRVATATGSDTEPLILVWDLRNANTPLQV 249

Query: 328 MN-GHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHA 386
           ++ GH   I +L++    + +L+SSG D  +++W            + E G         
Sbjct: 250 LSKGHSKGILSLDWCSQDEELLLSSGRDNTIVLW------------NPESGQELTQFPTR 297

Query: 387 GHRSAVNDFSINPNIPWLMASAEEENIIQV 416
           G+      F+  P  P L ASA  +N IQV
Sbjct: 298 GNWCFKTKFA--PEAPDLFASASFDNKIQV 325

>TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON}
           Anc_8.672 YPL151C
          Length = 434

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 108/231 (46%), Gaps = 26/231 (11%)

Query: 188 LISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI 247
           LI  +  H      +  +P D     +GS+D +I +WD      LA   LK+  S H   
Sbjct: 114 LIRVINGHIGWVRCVEVDPVDNAWYATGSNDTSIKVWD------LASGKLKLTLSGHIMT 167

Query: 248 VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAA 307
           V D   +E +  +F S SED T++  D  +   I N        +T++    +  L+ +A
Sbjct: 168 VRDLAISERHPYMF-SASEDKTIKCWDLEKNMVIRNYHGHLSGVHTVSLHP-TLDLVVSA 225

Query: 308 GTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGA 367
           G DS+V L+D R   VP+ ++ GH+  I  +   P  D  +IS   D  + +WDI     
Sbjct: 226 GRDSVVKLWDMRT-RVPVMNLIGHKSPINKVRCLP-VDPQIISCSTDANIRLWDIT---- 279

Query: 368 EQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
                    G    I+ H  H+ +V DF+++P+  + MASA  ++ I+ WK
Sbjct: 280 --------AGKSAKILTH--HKRSVRDFALHPS-EFSMASACTDD-IRSWK 318

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/122 (20%), Positives = 58/122 (47%), Gaps = 17/122 (13%)

Query: 305 AAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIND 364
           A    D+ + ++D  +  + L +++GH  ++ +L  S      + S+  D+ +  WD+  
Sbjct: 139 ATGSNDTSIKVWDLASGKLKL-TLSGHIMTVRDLAISERHP-YMFSASEDKTIKCWDLE- 195

Query: 365 IGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLP 424
                           VI  + GH S V+  S++P +  L+ SA  ++++++W    ++P
Sbjct: 196 -------------KNMVIRNYHGHLSGVHTVSLHPTLD-LVVSAGRDSVVKLWDMRTRVP 241

Query: 425 IV 426
           ++
Sbjct: 242 VM 243

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 87/401 (21%), Positives = 167/401 (41%), Gaps = 41/401 (10%)

Query: 51  PLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHT--SGEEDNYLKIAAIDL 108
           P +Y+ +    L WP +T++ +P +  S   +  Q +++ T T  S ++DN L +  +  
Sbjct: 125 PTVYEMLHNVNLPWPCMTLDLIPDNLGSERRNYPQSILMTTATQASKKKDNELLVLKLSQ 184

Query: 109 PDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKI--------VKKFKHEEEITRARFMP 160
             + +    +                     NIK+        V  F  E +   A  M 
Sbjct: 185 LAKTLAKDEDDGAEDDEDDEDEDADPIIENENIKLRDTTNRMQVSPFAAESQEVLAATMS 244

Query: 161 QNTDI-IATINGSGTVFI---YNQSNDKQSALISTLRFHKENGYGLSFNPNDK-GKLLSG 215
           +N +  I  +      F    Y      Q    +        GYGL ++P  K G LL+G
Sbjct: 245 ENGEAHIFDLGPQVKAFSSPGYQVPKAAQRPQYTIKNHGNVEGYGLDWSPLIKTGALLTG 304

Query: 216 SDDGTIALWDIQENST---LAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQL 272
              G + L   Q  S+     K+P  +    +N  + D KW+   + VFA+   D  +++
Sbjct: 305 DCSGRVFL--TQRTSSKWITDKQPFTV---DNNKSIEDIKWSPSENTVFATCGVDGHVRI 359

Query: 273 HDQR-EQNTIINSIKTTDP-FNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS------VP 324
            D R +++    S+K +D   N +++++   YL+A    +    ++D R  S       P
Sbjct: 360 WDIRSKKHKPALSVKVSDTDVNVMSWNQKISYLLATGDDNGTWGVWDLRQFSNQQGGVSP 419

Query: 325 LYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN-DIGAEQIPDDAEDGA----- 378
           +   + H+ +IT++ F+P  + ++  +  D  V +WD++ +   E+I   A +       
Sbjct: 420 VAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAEVKELQQI 479

Query: 379 -PEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
            P+++ +H   +  V D   +  IP  + S   +  + VWK
Sbjct: 480 PPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 517

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 95/445 (21%), Positives = 195/445 (43%), Gaps = 58/445 (13%)

Query: 18  MLAQLTNQEETGNGDE------NKELTIDE--EYDLWKSNVPLMYDFVSETKLTWPTLTV 69
           M+AQ   QEE  NG        ++ L  DE  E D      P +Y+ +    + WP LT+
Sbjct: 78  MIAQDLEQEEAPNGKGLYLPHLSRPLGPDEVLEAD------PTVYEMLHNVNVPWPCLTL 131

Query: 70  EWLPSSHSSTPVSNRQELILGTHT--SGEEDNYLKIAAI-DLPDEVVQPSTNSLKAQRXX 126
           + +P S  S   +  Q L++ T T  S +++N L + ++ +L   +V  + +    +   
Sbjct: 132 DIIPDSLGSERRNYPQSLLMTTATQASKKKENELMVLSLSNLTKTLV--NEDKEDDEDED 189

Query: 127 XXXXXXQKQKPRSNIKIVKKFKHEEEITRARFMPQNTDII-ATINGSGTVFIYNQSNDKQ 185
                   + P    + +        +  + F   + +++ AT++ +G V+I++     +
Sbjct: 190 DEDNEDNDKDPVMENENIPLRDTTNRLKVSPFANSSKEVLTATMSENGEVYIFDLGPQSK 249

Query: 186 S-------------ALISTLRFHKE-NGYGLSFNPN-DKGKLLSGSDDGTIALWDIQENS 230
           +               I T++ H    GY L ++P+   G LL+G   G I       + 
Sbjct: 250 AFSTPGYKIPKTAKRPIHTIKSHGNVEGYALDWSPSIQTGALLTGDCSGQIYFTQRHTSK 309

Query: 231 TLA-KKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQR-EQNTIINSIKTT 288
            +  K+P  +    +N  + D +W+     VFAS   D  +++ D R +++    S+K +
Sbjct: 310 WVTDKQPFTV---SNNKSIEDIQWSRTEGTVFASAGCDGYIRIWDTRSKKHKPAISVKAS 366

Query: 289 DP-FNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS-------VPLYSMNGHEDSITNLEF 340
           +   N +++S    YL+A+   + +  ++D R  S        P+   + H+ +IT++ F
Sbjct: 367 NTDVNVISWSDKLGYLLASGDDNGVWGVWDLRQFSPDTANSVQPVAQYDFHKGAITSISF 426

Query: 341 SPHTDGVLISSGNDRRVIMWDIN-DIGAEQIPDDAEDGA------PEVIMIHAGHRSAVN 393
           +P  + ++  +  D  V +WD++ +   E+I   A +        P+++ +H   +  V 
Sbjct: 427 NPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQLLFVH--WQKEVK 484

Query: 394 DFSINPNIPWLMASAEEENIIQVWK 418
           D   +  IP  + S   +  + +WK
Sbjct: 485 DVKWHKQIPGALVSTGTDG-LNIWK 508

>NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {ON}
           Anc_7.310
          Length = 1276

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 60/220 (27%), Positives = 109/220 (49%), Gaps = 24/220 (10%)

Query: 162 NTDIIATINGSGTVFIYN-QSNDKQSALISTLRFHKENGY--GLSFNPNDKGKLLSGSDD 218
           N  I   ++ +G + +++ + ND + +L S  +F K       L FNP  +  L S  ++
Sbjct: 76  NKFIAGALDDNGKIELFSKEENDTKISLKSLGKFKKHTTAVNTLRFNPKQQNVLASAGNN 135

Query: 219 GTIALWDIQENSTLAKKPLK-----IWDSVHNDIVNDCKWNEFNSNVFASVSEDSTL-QL 272
           G I +WDI  N TL+          I  S  ++I     WN+  ++VFAS  + +T   +
Sbjct: 136 GEILIWDI--NKTLSSTDYSPSAPGIAMSTQDEI-KSVSWNKSLAHVFASAGDTTTYASI 192

Query: 273 HDQREQNTIINSIKTTDPFNTLA--------FSKHSQYLMAAAGTDS--LVYLYDSRNLS 322
            D + +  +I+ +  T P   L           K + Y+  A+G+DS  ++ ++D RN +
Sbjct: 193 WDLKAKKEVIH-LNYTSPKTGLKPNLAVVEWHPKVTTYVATASGSDSDPVILIWDLRNSN 251

Query: 323 VPLYSMNG-HEDSITNLEFSPHTDGVLISSGNDRRVIMWD 361
           +P+ ++ G H   I +L++    + +L+SSG D  V +WD
Sbjct: 252 MPMTTLEGPHTKGIMSLDWCTKDESLLLSSGRDGIVALWD 291

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 77/177 (43%), Gaps = 16/177 (9%)

Query: 260 VFASVSEDSTLQL----HDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYL 315
           + A  S DSTL+L     D ++  T + SI T   F  L +S  ++++  A   +  + L
Sbjct: 32  IAADFSNDSTLELWSLLSDPKKDPTPVASITTDARFKDLDWSFDNKFIAGALDDNGKIEL 91

Query: 316 Y-----DSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQI 370
           +     D++     L     H  ++  L F+P    VL S+GN+  +++WDIN   +   
Sbjct: 92  FSKEENDTKISLKSLGKFKKHTTAVNTLRFNPKQQNVLASAGNNGEILIWDINKTLS--- 148

Query: 371 PDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASA-EEENIIQVWKCSHKLPIV 426
              + D +P    I    +  +   S N ++  + ASA +      +W    K  ++
Sbjct: 149 ---STDYSPSAPGIAMSTQDEIKSVSWNKSLAHVFASAGDTTTYASIWDLKAKKEVI 202

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 52/118 (44%), Gaps = 12/118 (10%)

Query: 160 PQNTDIIATINGSGT---VFIYNQSNDKQSALISTLRF-HKENGYGLSFNPNDKGKLLSG 215
           P+ T  +AT +GS +   + I++  N      ++TL   H +    L +   D+  LLS 
Sbjct: 224 PKVTTYVATASGSDSDPVILIWDLRNSNMP--MTTLEGPHTKGIMSLDWCTKDESLLLSS 281

Query: 216 SDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLH 273
             DG +ALWD + N      P +      +      K+   N ++FAS   D  + ++
Sbjct: 282 GRDGIVALWDTKANEVSTTYPTR------SQWCFKTKFAPENPDIFASAGFDGQINVN 333

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 81/406 (19%), Positives = 171/406 (42%), Gaps = 48/406 (11%)

Query: 51  PLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGEEDNYLKIAAIDLPD 110
           P +Y+ +    + WP +T++ +P +  S   +  Q L++ T T        ++  + L +
Sbjct: 112 PSVYEMLHNVNVPWPCMTLDIIPDNLGSERRNYPQSLLMATATQASRKKENELMVLSLSN 171

Query: 111 EVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKK--FKHEEEITRARFMP----QNTD 164
            V       +K            +     +  I++       +   R +  P    +   
Sbjct: 172 LV----KTLVKDDEEEEEEDVDNEDDRDDSDPIIENENIPLRDTTNRLKISPFASSKEEV 227

Query: 165 IIATINGSGTVFIYNQSNDKQS-------------ALISTLRFHKE-NGYGLSFNPNDK- 209
           + AT++ +G V+I++     ++               I T++ H    GY L ++P  K 
Sbjct: 228 LAATMSENGEVYIFDLGPQSKAFSTPGYKVPKAAKRPIHTVKNHGNVEGYALDWSPLTKT 287

Query: 210 GKLLSGSDDGTIALWDIQENSTLA-KKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDS 268
           G LL+G   G I       +  +  K+P  +    +N  + D +W+   S VFAS   D 
Sbjct: 288 GALLTGDCSGQIYFTQRHTSKWITDKQPFTV---ANNQSIEDIQWSRTESTVFASAGCDG 344

Query: 269 TLQLHDQR-EQNTIINSIKTTDP-FNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS---- 322
            +++ D R +++    S+K ++   N +++S+   YL+A+   +    ++D R  S    
Sbjct: 345 YIRIWDTRSKKHKPAISVKASNTDVNVISWSEKLGYLLASGDDNGTWGVWDLRQFSPENA 404

Query: 323 ---VPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN-DIGAEQIPDDAEDGA 378
               P+   + H+ +IT++ F+P  + ++     D  V +WD++ +   E+I   A +  
Sbjct: 405 GSVQPVAQYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLSVEADDEEIKQQAAETK 464

Query: 379 ------PEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
                 P+++ +H   +  V D   +  IP  + S   +  + +WK
Sbjct: 465 ELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 507

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 88/443 (19%), Positives = 185/443 (41%), Gaps = 62/443 (13%)

Query: 26  EETGNGDENKELTIDEEYDLWKSNV-------------PLMYDFVSETKLTWPTLTVEWL 72
           +E  N D+  EL+  E   L+  ++             P +Y+ +    L WP L+++ +
Sbjct: 89  QELVNKDQAAELSAQESQQLYLPHMSRPLGPDEVLEADPTVYEMLHNVNLPWPCLSLDIV 148

Query: 73  PSSHSSTPVSNRQELILGTHT--SGEEDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXX 130
           P    S   +  Q L+L T T  S ++DN L +  +          T +L  +       
Sbjct: 149 PDRLGSERRNYPQSLLLTTATQASKKKDNELLLLKM-------SQLTKTLVKEDEDDDEE 201

Query: 131 XXQKQKPRSNIKIVKKFKHEEEITRARFMPQNTD----IIATINGSGTVFIYN------- 179
              + + +  I   +     +   R +  P  ++    + A+++ +G V+I++       
Sbjct: 202 DDDEDEDQDPIVENENIPLRDTTNRLKVSPFASESPEKLTASMSENGEVYIFDLGPQVKG 261

Query: 180 ------QSNDKQSALISTLRFHKE-NGYGLSFNP-NDKGKLLSGSDDGTIALWDIQENST 231
                 Q        I T++ H    GY L ++P N  G LL+G   G + L     +  
Sbjct: 262 FETPGYQIPKTAKKPIHTVKAHGNVEGYALDWSPLNKSGSLLTGDCSGRVYLTQRHTSKW 321

Query: 232 LAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQR--EQNTIINSIKTTD 289
           +  K    + + +N  + D +++   + VFA+   D  +++ D R  +    I+   ++ 
Sbjct: 322 ITDK--TAFSAGNNQSIEDIQFSRTEATVFATCGCDGYIRIWDTRSKKHKPAISVKASST 379

Query: 290 PFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS-------VPLYSMNGHEDSITNLEFSP 342
             N +++++   YL+A+   +    ++D R  S        P+   + H+ +IT++ F+P
Sbjct: 380 DVNVISWNEKIGYLLASGDDNGTWGVWDLRQFSPNNAASVSPVAQYSFHKGAITSIAFNP 439

Query: 343 HTDGVLISSGNDRRVIMWDIN-DIGAEQIPDDAEDGA------PEVIMIHAGHRSAVNDF 395
             D ++  +  D  V +WD++ +   E+I   A +        P+++ +H   +  V D 
Sbjct: 440 LDDSIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQLLFVH--WQKEVKDV 497

Query: 396 SINPNIPWLMASAEEENIIQVWK 418
             +  IP  + S   +  + +WK
Sbjct: 498 KWHKQIPGCLVSTGTDG-LNIWK 519

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 61/129 (47%), Gaps = 9/129 (6%)

Query: 294 LAFSKHSQYLMAAAGTDSLVYLYDSRNLS-VPLYSMNGHEDSITNLEFSPHTDGVLISSG 352
           + FS+    + A  G D  + ++D+R+    P  S+      +  + ++    G L++SG
Sbjct: 339 IQFSRTEATVFATCGCDGYIRIWDTRSKKHKPAISVKASSTDVNVISWNEKI-GYLLASG 397

Query: 353 NDRRVI-MWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEE 411
           +D     +WD+        P++A   +P  +  ++ H+ A+   + NP    ++A A E+
Sbjct: 398 DDNGTWGVWDLRQFS----PNNAASVSP--VAQYSFHKGAITSIAFNPLDDSIIAVASED 451

Query: 412 NIIQVWKCS 420
           N + +W  S
Sbjct: 452 NTVTLWDLS 460

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 79/405 (19%), Positives = 170/405 (41%), Gaps = 50/405 (12%)

Query: 51  PLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSG--EEDNYLKIAAIDL 108
           P +Y+ +    L WP +T++ +P ++ S   +  Q +++ T T    ++DN L +  +  
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDIIPDTYGSERRNYPQSILMTTATQAAKKKDNELMVLKL-- 177

Query: 109 PDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRARFMPQNTD---- 164
                   + +L  +                 I   +    ++   R R  P  +     
Sbjct: 178 -----SQLSKTLVKENEEEEEDEDNSDNESDPILEDENVPLKDTTNRLRVSPFASSGQEV 232

Query: 165 IIATINGSGTVFIYN-------------QSNDKQSALISTLRFHKE-NGYGLSFNPNDK- 209
           + AT++ +G V+I++             Q        I T+R H    GY L ++P  + 
Sbjct: 233 LTATMSENGEVYIFDIAPQSRAFDTPGYQIPKTAKRPIHTIRNHGNVEGYALDWSPLIRS 292

Query: 210 GKLLSGSDDGTIALWDIQENSTLA-KKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDS 268
           G LL+G   G +       +  +  K+P  +    +N  + D +W+   + VFA+   D 
Sbjct: 293 GALLTGDCSGQVYFTQRHTSKWVTDKQPFTV---SNNKSIEDIQWSRTEATVFATAGCDG 349

Query: 269 TLQLHDQR--EQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS---- 322
            +++ D R  +    I++  +    N +++++   YL+A+   +    ++D R  S    
Sbjct: 350 YIRVWDTRSKKHKPAISTKASNTDVNVISWNEKMGYLLASGDDNGTWGVWDLRQFSPSNE 409

Query: 323 --VPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDI----NDIGAEQIPDDAED 376
              P+   + H+ +IT++ F P  + ++  +  D  V +WD+    +D   +Q   + ++
Sbjct: 410 NAQPVAQYDFHKGAITSISFHPTDESIVAVASEDNTVTLWDLSVEADDEEIKQQTAETKE 469

Query: 377 GA---PEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
            A   P+++ +H   +  V D   +  IP  + S   +  + +WK
Sbjct: 470 LAQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 511

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 87/178 (48%), Gaps = 22/178 (12%)

Query: 204 FNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFAS 263
           +NP D   L+S S D T  +WD+Q ++ +  + +      H+  V D K+   ++ +FAS
Sbjct: 230 WNPIDTNLLISSSIDTTCIVWDLQSSNYVRTQLI-----AHDSEVFDVKFLAHSTQLFAS 284

Query: 264 VSEDSTLQLHDQR-------------EQN---TIINSIKTTDPFNTLAFSKHSQYLMAAA 307
              D ++++ D R             +QN   T+ ++ K+      L  S     +MA  
Sbjct: 285 CGGDGSVRVFDLRSLAHSTIIYESNSDQNGSDTLTDNEKSPSALLRLQPSPSDPNVMATF 344

Query: 308 GTDSL-VYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIND 364
             DS  + + D RN   P+ ++ GH  ++  +++ P    VL+S G+D +V+ WD+N+
Sbjct: 345 ALDSKSILILDMRNPGSPVLTLEGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYWDLNE 402

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 80/177 (45%), Gaps = 10/177 (5%)

Query: 248 VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDP--FNTLAFSKHSQYLMA 305
           V    WN  ++N+  S S D+T  + D +  N +   +   D   F+ + F  HS  L A
Sbjct: 225 VTSFHWNPIDTNLLISSSIDTTCIVWDLQSSNYVRTQLIAHDSEVFD-VKFLAHSTQLFA 283

Query: 306 AAGTDSLVYLYDSRNL--SVPLYSMNGHE---DSITNLEFSPHTDGVLISSGNDRRVIMW 360
           + G D  V ++D R+L  S  +Y  N  +   D++T+ E SP     L  S +D  V+  
Sbjct: 284 SCGGDGSVRVFDLRSLAHSTIIYESNSDQNGSDTLTDNEKSPSALLRLQPSPSDPNVMAT 343

Query: 361 DINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
              D  +  I D    G+P  ++   GH +AVN    +P    ++ S  ++  +  W
Sbjct: 344 FALDSKSILILDMRNPGSP--VLTLEGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYW 398

>ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL195W (SEC31)
          Length = 1233

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 103/240 (42%), Gaps = 27/240 (11%)

Query: 189 ISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHN-DI 247
           ++ +  H      + FN       +SG   G I +WD  + S     P     ++   D 
Sbjct: 96  VARVARHTTGVRAVRFNAKQANVAVSGGSQGEIFVWDTNKISAAGYSPFGPGTAMTPIDE 155

Query: 248 VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPF----NTLAF----SKH 299
           V    WN+  ++VFAS        + D + +  +I+ +  T P     N LA       +
Sbjct: 156 VQSLAWNQSLAHVFASAGSSGFASIWDLKAKKEVIH-LSYTSPHSGLKNQLAVVEWHPSN 214

Query: 300 SQYLMAAAGTDS--LVYLYDSRNLSVPLYSMN-GHEDSITNLEFSPHTDGVLISSGNDRR 356
           S  +  A G D+  ++ ++D RN ++PL  M+ GH   I +L++  H + +++SSG D  
Sbjct: 215 STRVATATGNDNEPVILVWDLRNANMPLQVMSQGHSKGILSLDWCKHDEKLMLSSGRDNT 274

Query: 357 VIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQV 416
            I+W+         P++A+      +  +    +        P  P L ASA  +N IQV
Sbjct: 275 CILWN---------PEEAQK-----LTQYPTRGNWCFKTKFAPEAPDLFASASFDNKIQV 320

>KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {ON}
           Anc_8.672 YPL151C
          Length = 417

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 106/223 (47%), Gaps = 38/223 (17%)

Query: 202 LSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVF 261
           ++ +P D     +GS+D TI +WD       A   LK+  S H   V D   ++ +  +F
Sbjct: 114 IAMDPVDNEWFATGSNDSTIKVWD------FASGKLKLTLSGHVMGVRDLVVSKRHPYMF 167

Query: 262 ASVSEDSTLQLHDQREQNTI------INSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYL 315
            S SED  ++  D  +   I      ++ + T D   TL+       L+A+AG DS+V L
Sbjct: 168 -SASEDKLVKCWDLEKNAPIRDYFGHLSGVHTVDIHPTLS-------LIASAGRDSVVKL 219

Query: 316 YDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAE 375
           +D R+    + ++ GH+  I +++ +P  D  +IS  ND  VI WD+  + A+       
Sbjct: 220 WDIRSKKA-VITLVGHKSPINSVKCTP-ADPQIISCSNDTTVITWDL--VAAK------- 268

Query: 376 DGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
              P  ++ H  HR AV D +++P       ++   N I+ WK
Sbjct: 269 ---PMKVITH--HRKAVRDIAVHPGE--FSVASCSTNDIRSWK 304

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 108/232 (46%), Gaps = 32/232 (13%)

Query: 192 LRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDC 251
            R+ +EN + L   P  +  L++   DG++ L D     T++          H   +ND 
Sbjct: 8   CRYFEENNWCLKLQPLYQHGLMTSISDGSVHLLDWGNLKTISSI------QCHTTSINDM 61

Query: 252 KW--NEFNSN-VFASVSEDSTLQLHDQREQNTIIN-SIKTTDPFNTLAFSKHSQYLMAAA 307
           K   ++F++  VFA+ +ED  +++ D R +N + +       PF    FS  S++ M A 
Sbjct: 62  KVINSDFDTGAVFATAAEDG-VKVWDIRARNNVASLQNDKASPF----FSLDSRHNMLAC 116

Query: 308 GT-----DSLVYLYDSRNLSVPLYS-MNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWD 361
           GT     D+ +++YD RN + P+ S ++ H D IT+++F P    +L+S   D  V ++D
Sbjct: 117 GTELKDYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYD 176

Query: 362 INDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENI 413
           +         DD ED   +VI   + H        + P   W ++  E   I
Sbjct: 177 LTQ-------DDEEDALHQVINFASIHSCGW----LGPKRIWSLSHMETFGI 217

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 62.8 bits (151), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 115/239 (48%), Gaps = 30/239 (12%)

Query: 182 NDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWD 241
           N+  S+   T   H    Y  SF+  D+  LLS S+D T+ LW +Q++     KPL  + 
Sbjct: 560 NNPISSTCKTFIGHSGTVYSTSFSAGDE-YLLSASEDKTVRLWSVQDD-----KPLVSYK 613

Query: 242 SVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQ 301
             H   V D +++   +N+FA+ S D T +L        +       +  + ++F  + +
Sbjct: 614 G-HEKPVWDVEFSPSCNNLFATASNDQTARLWSCDRVYPLRVMAGHLNDVDCVSFHSNGR 672

Query: 302 YLMAAAGTDSLVYLYD-SRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVI-M 359
           Y+   + +D  V ++D +   SV L+   GH  ++T+L  SP  DG  IS+G+D  +I +
Sbjct: 673 YIFTGS-SDKTVRMWDINTGDSVRLFM--GHNSTVTSLSVSP--DGKWISTGSDDGIITI 727

Query: 360 WDINDIGAEQIPDDAEDGAPEVIMIHAGH-RSAVNDFSINPNIPWLMASAEEENIIQVW 417
           WDI              G+   +    GH +S+++  S NP    L++   +++ ++VW
Sbjct: 728 WDI--------------GSGRKLKNMRGHGKSSIHSLSYNPEGTLLVSGGADQS-VRVW 771

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 79/180 (43%), Gaps = 35/180 (19%)

Query: 270 LQLHDQREQNTIINSIKT----TDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPL 325
           L  +D+   N I ++ KT    +    + +FS   +YL++A+  D  V L+  ++   PL
Sbjct: 552 LSENDEMPNNPISSTCKTFIGHSGTVYSTSFSAGDEYLLSAS-EDKTVRLWSVQD-DKPL 609

Query: 326 YSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWD-------------INDI------- 365
            S  GHE  + ++EFSP  + +  ++ ND+   +W              +ND+       
Sbjct: 610 VSYKGHEKPVWDVEFSPSCNNLFATASNDQTARLWSCDRVYPLRVMAGHLNDVDCVSFHS 669

Query: 366 GAEQIPDDAEDGAPEV--------IMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
               I   + D    +        + +  GH S V   S++P+  W+ ++  ++ II +W
Sbjct: 670 NGRYIFTGSSDKTVRMWDINTGDSVRLFMGHNSTVTSLSVSPDGKWI-STGSDDGIITIW 728

 Score = 38.1 bits (87), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 42/96 (43%), Gaps = 15/96 (15%)

Query: 330 GHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHR 389
           GH  ++ +  FS   D  L+S+  D+ V +W +            +D  P  ++ + GH 
Sbjct: 572 GHSGTVYSTSFSAG-DEYLLSASEDKTVRLWSV------------QDDKP--LVSYKGHE 616

Query: 390 SAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPI 425
             V D   +P+   L A+A  +   ++W C    P+
Sbjct: 617 KPVWDVEFSPSCNNLFATASNDQTARLWSCDRVYPL 652

>ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 427

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 111/238 (46%), Gaps = 40/238 (16%)

Query: 188 LISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI 247
           LI  +  H      L  +P D     +GS+D T+ +WD      LA   LK+  + H   
Sbjct: 107 LIRVINGHVGWVRCLKVDPVDNEWFATGSNDTTVKIWD------LASGKLKLTLAGHVMT 160

Query: 248 VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTII-------NSIKTTDPFNTLAFSKHS 300
           V D   ++ +  +F S SED  ++  D  E+N II       + + T D   TL      
Sbjct: 161 VRDVAISQRHPYLF-SASEDKMVKCWDL-EKNQIIRDYHGHLSGVHTVDIHPTLD----- 213

Query: 301 QYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMW 360
             L+A+AG D +V L+D R+ +  + ++ GH+  IT +   P  +  ++SS  D  V +W
Sbjct: 214 --LIASAGRDGVVKLWDIRSRTA-VMTLIGHKSPITKVHCLP-VNPQVVSSSTDATVRLW 269

Query: 361 DINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
           D+              G    I+ H  H+ +V DFS++P+  + M SA  ++ I+ WK
Sbjct: 270 DVT------------AGKSYKILTH--HKRSVRDFSLHPS-EFSMVSACTDD-IRSWK 311

>ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} similar
           to uniprot|Q12523 Saccharomyces cerevisiae YPL247C
           Hypothetical ORF
          Length = 506

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 82/357 (22%), Positives = 138/357 (38%), Gaps = 92/357 (25%)

Query: 52  LMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGEEDNYLKIAAIDLPDE 111
           L +D V+E  +T+P  T++W PS                TH         + A       
Sbjct: 150 LSWDRVAECNVTFPVSTIQWQPSM---------------THPR-------RFATC----- 182

Query: 112 VVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRARFMPQNTDIIATING 171
                ++SL+           Q+Q    N+ + K  K ++  +R         + A   G
Sbjct: 183 -----SDSLRIWSFCEEERNLQEQI---NLSLCKYDKQQQGASR---------VNAAAGG 225

Query: 172 SGTVFIYNQSNDKQSALISTL----RFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQ 227
           SG++    Q   +Q  LI  L     FH        +NP D   L+S S D T  +WD+Q
Sbjct: 226 SGSIRTNPQ---QQQGLIGELPPITSFH--------WNPVDPNLLISSSIDTTCIVWDLQ 274

Query: 228 ENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQR--EQNTII--- 282
            ++ +  + +      H+  V D ++    + +F+S   D ++++ D R    +TII   
Sbjct: 275 SSNYVRTQLI-----AHDSEVYDVRFLTQTTQLFSSCGGDGSVRVFDLRCLAHSTIIYEP 329

Query: 283 ------------------NSIKTTDPFNTLAFSKHSQYLMAAAGTDS-LVYLYDSRNLSV 323
                                 T  P   L  S     ++A    DS  V + D RN   
Sbjct: 330 PSSPATLQPTTAAGSSSAADSDTGVPLLRLEPSPFDPNVIATFAIDSPRVLILDMRNPGS 389

Query: 324 PLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDI----GAEQIPDDAED 376
           P+  + GH  ++  + + P    VL+S  +D +V+ WD+N+       +Q PD A D
Sbjct: 390 PVLVLEGHSAAVNQMRWHPSKRNVLLSCADDCQVLYWDLNNYIMGHPTDQDPDHAVD 446

>SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {ON}
           highly similar to uniprot|Q75BY3 Ashbya gossypii ACR137W
           PRP46 Pre-mRNA-splicing factor PRP46 and similar to
           YPL151C uniprot|Q12417 Saccharomyces cerevisiae YPL151C
           PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 441

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/223 (27%), Positives = 103/223 (46%), Gaps = 38/223 (17%)

Query: 202 LSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVF 261
           ++ +P D     +GS+D TI +WD      LA   LK+  S H   V D   ++ +  +F
Sbjct: 135 VAVDPIDNEWFATGSNDTTIKIWD------LATGKLKLTLSGHIMTVKDICISKRHPYMF 188

Query: 262 ASVSEDSTLQLHDQREQNTI------INSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYL 315
            S SED  ++  D  +   I      ++ + T D   TL        L+A AG DS+V L
Sbjct: 189 -SASEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDIHPTLN-------LIATAGRDSVVRL 240

Query: 316 YDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAE 375
           +D R   +P+ +M GH+  I  ++  P  D  ++S   D  V +WDI             
Sbjct: 241 WDIRT-KLPVMTMAGHKSPINRVKCLP-VDPQVVSCSADATVRLWDIT------------ 286

Query: 376 DGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
             A + + +   H+ +V D  I+P   + ++SA  ++ I+ WK
Sbjct: 287 --AGKTLKVLTHHKRSVRDIGIHPG-EFSISSACTDD-IRSWK 325

 Score = 37.4 bits (85), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 57/123 (46%), Gaps = 17/123 (13%)

Query: 304 MAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN 363
            A    D+ + ++D     + L +++GH  ++ ++  S      + S+  D+ V  WD+ 
Sbjct: 145 FATGSNDTTIKIWDLATGKLKL-TLSGHIMTVKDICISKR-HPYMFSASEDKLVKCWDLE 202

Query: 364 DIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKL 423
                            VI  + GH S V+   I+P +  L+A+A  ++++++W    KL
Sbjct: 203 --------------KNRVIRDYHGHLSGVHTVDIHPTLN-LIATAGRDSVVRLWDIRTKL 247

Query: 424 PIV 426
           P++
Sbjct: 248 PVM 250

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 97/224 (43%), Gaps = 26/224 (11%)

Query: 204 FNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFAS 263
           +NP D   L+S S D T  +WD+Q  + +  + +      H+  V D ++   ++ +FAS
Sbjct: 218 WNPTDPNLLISSSIDTTCIVWDLQSANYIKTQLI-----AHDSEVFDVRFLTQSTQLFAS 272

Query: 264 VSEDSTLQLHDQR--EQNTIINSIKTTD-----PFNT-------LAFSKHSQYLMAAAGT 309
              D ++++ D R    +TII      D     P  T       L  S     ++A    
Sbjct: 273 CGGDGSVRVFDLRCLAHSTIIYEPTIPDGAPDLPSPTVPPALLRLEPSPFDPNVIATFAI 332

Query: 310 DS-LVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIND-IGA 367
           DS  V + D R+   PL ++  H   I  +++ P    VL+S+ +D +V+ WD+N  + +
Sbjct: 333 DSSKVLILDMRSPGSPLLTLEAHTAPINQIKWHPTRRNVLLSASDDCQVLYWDLNTHLDS 392

Query: 368 EQIPDDAEDGAPEVI-----MIHAGHRSAVNDFSINPNIPWLMA 406
           E   D   D  P+       M +A     VN+    P   W  A
Sbjct: 393 ESTKDTTPDSQPDSTVQKPAMFYASGGQEVNNIVWRPQGDWFGA 436

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 62/151 (41%), Gaps = 16/151 (10%)

Query: 149 HEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPND 208
           H+ E+   RF+ Q+T + A+  G G+V +++      S +I        +G     +P  
Sbjct: 253 HDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPTI--PDGAPDLPSPTV 310

Query: 209 KGKLL----SGSDDGTIALWDIQENSTL------AKKPLKIWDSVHNDIVNDCKWNEFNS 258
              LL    S  D   IA + I  +  L         PL   ++ H   +N  KW+    
Sbjct: 311 PPALLRLEPSPFDPNVIATFAIDSSKVLILDMRSPGSPLLTLEA-HTAPINQIKWHPTRR 369

Query: 259 NVFASVSEDSTLQLHDQREQNTIINSIKTTD 289
           NV  S S+D  +   D    NT ++S  T D
Sbjct: 370 NVLLSASDDCQVLYWD---LNTHLDSESTKD 397

>YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON}
           PRP46Member of the NineTeen Complex (NTC) that contains
           Prp19p and stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs
          Length = 451

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 86/168 (51%), Gaps = 24/168 (14%)

Query: 202 LSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVF 261
           ++ +P D    ++GS+D T+ +WD      LA   LK   + H   V D   ++ +  +F
Sbjct: 145 VAIDPVDNEWFITGSNDTTMKVWD------LATGKLKTTLAGHVMTVRDVAVSDRHPYLF 198

Query: 262 ASVSEDSTLQLHDQREQNTII-------NSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVY 314
            SVSED T++  D  E+N II       + ++T     TL        L+A AG DS++ 
Sbjct: 199 -SVSEDKTVKCWDL-EKNQIIRDYYGHLSGVRTVSIHPTLD-------LIATAGRDSVIK 249

Query: 315 LYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDI 362
           L+D R   +P+ ++ GH+  I  ++ +P  D  ++SS  D  V +WD+
Sbjct: 250 LWDMRT-RIPVITLVGHKGPINQVQCTP-VDPQVVSSSTDATVRLWDV 295

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 15/79 (18%)

Query: 348 LISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMAS 407
           L S   D+ V  WD+                 ++I  + GH S V   SI+P +  L+A+
Sbjct: 197 LFSVSEDKTVKCWDLE--------------KNQIIRDYYGHLSGVRTVSIHPTLD-LIAT 241

Query: 408 AEEENIIQVWKCSHKLPIV 426
           A  +++I++W    ++P++
Sbjct: 242 AGRDSVIKLWDMRTRIPVI 260

>AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR072C
          Length = 513

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 71/300 (23%), Positives = 118/300 (39%), Gaps = 73/300 (24%)

Query: 164 DIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSF------NPNDKGKLLSGSD 217
           ++IAT +   T+ +++  ++K  +L   LR H +    LS+       P +K +L S S 
Sbjct: 197 EVIATGSMDATIRLWD--SEKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASK 254

Query: 218 DGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQRE 277
           DGTI +WD      +         S H   V+  KW     NV  S S D T++  D   
Sbjct: 255 DGTIKIWDTTRRVCIYTL------SGHTSSVSCIKWG--GRNVLYSASHDRTVRCWDMAA 306

Query: 278 QNTIINSIK-----------TTD------PFNTLAFSKHS-------------------- 300
               IN +K           +TD      PF+       S                    
Sbjct: 307 GGKCINILKSHAHWVNHLSLSTDYALRMGPFDHTGTKPASPEDAQARALRNYEKVAKKNG 366

Query: 301 --QYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDG-VLISSGNDRRV 357
             + LM     D  +YL++    S P+  M GH+  + ++ FSP  DG  ++S+  D  +
Sbjct: 367 TMEELMVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAFSP--DGRYIVSASFDNSI 424

Query: 358 IMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
            +W            D  DG  + I    GH ++V   + + +   L+ S  ++  ++VW
Sbjct: 425 KLW------------DGRDG--KFIATFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 469

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 86/171 (50%), Gaps = 17/171 (9%)

Query: 203 SFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFA 262
           +F P+   ++++G+ D T  +WD    + L    LK     H++ V    W+  +  V A
Sbjct: 148 AFAPHTSSRMVTGAGDNTARIWDCDTQTPLCT--LK----GHSNWVLCVAWSA-DGEVIA 200

Query: 263 SVSEDSTLQLHDQREQNTIINSIK------TTDPFNTLAFSKHSQY-LMAAAGTDSLVYL 315
           + S D+T++L D  +  ++ ++++      T+  +  +   K  +   +A+A  D  + +
Sbjct: 201 TGSMDATIRLWDSEKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKI 260

Query: 316 YDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIG 366
           +D+    V +Y+++GH  S++ +++      VL S+ +DR V  WD+   G
Sbjct: 261 WDTTR-RVCIYTLSGHTSSVSCIKWGGRN--VLYSASHDRTVRCWDMAAGG 308

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 75/151 (49%), Gaps = 13/151 (8%)

Query: 212 LLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQ 271
           +++GSDD T+ LW+  + S    KP+ +  + H  +VN   ++  +     S S D++++
Sbjct: 372 MVTGSDDFTMYLWNPLKGS----KPI-LRMTGHQKLVNHVAFSP-DGRYIVSASFDNSIK 425

Query: 272 LHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSL-VYLYDSRNLSVPLYSMNG 330
           L D R+   I            +A+S   + L++ +   +L V+   +R L+V L    G
Sbjct: 426 LWDGRDGKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLTVDL---PG 482

Query: 331 HEDSITNLEFSPHTDGVLISSGN-DRRVIMW 360
           H D +  +++S   DG  + SG  D+ V +W
Sbjct: 483 HNDEVYTVDWS--VDGKRVCSGGKDKMVRLW 511

>NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672
          Length = 434

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 64/224 (28%), Positives = 104/224 (46%), Gaps = 40/224 (17%)

Query: 202 LSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVF 261
           ++ +P D    ++GS+D TI +WD      LAK  LK+  + H   V D   +E +  +F
Sbjct: 128 VAVDPIDNEWFVTGSNDATIKIWD------LAKGHLKLTLAGHAMTVRDIAISERHPYMF 181

Query: 262 ASVSEDSTLQLHDQREQNTII-------NSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVY 314
            S SED  ++  D  E+NT I       + + + D   TL        L+A AG DS+V 
Sbjct: 182 -SASEDKLVKCWDL-EKNTAIRDYHGHLSGVHSVDIHPTLD-------LIATAGRDSVVR 232

Query: 315 LYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDA 374
           L+D R   V + ++ GH+  I  +   P  D  ++S   D  + +WDI            
Sbjct: 233 LWDIR-ARVSVMTLIGHKSPINKVHCLP-VDPQIVSCSTDATIRLWDI------------ 278

Query: 375 EDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
             G    ++ H  H+ +V D S +P   + M SA  ++ I+ W+
Sbjct: 279 IAGKSRKVLTH--HKKSVRDMSFHPR-EFSMVSASTDD-IRSWR 318

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 27/139 (19%), Positives = 65/139 (46%), Gaps = 13/139 (9%)

Query: 138 RSNIKIVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKE 197
           R+ + ++    H+  I +   +P +  I++  +   T+ +++    K   +++    HK+
Sbjct: 237 RARVSVMTLIGHKSPINKVHCLPVDPQIVSC-STDATIRLWDIIAGKSRKVLT---HHKK 292

Query: 198 NGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFN 257
           +   +SF+P +   + + +DD  I  W + E + L       ++S  + I+N    N+  
Sbjct: 293 SVRDMSFHPREFSMVSASTDD--IRSWRLPEGALLTN-----FNSEKSGIINSLSVNQ-- 343

Query: 258 SNVFASVSEDSTLQLHDQR 276
            NV  +  ++ TL  +D +
Sbjct: 344 DNVLCAGGDNGTLSFYDYK 362

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/90 (22%), Positives = 38/90 (42%), Gaps = 15/90 (16%)

Query: 328 MNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAG 387
           +NGH   +  +   P  +   ++  ND  + +WD+                  + +  AG
Sbjct: 118 INGHLGWVRCVAVDPIDNEWFVTGSNDATIKIWDL--------------AKGHLKLTLAG 163

Query: 388 HRSAVNDFSINPNIPWLMASAEEENIIQVW 417
           H   V D +I+   P+ M SA E+ +++ W
Sbjct: 164 HAMTVRDIAISERHPY-MFSASEDKLVKCW 192

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 79/406 (19%), Positives = 169/406 (41%), Gaps = 50/406 (12%)

Query: 51  PLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHT--SGEEDNYLKIAAIDL 108
           P +Y+ +    L W  +T++ +P    S   +  Q +++ T T  S ++DN L +  +  
Sbjct: 125 PTVYEMLHNVNLPWSCMTLDIIPDLLGSERRNYPQSILMTTATQASKKKDNELLVLKMS- 183

Query: 109 PDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRARFMPQNTD---- 164
                Q +   +K +          +      I   +    ++   R +  P   +    
Sbjct: 184 -----QLTKTLVKEEEDENDEEEDNEDNDLDPIIENESISLKDTTNRIKISPFAAESPEV 238

Query: 165 IIATINGSGTVFIYN-------------QSNDKQSALISTLRFHKE-NGYGLSFNPNDK- 209
           + AT++ +G  +IY+             Q        + ++R H    GYGL ++P  K 
Sbjct: 239 LAATMSENGEAYIYDLGPQVKAFTSPGYQIPKTAQKPLHSIRNHGNVEGYGLDWSPLIKT 298

Query: 210 GKLLSGSDDGTIALWDIQENSTLA-KKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDS 268
           G +L+G   G + L     +  +  K+P  +    +N  + D +W+     VFA+   D 
Sbjct: 299 GSILTGDCSGRVYLTQRTASRWVTDKQPFTV---GNNKSIEDIQWSRAEMTVFATCGVDG 355

Query: 269 TLQLHDQR--EQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSV--- 323
            +++ D R  +    ++ + +    N +++++   YL+A+        ++D R  S    
Sbjct: 356 HIRIWDTRSKKHKPALSVMVSDTDVNVMSWNEKIGYLLASGDDSGTWGVWDLRQFSAQNT 415

Query: 324 ----PLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN-DIGAEQIPDDAEDGA 378
               P+   N H+ +IT++ F+P  + ++  +  D  V +WD++ +   E+I     + A
Sbjct: 416 EKTTPVAQYNFHKAAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQTAETA 475

Query: 379 ------PEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
                 P+++ +H   +  V D   +  IP  + S   +  + +WK
Sbjct: 476 ELQQIPPQLLFVH--WQRDVKDVKWHRQIPGCLVSTGTDG-LNIWK 518

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 61/129 (47%), Gaps = 9/129 (6%)

Query: 294 LAFSKHSQYLMAAAGTDSLVYLYDSRNLS-VPLYSMNGHEDSITNLEFSPHTDGVLISSG 352
           + +S+    + A  G D  + ++D+R+    P  S+   +  +  + ++    G L++SG
Sbjct: 338 IQWSRAEMTVFATCGVDGHIRIWDTRSKKHKPALSVMVSDTDVNVMSWNEKI-GYLLASG 396

Query: 353 NDRRVI-MWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEE 411
           +D     +WD+    A+    + E   P  +  +  H++A+   S NP    ++A A E+
Sbjct: 397 DDSGTWGVWDLRQFSAQ----NTEKTTP--VAQYNFHKAAITSISFNPLDESIIAVASED 450

Query: 412 NIIQVWKCS 420
           N + +W  S
Sbjct: 451 NTVTLWDLS 459

>TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.672
           YPL151C
          Length = 423

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 109/238 (45%), Gaps = 40/238 (16%)

Query: 188 LISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI 247
           L+  ++ H      +  +P D     +GS+D TI +WD      LA   LKI  S H   
Sbjct: 103 LMRVIKGHNGWVRCVQIDPVDNEWFATGSNDTTIKIWD------LASGKLKITLSGHAMT 156

Query: 248 VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTII-------NSIKTTDPFNTLAFSKHS 300
           V D   +  +  +F S SED   +  D  E+NT I       + + T D   TL      
Sbjct: 157 VRDIAISNRHPYLF-SASEDKLAKCWD-LEKNTAIRDYHGHLSGVHTVDIHPTLD----- 209

Query: 301 QYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMW 360
             L+A AG DS+V L+D R+  VP+ ++ GH+  I  +   P  +  +ISS  D  + +W
Sbjct: 210 --LIATAGRDSVVKLWDIRS-RVPVVTLIGHKSPINKVHCLP-VNPQVISSSVDATIRLW 265

Query: 361 DINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
           DI              G    ++ H  H+ ++ D + +P+  + MA+A  ++ I+ WK
Sbjct: 266 DI------------VAGKASKVLTH--HKRSIRDIAFHPS-EFSMATACTDD-IRSWK 307

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 25/123 (20%), Positives = 58/123 (47%), Gaps = 17/123 (13%)

Query: 304 MAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN 363
            A    D+ + ++D  +  + + +++GH  ++ ++  S +    L S+  D+    WD+ 
Sbjct: 127 FATGSNDTTIKIWDLASGKLKI-TLSGHAMTVRDIAIS-NRHPYLFSASEDKLAKCWDLE 184

Query: 364 DIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKL 423
              A              I  + GH S V+   I+P +  L+A+A  ++++++W    ++
Sbjct: 185 KNTA--------------IRDYHGHLSGVHTVDIHPTLD-LIATAGRDSVVKLWDIRSRV 229

Query: 424 PIV 426
           P+V
Sbjct: 230 PVV 232

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 84/176 (47%), Gaps = 18/176 (10%)

Query: 201 GLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNV 260
              +NP D   L+S S D T  +WD+ E+S   K  L      H+  V D ++   ++ +
Sbjct: 253 SFHWNPIDTNLLISSSIDTTCIIWDL-ESSNYVKTQLI----AHDSEVFDVRFLTQSTQL 307

Query: 261 FASVSEDSTLQLHDQRE--QNTII-NSIKTTDPFNT---------LAFSKHSQYLMAAAG 308
           FAS   D ++++ D R    +TII       DP ++         L  S H   ++A   
Sbjct: 308 FASCGGDGSVRVFDLRSLAHSTIIYEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATFA 367

Query: 309 TDS-LVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN 363
            DS  + + D RN   P+ ++ GH  S+  +++ P    +L+S  +D +V+ WD+N
Sbjct: 368 ADSNKIIILDMRNPETPVLTLQGHSSSLNQIKWHPTERNILLSCADDCQVLYWDLN 423

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 27/51 (52%)

Query: 139 SNIKIVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALI 189
           SN    +   H+ E+   RF+ Q+T + A+  G G+V +++  +   S +I
Sbjct: 281 SNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRSLAHSTII 331

>ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408)
           [960 bp, 319 aa] {ON} highly similar to uniprot|P38011
           Saccharomyces cerevisiae YMR116C ASC1 WD repeat protein
           (G-beta like protein) involved in translation regulation
           required for repression of Gcn4p activity in the absence
           of amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 103/243 (42%), Gaps = 25/243 (10%)

Query: 188 LISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI 247
           L  TL  H      L+ +      LLS S D T+  W +  +      P++ +   HN I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDKQYGVPVRSFQG-HNHI 67

Query: 248 VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAA 307
           V DC      +    S S D TL+L D     T    +       ++A  + +  +++ +
Sbjct: 68  VQDCSLTADGAYAL-SASWDKTLRLWDVATGQTYQRFVGHKSDVMSVAIDRKASMIISGS 126

Query: 308 GTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDG-----VLISSGNDRRVIMWDI 362
             D  V ++  R     L +M GH D ++ +  +P  D       +IS+G D+ V  W++
Sbjct: 127 -RDRTVKVWTIRGQC--LATMLGHNDWVSQVRIAPTEDANDDTVTVISAGMDKMVKAWNV 183

Query: 363 NDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHK 422
           N     QI  D             GH + VN  + +P+   L+ASA ++  I +W  + K
Sbjct: 184 NQF---QIEAD-----------FIGHNNYVNTITASPDGS-LVASAGKDGEIMLWNLADK 228

Query: 423 LPI 425
           +P+
Sbjct: 229 VPM 231

>CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247c
          Length = 513

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 90/202 (44%), Gaps = 32/202 (15%)

Query: 204 FNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFAS 263
           +NP D   L+S S D T  +WD+Q ++ +  + +      H+  V D ++   ++ +FAS
Sbjct: 243 WNPVDTNILISSSIDTTCIVWDLQSSNYVKTQLI-----AHDSEVFDVRFLTQSTQLFAS 297

Query: 264 VSEDSTLQLHDQR--EQNTIINSIKTTDP------------------FNTLAFSKHSQYL 303
              D ++++ D R    +TII     ++P                     L  S H   +
Sbjct: 298 CGGDGSVRVFDLRCLAHSTIIYEPPASEPGTGNNSSRSDSTDENSHALLRLEPSPHDPNV 357

Query: 304 MAA-AGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDI 362
           +A  A   + + + D RN   PL  +NGH  SI  +++ P     LIS  +D +V+ WDI
Sbjct: 358 LATFAIASNEILILDMRNPDSPLVVLNGHSASINQIKWHPTKKNTLISCSDDCQVLFWDI 417

Query: 363 N---DIGA---EQIPDDAEDGA 378
           +   D GA      P  A  GA
Sbjct: 418 SSYFDQGAVSHTTTPRPAASGA 439

 Score = 33.9 bits (76), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 61/151 (40%), Gaps = 17/151 (11%)

Query: 139 SNIKIVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKEN 198
           SN    +   H+ E+   RF+ Q+T + A+  G G+V +++      S +I       E 
Sbjct: 268 SNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPP-ASEP 326

Query: 199 GYGLSFNPNDKG-----KLL----SGSDDGTIALWDIQENSTL------AKKPLKIWDSV 243
           G G + + +D        LL    S  D   +A + I  N  L         PL + +  
Sbjct: 327 GTGNNSSRSDSTDENSHALLRLEPSPHDPNVLATFAIASNEILILDMRNPDSPLVVLNG- 385

Query: 244 HNDIVNDCKWNEFNSNVFASVSEDSTLQLHD 274
           H+  +N  KW+    N   S S+D  +   D
Sbjct: 386 HSASINQIKWHPTKKNTLISCSDDCQVLFWD 416

>YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; similar to the petunia WD repeat protein
           an11; overexpression causes a cell cycle delay or arrest
          Length = 523

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 82/180 (45%), Gaps = 25/180 (13%)

Query: 204 FNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFAS 263
           +N  D   ++S S D T  +WD+Q +  +  + +      H+  V D ++   ++ +FAS
Sbjct: 251 WNTVDTNLIISSSIDTTCIVWDLQSSHYVKTQLI-----AHDSEVFDVRFLTKSTQLFAS 305

Query: 264 VSEDSTLQLHDQRE-------------------QNTIINSIKTTDPFNTLAFSKHSQYLM 304
              D ++++ D R                      TI  S K +D    L  S +   ++
Sbjct: 306 CGGDGSVRVFDLRSLAHSTIIYEPPSSSVSGATAGTITPSSKGSDALLRLEPSPYDPNVL 365

Query: 305 AAAGTDS-LVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN 363
           A    DS  + + D RN   P+ ++ GH  S+  +++ P    VL+S G+D +V+ WD+N
Sbjct: 366 ATFAADSNKIIILDMRNPESPILNLQGHGSSVNGIKWHPTKRNVLLSCGDDCQVLYWDLN 425

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 61/155 (39%), Gaps = 14/155 (9%)

Query: 149 HEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGY-GLSFNPN 207
           H+ E+   RF+ ++T + A+  G G+V +++  +   S +I        +G    +  P+
Sbjct: 286 HDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSSVSGATAGTITPS 345

Query: 208 DKGK--LL----SGSDDGTIALWDIQENSTL------AKKPLKIWDSVHNDIVNDCKWNE 255
            KG   LL    S  D   +A +    N  +       + P+      H   VN  KW+ 
Sbjct: 346 SKGSDALLRLEPSPYDPNVLATFAADSNKIIILDMRNPESPILNLQG-HGSSVNGIKWHP 404

Query: 256 FNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDP 290
              NV  S  +D  +   D       IN+  +  P
Sbjct: 405 TKRNVLLSCGDDCQVLYWDLNSSFMEINAAGSKSP 439

>AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR196W (PWP1)
          Length = 562

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 88/182 (48%), Gaps = 17/182 (9%)

Query: 195 HKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHN-DIVNDCKW 253
           H +    L+ N + +  L S S D T+ LWD+  N   A + L   D+VH+   V+  +W
Sbjct: 270 HTDAVLSLAHNRHFRAVLASTSADHTVKLWDL--NHGRAARSL---DAVHSATAVSSSQW 324

Query: 254 NEFNSNVFASVSEDSTLQLHDQREQNTIINS----IKTTDPFNTLAFSKHSQYLMAAAGT 309
           +  + ++  +   DS + L D R  N    S    +   +   +  F   + +L   AGT
Sbjct: 325 HPSDGSILLTAGYDSRVALSDVRIANDAGMSKYWKVMKGEEIESATFVSETVFL---AGT 381

Query: 310 DSL-VYLYDSRNL--SVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVI-MWDINDI 365
           DS  VY +D RN   S PL+++N H+  I++L  SP    +L++S    +VI +W     
Sbjct: 382 DSGNVYSFDLRNGEDSAPLWTLNAHDSGISSLSVSPSIPNMLVTSAMGEKVIKLWKTPAE 441

Query: 366 GA 367
           GA
Sbjct: 442 GA 443

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 77/184 (41%), Gaps = 23/184 (12%)

Query: 244 HNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTI--INSIKTTDPFNTLAFSKHSQ 301
           H D V     N     V AS S D T++L D         ++++ +    ++  +     
Sbjct: 270 HTDAVLSLAHNRHFRAVLASTSADHTVKLWDLNHGRAARSLDAVHSATAVSSSQWHPSDG 329

Query: 302 YLMAAAGTDSLVYLYDSR-----NLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRR 356
            ++  AG DS V L D R      +S     M G E  I +  F   T  V ++  +   
Sbjct: 330 SILLTAGYDSRVALSDVRIANDAGMSKYWKVMKGEE--IESATFVSET--VFLAGTDSGN 385

Query: 357 VIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIP-WLMASAEEENIIQ 415
           V  +D+ +          ED AP  +     H S ++  S++P+IP  L+ SA  E +I+
Sbjct: 386 VYSFDLRN---------GEDSAP--LWTLNAHDSGISSLSVSPSIPNMLVTSAMGEKVIK 434

Query: 416 VWKC 419
           +WK 
Sbjct: 435 LWKT 438

>Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON}
           similar to Ashbya gossypii ADR090W
          Length = 1228

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 104/240 (43%), Gaps = 27/240 (11%)

Query: 189 ISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHN-DI 247
           ++ ++ H      L FN      L+SG   G I +WD  + +T    P     ++   + 
Sbjct: 97  VAKVKKHTTAVQTLRFNAKQSNVLVSGGSQGEIYVWDTNKIATQGYSPFGPGVAMTPIEE 156

Query: 248 VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLA--------FSKH 299
           V    WN+  ++VFAS        + D + +  +I+ +  T P + L            +
Sbjct: 157 VQSLAWNQTLAHVFASAGSSGFASIWDLKAKKEVIH-LSYTSPTSGLKNQLSVVEWHPSN 215

Query: 300 SQYLMAAAGTDS--LVYLYDSRNLSVPLYSMN-GHEDSITNLEFSPHTDGVLISSGNDRR 356
           S  +  A G D+  ++ ++D RN + PL  ++ GH   I +L++    D ++ISSG D  
Sbjct: 216 STKVATATGNDNEPVILVWDLRNSNAPLKVLSQGHSKGILSLDWCQQDDKLMISSGRDNT 275

Query: 357 VIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQV 416
            I+W+         P++A+           G+      F+  P  P L ASA  +N +QV
Sbjct: 276 CILWN---------PEEAQK---LTQFPTRGNWCFKTKFA--PEAPDLFASASFDNKVQV 321

>ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1282

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 94/208 (45%), Gaps = 22/208 (10%)

Query: 170 NGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQEN 229
           NGS  +F YN  + K  A     + HK       FN      L +G   G I +WD+  N
Sbjct: 83  NGSVELFSYNADSLKSEA---KFQRHKTTAKVARFNAKQFNVLATGGTKGEIFIWDV--N 137

Query: 230 STLAKK----PLKIWDSVHN-DIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINS 284
             L       PL   +S+   + +    WN+  ++VFAS    S   + D + +  +I+ 
Sbjct: 138 KCLENPNDYTPLTPGNSMTPVEEITSLAWNQSLAHVFASAGSTSYASIWDLKAKKEVIH- 196

Query: 285 IKTTDPFNTLA--------FSKHSQYLMAAAGTDS--LVYLYDSRNLSVPLYSMN-GHED 333
           +  T P   L           K+S  +  A G+D+   + ++D RN + PL  ++ GH  
Sbjct: 197 LSYTSPNTGLKAPLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQVLSQGHSK 256

Query: 334 SITNLEFSPHTDGVLISSGNDRRVIMWD 361
            + +L++    + +L+SSG D  V++W+
Sbjct: 257 GVLSLDWCNQDENLLLSSGRDNTVVLWN 284

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 66/145 (45%), Gaps = 16/145 (11%)

Query: 160 PQNTDIIATINGS---GTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGS 216
           P+N+  +AT  GS    ++ +++  N   + L    + H +    L +   D+  LLS  
Sbjct: 217 PKNSTRVATATGSDNDPSILVWDLRN-ANTPLQVLSQGHSKGVLSLDWCNQDENLLLSSG 275

Query: 217 DDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQR 276
            D T+ LW+ QE   L + P +      ++ V   K+     ++FAS S D+ +Q+    
Sbjct: 276 RDNTVVLWNPQEGQELTQFPTR------SNWVFKTKFASQAPDIFASASFDNKVQVQ--- 326

Query: 277 EQNTIINSIKTTDPFNTLAFSKHSQ 301
              T+ N + T D   T +  + S+
Sbjct: 327 ---TLQNLVNTLDQEQTASKQRESE 348

>Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 85/167 (50%), Gaps = 24/167 (14%)

Query: 203 SFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFA 262
           + +P D    ++GS+D T+ +WD      LA   LK   + H   V D   ++ +  +F 
Sbjct: 146 AIDPVDNEWFVTGSNDTTMKVWD------LATGKLKTTLAGHVMTVRDIAVSDRHPYLF- 198

Query: 263 SVSEDSTLQLHDQREQNTII-------NSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYL 315
           SVSED T++  D  E+N II       + ++T     TL        L+A AG DS+V L
Sbjct: 199 SVSEDKTVKCWDL-EKNHIIRDYYGHLSGVRTVSIHPTLD-------LIATAGRDSVVKL 250

Query: 316 YDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDI 362
           +D R   +P+ ++ GH+  I  ++ +P  D  ++SS  D  V +WDI
Sbjct: 251 WDIRT-RMPVITLVGHKGPINQVQCTP-VDPQIVSSSTDATVRLWDI 295

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 46/100 (46%), Gaps = 16/100 (16%)

Query: 327 SMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHA 386
           ++ GH  ++ ++  S      L S   D+ V  WD+                  +I  + 
Sbjct: 177 TLAGHVMTVRDIAVSDR-HPYLFSVSEDKTVKCWDLE--------------KNHIIRDYY 221

Query: 387 GHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIV 426
           GH S V   SI+P +  L+A+A  ++++++W    ++P++
Sbjct: 222 GHLSGVRTVSIHPTLD-LIATAGRDSVVKLWDIRTRMPVI 260

>Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON}
           (56367..60125) [3759 nt, 1253 aa]
          Length = 1252

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 73/273 (26%), Positives = 126/273 (46%), Gaps = 41/273 (15%)

Query: 166 IATINGSGTVFIYNQSNDKQS----ALISTLRFHKENGYGLSFNPNDKGKLLSGSD-DGT 220
           IA    +G + ++N  N  Q+      +S    HK +   L FN      L+SGSD +G 
Sbjct: 77  IAGALDNGNIELFNFDNKSQTIKSLGNLSDSNKHKGSVKTLKFNTKQSNLLVSGSDKNGE 136

Query: 221 IALWDIQENSTLAKKPLK--IWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQ 278
           I +WD+   + L K PL   +  +  N+I +   WN+  S+VF+  S  S + + D + +
Sbjct: 137 ILIWDL---NNLDKTPLTPGMPMTPTNEITS-LAWNKSLSHVFSCSSNTSNVSIFDLKAK 192

Query: 279 NTIINSIKTTDPFNTLA--FS------KHSQYLMAAA-GTDSL----VYLYDSRNLSVPL 325
             +I+ +  T+P N +   FS      K+S  +  A    DS     ++++D RN   PL
Sbjct: 193 KEVIH-LNYTNPVNNVKSLFSVVEWHPKNSTRIATATLNNDSTESDSIFIWDLRNSHTPL 251

Query: 326 --YSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIM 383
              S +GH + I +L++    + +L+SSG D  V++W            + E+G  E + 
Sbjct: 252 QILSKDGHSNGILSLDWCSTDENLLLSSGRDNSVMLW------------NPENG--ESLT 297

Query: 384 IHAGHRSAVNDFSINPNIPWLMASAEEENIIQV 416
            +   R+        P  P + A+A  +  I+V
Sbjct: 298 KYPSRRNWCFKTKFAPAFPDVFATASFDGKIEV 330

>KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa]
           {ON} Anc_7.310 YDL195W
          Length = 1240

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 99/209 (47%), Gaps = 17/209 (8%)

Query: 168 TINGS---GTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALW 224
           TI G+   G + ++  SND+ ++ ++ L  H  +   L FN   +  L+SGS+ G I +W
Sbjct: 76  TIAGALDNGIIELFYLSNDQLTS-VAKLTTHTSSVKTLKFNSKQENVLVSGSNKGEIFVW 134

Query: 225 DIQENSTLAKKPLKIWDSVHN-DIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIIN 283
           D  +       P+    ++   + +    WN+  ++VFAS        + D + +  +I+
Sbjct: 135 DTNKAKQTDYVPMTPGTAMTPLEEITSLSWNQSLAHVFASAGATVYASIWDLKAKKEVIH 194

Query: 284 SIKTTDPFNTLA--------FSKHSQYLMAAAGTDS--LVYLYDSRNLSVPLYSMN-GHE 332
            +  T P   L            +S  +  A G D+   + ++D RN + PL  ++ GH 
Sbjct: 195 -LSYTSPATGLKSQLSVVEWHPNNSTRVATATGNDNDPSILVWDLRNANTPLQVLDQGHS 253

Query: 333 DSITNLEFSPHTDGVLISSGNDRRVIMWD 361
             I +L++    + +++SSG D  V++W+
Sbjct: 254 KGIISLDWCHEDESLMLSSGRDNTVLLWN 282

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 51/106 (48%), Gaps = 6/106 (5%)

Query: 262 ASVSEDSTLQLHDQREQNTI--INSIKTTDPFNTLAFSKHSQYLMAAA--GTDSLVYLYD 317
           A+ S DS L+L      +T+  + SI T   FN L +S  ++ +  A   G   L YL +
Sbjct: 34  ANFSSDSVLELWSLLSTDTVKPVASISTDTKFNDLDWSYDNKTIAGALDNGIIELFYLSN 93

Query: 318 SRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN 363
            +  SV    +  H  S+  L+F+   + VL+S  N   + +WD N
Sbjct: 94  DQLTSV--AKLTTHTSSVKTLKFNSKQENVLVSGSNKGEIFVWDTN 137

>Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa]
           {ON} YDL195W (SEC31) - Component (p150) of COPII coat of
           secretory pathway vesicles [contig 161] FULL
          Length = 1296

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 90/200 (45%), Gaps = 14/200 (7%)

Query: 173 GTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTL 232
           G V  ++ S  K    I+ L  H      + FN      L SG   G I +WD  +  T 
Sbjct: 84  GVVEFFSPSEYKS---IAKLAQHSTPVKTVRFNAKQHNVLCSGGSKGEIYIWDANKIETP 140

Query: 233 AKKPLKIWDSVHN-DIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKT---T 288
              P     ++   D +    WN+   +VFAS        + D + +  +I+   T   T
Sbjct: 141 GYAPFVPGTAMTPMDEIYSLAWNQNQGHVFASAGSSGFASIWDLKAKKEVIHLSHTSSIT 200

Query: 289 DPFNTLAFSK----HSQYLMAAAGTDS--LVYLYDSRNLSVPLYSMN-GHEDSITNLEFS 341
              N L+  +    +S  +  A+G+DS   + ++D RN +VPL +++ GH   + +L++ 
Sbjct: 201 GQKNQLSIVEWHPNNSTRIATASGSDSDPSILVWDLRNANVPLQTLSQGHTKGVLSLDWC 260

Query: 342 PHTDGVLISSGNDRRVIMWD 361
              + +L+SSG D   ++W+
Sbjct: 261 KQDETLLLSSGRDNSCVLWN 280

>TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.276
           YPL247C
          Length = 598

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 84/344 (24%), Positives = 145/344 (42%), Gaps = 72/344 (20%)

Query: 48  SNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSGEEDNYLKIAAID 107
           SN  L ++ V+E  +T+P   ++WLPS      V N ++L     TS E    L+I ++D
Sbjct: 190 SNDLLTWEKVAECNVTYPVSNIQWLPS------VPNPRKLA----TSSE---CLRIWSLD 236

Query: 108 LPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEEITRARFMPQNTDIIA 167
                     NS+                 R N    K    +  ++  ++  Q+  I  
Sbjct: 237 ---------DNSMDNSSVFNNNISNNS---RHNT-YKKSLTEQVNLSLCKYNEQHQIINN 283

Query: 168 TINGSGTVFIYNQSNDKQ-SALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDI 226
           + N      + N+SN +    L     FH        +N  D   L+S S D T  +WD+
Sbjct: 284 STNS-----VSNKSNARLLGQLPPVTSFH--------WNSIDTNLLISSSIDTTCIVWDL 330

Query: 227 QENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQR--EQNTII-- 282
           Q ++ +  + +      H+  V D K+   ++ +FAS   D ++++ D R  + +TII  
Sbjct: 331 QSSNYVKTQLI-----AHDSEVFDVKFLIQSTQLFASCGGDGSIRVFDLRALQHSTIIYE 385

Query: 283 --NSIKTTDPFNT--------------------LAFSKHSQYLMAAAGTDS-LVYLYDSR 319
             N ++  + FN                     L  S     L+A  G D   + + D R
Sbjct: 386 TANDLQGNNTFNNDVTTKIDNSSANSLSHALLRLEPSPTDPNLIATFGLDKKAILILDMR 445

Query: 320 NLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN 363
           N  VP+  ++GH  S+  +++ P    VL+S G+D +V+ WD+N
Sbjct: 446 NPGVPVLVLSGHSPSVNQIKWHPSKPYVLLSCGDDCQVLYWDLN 489

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 82/198 (41%), Gaps = 40/198 (20%)

Query: 253 WNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDP--FNTLAFSKHSQYLMAAAGTD 310
           WN  ++N+  S S D+T  + D +  N +   +   D   F+ + F   S  L A+ G D
Sbjct: 308 WNSIDTNLLISSSIDTTCIVWDLQSSNYVKTQLIAHDSEVFD-VKFLIQSTQLFASCGGD 366

Query: 311 SLVYLYDSRNL--SVPLY-----------------------SMNGHEDSITNLEFSPHTD 345
             + ++D R L  S  +Y                       S N    ++  LE SP   
Sbjct: 367 GSIRVFDLRALQHSTIIYETANDLQGNNTFNNDVTTKIDNSSANSLSHALLRLEPSPTDP 426

Query: 346 GVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLM 405
            ++ + G D++ I+          I D    G P  +++ +GH  +VN    +P+ P+++
Sbjct: 427 NLIATFGLDKKAIL----------ILDMRNPGVP--VLVLSGHSPSVNQIKWHPSKPYVL 474

Query: 406 ASAEEENIIQVWKCSHKL 423
            S  ++  +  W  + +L
Sbjct: 475 LSCGDDCQVLYWDLNSEL 492

>TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa]
           {ON} Anc_6.340 YCR072C
          Length = 514

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 69/302 (22%), Positives = 122/302 (40%), Gaps = 73/302 (24%)

Query: 162 NTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNP------NDKGKLLSG 215
           + ++IAT +   T+ ++N  N K   +  +LR H +    L++ P        K +L S 
Sbjct: 196 DAEVIATGSMDNTIRLWNGINGK--PIGDSLRGHSKWITSLAWEPLHLVKVGQKPRLASA 253

Query: 216 SDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQ 275
           S DGTI +WD      L         S H   V+  +W     N+  + S D T+++ D 
Sbjct: 254 SKDGTIKVWDTTGRVCLYTL------SGHTSSVSCVRWG--GQNMLYTGSHDKTIRVWDM 305

Query: 276 REQNTIINSIKT-----------TD------PFN----------------------TLAF 296
                 IN +K+           TD      PF+                       +  
Sbjct: 306 NSNGRCINILKSHAHWVNHLSLSTDYALRIGPFDHSGAKPAIAEEARDKALKNYEKIVKK 365

Query: 297 SKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGV-LISSGNDR 355
           + H++ LM  A  D  ++L++    + PL  M GH+  + ++ FSP  DG  ++S+  D 
Sbjct: 366 NGHTEELMVTASDDFTMFLWNPLKSTKPLARMTGHQKLVNHVAFSP--DGRHIVSASFDN 423

Query: 356 RVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQ 415
            + +W            D  DG  + I    GH ++V   + + +   L+ S  ++  ++
Sbjct: 424 SIKLW------------DGRDG--KFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLK 468

Query: 416 VW 417
           VW
Sbjct: 469 VW 470

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 95/210 (45%), Gaps = 21/210 (10%)

Query: 164 DIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIAL 223
           DII  I     VF         SA+      H       +F PN   ++++G+ D T  L
Sbjct: 114 DIITLIYTPRAVFKVKPVTRSSSAIAG----HGSTILCSAFAPNSSSRMVTGAGDNTARL 169

Query: 224 WDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIIN 283
           WD    + +A        S H++ V    W+  ++ V A+ S D+T++L +      I +
Sbjct: 170 WDCDTQTPMATL------SGHSNWVLCVAWSP-DAEVIATGSMDNTIRLWNGINGKPIGD 222

Query: 284 SIK------TTDPFNTLAFSKHSQY-LMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSIT 336
           S++      T+  +  L   K  Q   +A+A  D  + ++D+    V LY+++GH  S++
Sbjct: 223 SLRGHSKWITSLAWEPLHLVKVGQKPRLASASKDGTIKVWDTTG-RVCLYTLSGHTSSVS 281

Query: 337 NLEFSPHTDGVLISSGNDRRVIMWDINDIG 366
            + +      +L +  +D+ + +WD+N  G
Sbjct: 282 CVRWGGQN--MLYTGSHDKTIRVWDMNSNG 309

>Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C
           (REAL)
          Length = 451

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 85/167 (50%), Gaps = 24/167 (14%)

Query: 203 SFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFA 262
           + +P +    ++GS+D T+ +WD      LA   L+   + H   V D   ++ +  +F 
Sbjct: 146 AIDPVNNEWFITGSNDTTMKVWD------LATGKLRTTLAGHVMTVRDIAISDRHPYLF- 198

Query: 263 SVSEDSTLQLHDQREQNTII-------NSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYL 315
           SVSED T++  D  E+N II       + ++T     TL        L+A AG DS++ L
Sbjct: 199 SVSEDKTVKCWDL-EKNQIIRDYYGHLSGVRTVSIHPTLD-------LIATAGRDSVIKL 250

Query: 316 YDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDI 362
           +D R   VP+ ++ GH+  I  ++ +P  D  ++SS  D  V +WD+
Sbjct: 251 WDIRT-RVPVITLVGHKGPINQVQCTP-VDPQIVSSSTDATVRLWDV 295

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 47/100 (47%), Gaps = 16/100 (16%)

Query: 327 SMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHA 386
           ++ GH  ++ ++  S      L S   D+ V  WD+                 ++I  + 
Sbjct: 177 TLAGHVMTVRDIAISDR-HPYLFSVSEDKTVKCWDLE--------------KNQIIRDYY 221

Query: 387 GHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIV 426
           GH S V   SI+P +  L+A+A  +++I++W    ++P++
Sbjct: 222 GHLSGVRTVSIHPTLD-LIATAGRDSVIKLWDIRTRVPVI 260

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 93/203 (45%), Gaps = 20/203 (9%)

Query: 201 GLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNV 260
           GL ++P D   LLSG  D  + LWD+  NS    +        H   V+  K +  +  +
Sbjct: 220 GLDWHP-DGNHLLSGGGDNLVKLWDMTSNSFEELRG-------HAGRVSRVKVHP-SGRL 270

Query: 261 FASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRN 320
            AS S D T  L D   +  +      +    T+AF      L+A+AG D++  ++D R+
Sbjct: 271 AASASFDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGA-LLASAGLDAVCAIWDLRS 329

Query: 321 LSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPE 380
              P+  + GH  +I+ +++SP+    L ++G D  V +WDI ++G E      +  A +
Sbjct: 330 -GEPIMKLEGHAGAISGVDWSPNGY-QLATAGADGTVRVWDIRNVGTESALLAHQVAALD 387

Query: 381 V--------IMIHAGHRSAVNDF 395
           V         ++  GH   VN F
Sbjct: 388 VKFKKNNGTFLVSCGHDRLVNIF 410

>SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1261

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 105/238 (44%), Gaps = 21/238 (8%)

Query: 135 QKPRSNIKIVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRF 194
           +KP+ +I    KF   +      + P N+ I+A    +G V  ++    K  A IS    
Sbjct: 53  EKPQGSITASAKFNDLD------WSPDNS-ILAGALDNGIVEFFSPKELKSVAKISK--- 102

Query: 195 HKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHN-DIVNDCKW 253
           H      L FN      L SG   G I +WDI + ++    P     ++   D V    W
Sbjct: 103 HTTPVNTLKFNAKQDNVLCSGDSRGEIFIWDINKITSSGYVPFSPGVAMTPIDEVYSLAW 162

Query: 254 NEFNSNVFASVSEDSTLQLHDQREQNTIIN---SIKTTDPFNTLAF----SKHSQYLMAA 306
           N+  ++VFAS        + D + +  +++   +  +T   N L+       +S  +  A
Sbjct: 163 NQSLAHVFASAGSSGYTSIWDLKAKKEVLHLSYTSPSTGAKNHLSVVEWHPSNSTKIATA 222

Query: 307 AGTDS--LVYLYDSRNLSVPLYSMN-GHEDSITNLEFSPHTDGVLISSGNDRRVIMWD 361
            G D+  ++ ++D RN   PL +M+ GH   I +L++    + +L+SSG D    +W+
Sbjct: 223 TGNDNDPVILVWDLRNAKAPLQAMSQGHSKGILSLDWCKQDENLLLSSGRDNTCALWN 280

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 53/112 (47%), Gaps = 12/112 (10%)

Query: 260 VFASVSEDSTLQLHD------QREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLV 313
           V A  S +STL+L        ++ Q +I  S K    FN L +S  +  ++A A  + +V
Sbjct: 32  VDADFSSESTLELWSLLSADVEKPQGSITASAK----FNDLDWSPDNS-ILAGALDNGIV 86

Query: 314 YLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDI 365
             +  + L   +  ++ H   +  L+F+   D VL S  +   + +WDIN I
Sbjct: 87  EFFSPKELKS-VAKISKHTTPVNTLKFNAKQDNVLCSGDSRGEIFIWDINKI 137

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 53/117 (45%), Gaps = 10/117 (8%)

Query: 160 PQNTDIIATINGS---GTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGS 216
           P N+  IAT  G+     + +++  N K + L +  + H +    L +   D+  LLS  
Sbjct: 213 PSNSTKIATATGNDNDPVILVWDLRNAK-APLQAMSQGHSKGILSLDWCKQDENLLLSSG 271

Query: 217 DDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLH 273
            D T ALW+ Q    L++ P +       +     K+     ++FAS S D+ +Q+ 
Sbjct: 272 RDNTCALWNPQTAQKLSQFPTR------GNWCFKTKFAPEAPDLFASASLDNKIQVQ 322

>TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.276
           YPL247C
          Length = 531

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 88/197 (44%), Gaps = 41/197 (20%)

Query: 204 FNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFAS 263
           +NP D   L+S S D T  +WD+Q N+ +  + +      H+  V D ++   ++ +FAS
Sbjct: 251 WNPIDTNFLISSSIDTTCIVWDLQSNNYVKTQLI-----AHDSEVFDVRFLTQSTQLFAS 305

Query: 264 VSEDSTLQLHDQRE--QNTII---------------------NSIKTTDPFNTLAFSKHS 300
              D ++++ D R    +TII                      S+ T+    ++  S  S
Sbjct: 306 CGGDGSVRVFDLRSLAHSTIIYESAANTSMSNLSSGGMVDHPGSLNTSSRVGSVDLSSKS 365

Query: 301 QYLM------------AAAGTDS-LVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGV 347
             L+            A  G DS  V + D RN   P+ +++GH   I  +++ P     
Sbjct: 366 NALLRLEPSPTDPNVIATFGADSNSVLILDMRNPGTPVLTLDGHSAPINQIKWHPTKKNT 425

Query: 348 LISSGNDRRVIMWDIND 364
           ++SS +D +V+ W++ND
Sbjct: 426 ILSSSDDCQVLYWNLND 442

>KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1231

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 86/188 (45%), Gaps = 13/188 (6%)

Query: 187 ALISTLRFHKENG--YGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDS-V 243
           AL S  + HK  G    L FN      L+SG   G I +WD  +  +    P     S  
Sbjct: 93  ALKSVAKIHKHQGPVKTLKFNAKQNNVLVSGGTQGEIFVWDSNKIGSSDYSPFSAGISNT 152

Query: 244 HNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIIN---SIKTTD---PFNTLAFS 297
             D V+   WN+  ++VFAS S      + D + +  +++   S  TT    P   + + 
Sbjct: 153 PIDEVSSLSWNQSLAHVFASASSSGYASVWDLKAKKQVLHLNHSSSTTGIKVPLTVVDWH 212

Query: 298 KHSQYLMAAAG---TDSLVYLYDSRNLSVPLYSMN-GHEDSITNLEFSPHTDGVLISSGN 353
             S  ++A A    T+ LV  +D RN  VPL  ++ GH   + +L++    + +L+SSG 
Sbjct: 213 PTSSTIIATASSSDTEPLVLTWDLRNAHVPLKVLSQGHSKGVLSLDWCKQDENLLLSSGR 272

Query: 354 DRRVIMWD 361
           D   ++W+
Sbjct: 273 DNTSVLWN 280

 Score = 38.1 bits (87), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 41/77 (53%), Gaps = 2/77 (2%)

Query: 291 FNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLIS 350
           FN L +S   + ++A A  + +V  +D + L   +  ++ H+  +  L+F+   + VL+S
Sbjct: 65  FNDLDWSGDDK-IIAGALENGVVEFFDPKALKS-VAKIHKHQGPVKTLKFNAKQNNVLVS 122

Query: 351 SGNDRRVIMWDINDIGA 367
            G    + +WD N IG+
Sbjct: 123 GGTQGEIFVWDSNKIGS 139

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/126 (19%), Positives = 54/126 (42%), Gaps = 10/126 (7%)

Query: 247 IVNDCKWNEFN----SNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQY 302
           +V D K+N+ +      + A   E+  ++  D +   ++    K   P  TL F+     
Sbjct: 59  VVADGKFNDLDWSGDDKIIAGALENGVVEFFDPKALKSVAKIHKHQGPVKTLKFNAKQNN 118

Query: 303 LMAAAGTDSLVYLYDSRNLSVPLYS------MNGHEDSITNLEFSPHTDGVLISSGNDRR 356
           ++ + GT   ++++DS  +    YS       N   D +++L ++     V  S+ +   
Sbjct: 119 VLVSGGTQGEIFVWDSNKIGSSDYSPFSAGISNTPIDEVSSLSWNQSLAHVFASASSSGY 178

Query: 357 VIMWDI 362
             +WD+
Sbjct: 179 ASVWDL 184

>NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4.122
          Length = 575

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 75/165 (45%), Gaps = 34/165 (20%)

Query: 212 LLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQ 271
           L  G  +G + ++D+ +   +   P       H D  +   WN   +++ +S S D T+ 
Sbjct: 322 LAVGQGNGIVEIYDVVKRKCIRTLP------GHVDRTSCLSWN---NHILSSGSRDHTIL 372

Query: 272 LHDQREQNTIINSIKTTDPFNTLAFSKHSQYL-----------MAAAGTDSLVYLYDSRN 320
             D R        IKT           HSQ +           +A+ G D++VY+YD  +
Sbjct: 373 HRDVRMAEPFFERIKT-----------HSQEVCGLKWNVDENKLASGGNDNMVYVYDGTS 421

Query: 321 LSVPLYSMNGHEDSITNLEFSPHTDGVLISSGN--DRRVIMWDIN 363
            S P++ +  H+ ++  + +SPH  G L + G   DR++ +W+IN
Sbjct: 422 -SSPVFKITEHKAAVKAMAWSPHKRGTLATGGGTVDRKLKIWNIN 465

>TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {ON}
           Anc_7.310 YDL195W
          Length = 1300

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 53/207 (25%), Positives = 100/207 (48%), Gaps = 18/207 (8%)

Query: 170 NGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQ-- 227
           NG   +F  N  +  +S  I  L  H  +   ++FN   +  L SGS +G I +WD+   
Sbjct: 83  NGMVELFKTNSKDTLKS--IKKLSKHGTSVTTVNFNAKQENVLASGSKNGEIFIWDLNKC 140

Query: 228 -ENSTLAKKPLKIWDSVHN-DIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSI 285
            + S  +  PL    ++   + +    WN+  S+VFAS    S   + D + +  +I+ +
Sbjct: 141 IDQSNDSYSPLTPGMAMTPVEEITSLAWNQSLSHVFASAGNTSYASIWDLKAKKEVIH-L 199

Query: 286 KTTDPFNTLA--------FSKHSQYLMAAAGTDS--LVYLYDSRNLSVPLYSM-NGHEDS 334
             T P ++L           ++S  +  A+ +D+  ++ ++D RN + PL  + NG+   
Sbjct: 200 SYTSPSSSLKPQLSVVEWHPENSTRVATASNSDNEPIILIWDLRNANTPLQILENGNSKG 259

Query: 335 ITNLEFSPHTDGVLISSGNDRRVIMWD 361
           I +L++  H   +L+SSG D   ++W+
Sbjct: 260 ILSLDWCKHDSNLLLSSGRDNTAVLWN 286

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 77/171 (45%), Gaps = 9/171 (5%)

Query: 260 VFASVSEDSTLQLHDQREQNTI--INSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLY- 316
           V A  S DSTL+L      + +  + S++    FN + +S  ++Y+ A A  + +V L+ 
Sbjct: 32  VDADFSSDSTLELWSLLSTDKLNPVVSVEANAKFNDIDWSIDNKYI-AGALDNGMVELFK 90

Query: 317 -DSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAE 375
            +S++    +  ++ H  S+T + F+   + VL S   +  + +WD+N    +Q  D   
Sbjct: 91  TNSKDTLKSIKKLSKHGTSVTTVNFNAKQENVLASGSKNGEIFIWDLNKC-IDQSNDSYS 149

Query: 376 DGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIV 426
              P + M        +   + N ++  + ASA   +   +W    K  ++
Sbjct: 150 PLTPGMAMTPVEE---ITSLAWNQSLSHVFASAGNTSYASIWDLKAKKEVI 197

>KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8.672
           YPL151C
          Length = 398

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 102/219 (46%), Gaps = 39/219 (17%)

Query: 202 LSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVF 261
           ++  P D    ++GS+D T+ +WD      LA   LK+  S H   V D   +E +  +F
Sbjct: 92  VAVEPVDNEWFVTGSNDTTLKVWD------LASGKLKLTLSGHTMGVRDVAVSERHPYMF 145

Query: 262 ASVSEDSTLQLHDQREQNTII-------NSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVY 314
            S SED  ++  D  E+NT I       + + T D   TL        L+A  G D++V 
Sbjct: 146 -SASEDKLVKCWDL-EKNTAIRDYYGHLSGVHTVDIHPTLD-------LIATGGRDAVVK 196

Query: 315 LYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDA 374
           L+D R     + ++ GH+  IT ++ +P  D  ++SS  D  V +WDI            
Sbjct: 197 LWDIRTRKA-VKTLVGHKAPITKVKCTP-VDPQVVSSSTDTTVRLWDI------------ 242

Query: 375 EDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENI 413
             G    ++ H  H+ AV   +++P   + +ASA  +++
Sbjct: 243 VAGKSMKVLTH--HKRAVRSIALHPG-EFSLASACTDDV 278

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 18/90 (20%), Positives = 40/90 (44%), Gaps = 15/90 (16%)

Query: 328 MNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAG 387
           +NGH   +  +   P  +   ++  ND  + +WD+               + ++ +  +G
Sbjct: 82  INGHLGWVRCVAVEPVDNEWFVTGSNDTTLKVWDL--------------ASGKLKLTLSG 127

Query: 388 HRSAVNDFSINPNIPWLMASAEEENIIQVW 417
           H   V D +++   P+ M SA E+ +++ W
Sbjct: 128 HTMGVRDVAVSERHPY-MFSASEDKLVKCW 156

>KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {ON}
           highly similar to uniprot|P25382 Saccharomyces
           cerevisiae YCR072C Protein required for cell viability
          Length = 514

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 70/300 (23%), Positives = 114/300 (38%), Gaps = 73/300 (24%)

Query: 164 DIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSF------NPNDKGKLLSGSD 217
           ++IAT +   T+ ++   ++K       LR H +    LS+       P DK +L S S 
Sbjct: 198 ELIATGSMDNTIRLWQ--SEKGENFGDALRGHSKWITSLSWEPIHLVKPGDKPRLASASK 255

Query: 218 DGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQRE 277
           DGTI +WD      L         S H + V+  KW      V  S S D T++  D   
Sbjct: 256 DGTIKIWDTARRVCLFTL------SGHTNSVSCVKWG--GRGVLYSGSHDKTIRAWDMNA 307

Query: 278 QNTIINSIK-----------TTDPFNTLAFSKHS-------------------------- 300
               IN +K           +TD    +    H+                          
Sbjct: 308 GGKCINILKSHAHWINHLSLSTDYALRVGAFDHTGKKPSSPEEARAKALENYEKIAKKNG 367

Query: 301 --QYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDG-VLISSGNDRRV 357
             + LM  A  D  +YL+D    + P+  M GH+  + ++ FSP  DG  ++S+  D  +
Sbjct: 368 KLEELMVTASDDFTMYLWDPIKSTKPITRMTGHQKLVNHVAFSP--DGRYIVSASFDNSI 425

Query: 358 IMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
            +W            D  DG    I    GH ++V   + + +   L+ S  ++  ++VW
Sbjct: 426 KLW------------DGRDGT--FIATFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 470

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 86/172 (50%), Gaps = 19/172 (11%)

Query: 203 SFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFA 262
           +F P+   ++++G+ D T  +WD   N+ +  + LK     H + V    W+  +  + A
Sbjct: 149 AFAPHTSSRMVTGAGDNTARIWDCNTNTPM--QTLK----GHFNWVLCVAWSP-DGELIA 201

Query: 263 SVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYL--------MAAAGTDSLVY 314
           + S D+T++L    +     ++++    + T + S    +L        +A+A  D  + 
Sbjct: 202 TGSMDNTIRLWQSEKGENFGDALRGHSKWIT-SLSWEPIHLVKPGDKPRLASASKDGTIK 260

Query: 315 LYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIG 366
           ++D+    V L++++GH +S++ +++     GVL S  +D+ +  WD+N  G
Sbjct: 261 IWDTAR-RVCLFTLSGHTNSVSCVKWGGR--GVLYSGSHDKTIRAWDMNAGG 309

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 40/91 (43%), Gaps = 19/91 (20%)

Query: 278 QNTIINSI-----KTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHE 332
           ++ I NSI     KTT+ F T+ ++  +              ++  R ++    ++ GH 
Sbjct: 97  KDNIYNSILKPGYKTTEDFITIVYTPRA--------------VFKVRPVTRSSSAIAGHG 142

Query: 333 DSITNLEFSPHTDGVLISSGNDRRVIMWDIN 363
            +I    F+PHT   +++   D    +WD N
Sbjct: 143 STILCSAFAPHTSSRMVTGAGDNTARIWDCN 173

>SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|Q750X9 Ashbya gossypii AGL190W
           AGL190Wp and similar to YDR142C uniprot|P39108
           Saccharomyces cerevisiae YDR142C PEX7 May serve as
           intraperoxisomal receptor for type 2 peroxisomal
           proteins (such as thiolase) Member of
           beta-transducin-related (WD- 40) protein family
          Length = 368

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 57/248 (22%), Positives = 111/248 (44%), Gaps = 34/248 (13%)

Query: 171 GSGTVFIYNQSNDKQSALISTLRFHKENG-YGLSFNPNDKGKLLSGSDDGTIALWDIQEN 229
           G+G +FI +   D    ++ +  F  ++G + +++N     ++L+   DG++ L+DI   
Sbjct: 36  GNGKLFILDI--DPHGRMVESNSFLTQDGLFDVAWNEGHANQVLAAQGDGSLRLFDIN-- 91

Query: 230 STLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTD 289
             L + P+ I+   H   V  C WN  N   F S S D T+++     Q     S+ T  
Sbjct: 92  --LPQYPISIFQE-HQKEVFSCNWNLVNKQTFVSSSWDGTVKIWSPMRQE----SLTTLV 144

Query: 290 PFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLI 349
           P       + S  + A AG    + L + +N S+    ++ ++D I   +FSPH   +++
Sbjct: 145 PIPM----ERSPLVEAKAGG---IPLSNQQNHSI----ISKNKDCIYQAQFSPHDPNLIM 193

Query: 350 SSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAE 409
               +  V ++D+        P +      +  M H G  +   DF  N   P ++A+  
Sbjct: 194 CCAGNSYVTLFDLRQ------PTNTNQ---QNFMSHGGLETLTCDF--NKYRPHIVATGG 242

Query: 410 EENIIQVW 417
            + ++++W
Sbjct: 243 VDKLVKIW 250

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 92/208 (44%), Gaps = 35/208 (16%)

Query: 189 ISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQEN---STLAKKPLKIWDSV-- 243
           IS  + H++  +  ++N  +K   +S S DGT+ +W        +TL   P++    V  
Sbjct: 97  ISIFQEHQKEVFSCNWNLVNKQTFVSSSWDGTVKIWSPMRQESLTTLVPIPMERSPLVEA 156

Query: 244 ------------------HNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQRE-QNTIINS 284
                             + D +   +++  + N+    + +S + L D R+  NT   +
Sbjct: 157 KAGGIPLSNQQNHSIISKNKDCIYQAQFSPHDPNLIMCCAGNSYVTLFDLRQPTNTNQQN 216

Query: 285 IKTTDPFNTLA--FSKHSQYLMAAAGTDSLVYLYD---SRNLSVPL---YSMN---GHED 333
             +     TL   F+K+  +++A  G D LV ++D    R  S PL    S+N   GHE 
Sbjct: 217 FMSHGGLETLTCDFNKYRPHIVATGGVDKLVKIWDLRMVRKFSNPLQQPMSINEIPGHEL 276

Query: 334 SITNLEFSPHTDGVLISSGNDRRVIMWD 361
           +I  + +SPH   +++S+  D    +WD
Sbjct: 277 AIRKVSWSPHHSNLVLSTSYDMTCRVWD 304

>KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} similar
           to uniprot|P53197 Saccharomyces cerevisiae YGL003C CDH1
           CDC20 homolog 1 protein required for Clb2 and Ase1
           degradation
          Length = 582

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 57/214 (26%), Positives = 93/214 (43%), Gaps = 42/214 (19%)

Query: 163 TDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLS-GSDDGTI 221
           TD++A   G       N +ND     ++ L   + +   LS+   D G  L+ G   G +
Sbjct: 290 TDVLAVALGKSIFLSDNTTND-----VTHLATSESDFTSLSWV--DSGSHLAVGLSSGIV 342

Query: 222 ALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTI 281
            ++D+ +N  +         S H D V    WN   ++V +S S D  +   D R     
Sbjct: 343 EIYDVLKNKCIRTL------SGHVDRVACLSWN---NHVLSSGSRDRKILHRDVRAPEPF 393

Query: 282 INSIKTTDPFNTLAFSKHSQYL-----------MAAAGTDSLVYLYDSRNLSVPLYSMNG 330
              I T           HSQ +           +A+ G D++VY+YD   L  P+ SM  
Sbjct: 394 FEQIDT-----------HSQEVCGLKWNVNENKLASGGNDNMVYVYDG-TLRQPMLSMEE 441

Query: 331 HEDSITNLEFSPHTDGVLISSGN--DRRVIMWDI 362
           H  ++  + +SPHT GVL + G   D+++ +W+I
Sbjct: 442 HTAAVKAMAWSPHTRGVLATGGGTADKKLKIWNI 475

>Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AER255C
          Length = 471

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 92/205 (44%), Gaps = 14/205 (6%)

Query: 188 LISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI 247
           +I+    H+     L F P      LSG +D  + +WD+  +  L +         H   
Sbjct: 170 IINVYDGHENGTTALKFLPKSGHLFLSGGNDNKLKIWDLYHDRRLLRDFCG-----HQKP 224

Query: 248 VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAA 307
           + D  +   +S  F SVS D  L++ D  E+  II+  K T   N + F   + Y +   
Sbjct: 225 IRDFNFTT-DSKQFTSVSYDKFLKIWDT-EKGAIIHRTKLTSVPNCVTFHPINNYELVVG 282

Query: 308 GTDSLVYLYDSRN--LSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWD--IN 363
             +S +  YD+R+   +  + + + H  SI  L+F P+     ISS  D+ + +WD  IN
Sbjct: 283 LLNSEIKHYDTRDNYKNGLIQTYDHHTSSIIALKFFPN-GSKFISSSEDKTIRIWDNQIN 341

Query: 364 DIGAEQIPDDAEDGAPEVIMIHAGH 388
            I  +QI D A+   P  I IH  H
Sbjct: 342 -IPIKQISDTAQHSMP-WIEIHPEH 364

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 88/192 (45%), Gaps = 19/192 (9%)

Query: 178 YNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPL 237
           Y+  ++ ++ LI T   H  +   L F PN   K +S S+D TI +WD Q N      P+
Sbjct: 291 YDTRDNYKNGLIQTYDHHTSSIIALKFFPNGS-KFISSSEDKTIRIWDNQINI-----PI 344

Query: 238 K-IWDSVHNDIVNDCKWNEFN--SNVFASVSEDSTLQLHDQREQNT-----IINSIKTTD 289
           K I D+  + +     W E +   N FA+ S D+++ ++  + +       I     +  
Sbjct: 345 KQISDTAQHSM----PWIEIHPEHNYFATQSMDNSIGVYSMKPKYKKHTKKIFKGHHSAG 400

Query: 290 PFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLI 349
                  S   +Y+ A+  +   ++++D +   +      G +D +TN+ ++P     +I
Sbjct: 401 YGIRFDISPDGRYI-ASGDSMGRLFIWDWKTCRILKQFNAGTKDPLTNVAWNPQETSKVI 459

Query: 350 SSGNDRRVIMWD 361
            SGN  ++ ++D
Sbjct: 460 CSGNSGKIFLFD 471

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/90 (21%), Positives = 39/90 (43%), Gaps = 14/90 (15%)

Query: 328 MNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAG 387
            +GHE+  T L+F P +  + +S GND ++ +WD+                  ++    G
Sbjct: 174 YDGHENGTTALKFLPKSGHLFLSGGNDNKLKIWDLYH-------------DRRLLRDFCG 220

Query: 388 HRSAVNDFSINPNIPWLMASAEEENIIQVW 417
           H+  + DF+   +      S   +  +++W
Sbjct: 221 HQKPIRDFNFTTDSK-QFTSVSYDKFLKIW 249

>Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa]
           {ON} complement(180839..181954) [1116 nt, 372 aa]
          Length = 371

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 70/282 (24%), Positives = 119/282 (42%), Gaps = 45/282 (15%)

Query: 171 GSGTVFIYNQSNDKQSALISTLRFHKENG-YGLSFNPNDKGKLLSGSDDGTIALWDIQEN 229
           G+G +FI +   D Q  + S   F  ++  Y +++N   + ++L    DG++ L+D    
Sbjct: 37  GNGNLFILDI--DPQGRIHSMNSFMTQDCLYDVAWNELHENQVLVAQGDGSLRLFD---- 90

Query: 230 STLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDS--------------TLQLHDQ 275
           ++L K P+ I+   H+  V  C WN  N   F S S D               TLQ+   
Sbjct: 91  TSLQKFPIAIFKE-HSKEVLSCNWNLINKQTFVSSSWDGTVKIWTPNRKESLRTLQVQPV 149

Query: 276 REQNTIINSI-KTTDPFNTLA----------FSKHSQYLMAAAGTDSLVYLYDSR----- 319
            +   + N+I KT     T++          FS H + L+     +S V L+D R     
Sbjct: 150 MQSQLVDNTIAKTNGSRGTISANKNCIYQAQFSPHDENLVMCCSGNSYVTLFDLRQPNSN 209

Query: 320 NLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN---DIGAEQIPDDAED 376
           N      + NG E      +F+ +   V+ +SG D  + +WDI    ++G +        
Sbjct: 210 NKQQRFLAHNGSE--TLTCDFNKYRPTVVATSGVDSSIRIWDIRMLVNLGPQS--QHINS 265

Query: 377 GAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
            A  +  I   H  AV   + +P+ P ++ SA  +    VW+
Sbjct: 266 SAACINEITRAHELAVRKVAWSPHHPNVLLSASYDMTCSVWQ 307

>TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.122
           YGL003C
          Length = 631

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 78/155 (50%), Gaps = 14/155 (9%)

Query: 212 LLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQ 271
           L  G  +G + ++DI     + +K ++   S H+D V+   WN   +++ +S S D  + 
Sbjct: 382 LAVGQSNGLVEIYDI-----IKRKCIRTL-SGHSDRVSCLSWN---NHILSSGSRDRKIL 432

Query: 272 LHDQREQNTIINSIKT-TDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNG 330
             D R  ++    I+T T     L ++     L A+ G D++VY+YD  N S P      
Sbjct: 433 HRDVRSPDSYFTQIETHTQEVCGLKWNIEDNRL-ASGGNDNIVYVYDGVN-SKPTLMFTE 490

Query: 331 HEDSITNLEFSPHTDGVLISSGN--DRRVIMWDIN 363
           H  ++  + +SPH  G+L + G   DRR+ +W++N
Sbjct: 491 HTAAVKAMTWSPHRRGILATGGGTADRRLKIWNVN 525

>KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability,
          Length = 515

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 69/300 (23%), Positives = 112/300 (37%), Gaps = 73/300 (24%)

Query: 164 DIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSF------NPNDKGKLLSGSD 217
           ++IAT +   T+ ++  S  K       LR H +    LS+       P DK +L + S 
Sbjct: 199 ELIATGSMDNTIRLWESSKGKPYG--DALRGHSKWITSLSWEPIHLVKPGDKPRLATASK 256

Query: 218 DGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQRE 277
           DGTI +WD      L           H   V+  KW     NV  S S D T++  D   
Sbjct: 257 DGTIKIWDTTRRVCLLTL------CGHTSSVSCVKWG--GKNVLYSGSHDKTIRCWDMNL 308

Query: 278 QNTIINSIKT-----------TDPFNTLAFSKHS-------------------------- 300
               IN +K+           TD    L    H                           
Sbjct: 309 NGKCINILKSHAHWVNHLSLSTDYALRLGAFDHKGETPASPEEAQQKALKNYEKVAKRKG 368

Query: 301 --QYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDG-VLISSGNDRRV 357
             + LM  A  D  +YL++    + P+  M GH+  + ++ FSP  DG  ++S+  D  +
Sbjct: 369 DFEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSP--DGRYIVSASFDNSI 426

Query: 358 IMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
            +W            D  DG  + +    GH ++V   + + +   L+ S  ++  ++VW
Sbjct: 427 KLW------------DGRDG--KFLSTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 471

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 79/169 (46%), Gaps = 19/169 (11%)

Query: 203 SFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFA 262
           +F PN   ++++G+ D T  +WD    + +           H++ V  C W+  +  + A
Sbjct: 150 AFAPNTSSRMVTGAGDNTACIWDCDTQTRMCTL------QGHHNWVLCCSWSP-DGELIA 202

Query: 263 SVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYL--------MAAAGTDSLVY 314
           + S D+T++L +  +     ++++    + T + S    +L        +A A  D  + 
Sbjct: 203 TGSMDNTIRLWESSKGKPYGDALRGHSKWIT-SLSWEPIHLVKPGDKPRLATASKDGTIK 261

Query: 315 LYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN 363
           ++D+    V L ++ GH  S++ +++      VL S  +D+ +  WD+N
Sbjct: 262 IWDTTR-RVCLLTLCGHTSSVSCVKWG--GKNVLYSGSHDKTIRCWDMN 307

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 30/160 (18%), Positives = 67/160 (41%), Gaps = 29/160 (18%)

Query: 265 SEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVP 324
           +++  + + D   Q+ +   +KTT+ F TL ++  +              ++  + ++  
Sbjct: 90  ADEEMVDIRDNLYQSILKPGLKTTEDFLTLVYTPRA--------------IFKVKPVTRS 135

Query: 325 LYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMI 384
             ++ GH  +I    F+P+T   +++   D    +WD              D    +  +
Sbjct: 136 SSAIAGHGSTILCSAFAPNTSSRMVTGAGDNTACIWDC-------------DTQTRMCTL 182

Query: 385 HAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLP 424
             GH + V   S +P+   L+A+   +N I++W+ S   P
Sbjct: 183 Q-GHHNWVLCCSWSPDGE-LIATGSMDNTIRLWESSKGKP 220

>SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247C Hypothetical ORF
          Length = 415

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 59/251 (23%), Positives = 111/251 (44%), Gaps = 46/251 (18%)

Query: 153 ITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKE-NGYGLS-------- 203
           +TR +++P+    +AT + S  ++    S  +Q  L S  ++ K+ NG   S        
Sbjct: 111 VTRCQWLPKGGGKLATCSDSLRIWSVGDSLQEQLNL-SLCKYSKQSNGSTASAALGSLPP 169

Query: 204 -----FNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNS 258
                +N  D   ++S S D T  +WD+Q ++ +  + +      H+  V D K+   ++
Sbjct: 170 VTSFDWNSVDTNLIISSSIDTTCTVWDLQSSNYVKTQLI-----AHDSEVYDVKFLTNST 224

Query: 259 NVFASVSEDSTLQLHDQR--EQNTII---------NSIKTTDPFNT-------------- 293
            +FAS   D ++++ D R    +TII          ++K++   N               
Sbjct: 225 QLFASCGGDGSVRVFDLRCLAHSTIIYEPLAGLTSGTVKSSGEGNVGGNEDGTNHTALLR 284

Query: 294 LAFSKHSQYLMAAAGTDS-LVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSG 352
           L  S     ++A    DS  V + D R    P+ ++ GH  ++  + + P    VL++ G
Sbjct: 285 LEPSPFDPNVVATFTQDSNAVLILDMRYPGSPILTLEGHSSAVNQMRWHPTQRNVLLTCG 344

Query: 353 NDRRVIMWDIN 363
           +D +V+ WDIN
Sbjct: 345 DDCQVLYWDIN 355

>Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}
           similar to Ashbya gossypii AFL157C
          Length = 435

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 68/269 (25%), Positives = 120/269 (44%), Gaps = 63/269 (23%)

Query: 153 ITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHK-----ENGYGL----- 202
           ++R ++MP +++ +AT + S  ++       +Q  L S +++ K      NG+ L     
Sbjct: 110 VSRIQWMPMSSEKLATCSDSLRIWSLGDQLKEQVNL-SLVKYGKGVGDVANGHTLGKLPP 168

Query: 203 --SFNPN--DKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNS 258
             SF+ N  D   +LS S D T  +WD+Q ++ +  + +      H+  V D K+   +S
Sbjct: 169 VTSFDWNSIDTNIILSSSIDTTCTVWDLQASNYVKTQLI-----AHDSEVFDAKFLTQSS 223

Query: 259 NVFASVSEDSTLQLHDQR--EQNTII----NSIKTTDPFN-------------------- 292
           N+FAS   D ++++ D R    +TII    + I+T  P                      
Sbjct: 224 NLFASCGGDGSVRVFDLRCLAHSTIIYEPQSQIQTHTPSQIQLSAQGHDDGHARKNNQNA 283

Query: 293 ---TLAFSK-HSQYLM------------AAAGTDS-LVYLYDSRNLSVPLYSMNGHEDSI 335
              +LA S   SQ L+            A    DS +V + D R    P+ ++NGH  ++
Sbjct: 284 AETSLAVSSLESQALLRLEPSPFDPNILATIQQDSNVVIILDMRYPGSPILTLNGHYCAL 343

Query: 336 TNLEFSPHTDGVLISSGNDRRVIMWDIND 364
             L + P    VL + G+D +++ WD+ D
Sbjct: 344 NQLRWHPSKPNVLATCGDDCQILYWDLLD 372

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 54/236 (22%), Positives = 85/236 (36%), Gaps = 66/236 (27%)

Query: 225 DIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINS 284
           D+    TL K P           V    WN  ++N+  S S D+T  + D +  N +   
Sbjct: 156 DVANGHTLGKLP----------PVTSFDWNSIDTNIILSSSIDTTCTVWDLQASNYVKTQ 205

Query: 285 IKTTDP--FNTLAFSKHSQYLMAAAGTDSLVYLYDSRNL--SVPLY-------------- 326
           +   D   F+   F   S  L A+ G D  V ++D R L  S  +Y              
Sbjct: 206 LIAHDSEVFDA-KFLTQSSNLFASCGGDGSVRVFDLRCLAHSTIIYEPQSQIQTHTPSQI 264

Query: 327 --SMNGHED-----------------------SITNLEFSPHTDGVLISSGNDRRVIMWD 361
             S  GH+D                       ++  LE SP    +L +   D  V++  
Sbjct: 265 QLSAQGHDDGHARKNNQNAAETSLAVSSLESQALLRLEPSPFDPNILATIQQDSNVVI-- 322

Query: 362 INDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
                   I D    G+P  I+   GH  A+N    +P+ P ++A+  ++  I  W
Sbjct: 323 --------ILDMRYPGSP--ILTLNGHYCALNQLRWHPSKPNVLATCGDDCQILYW 368

>KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 437

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 88/182 (48%), Gaps = 26/182 (14%)

Query: 198 NGY--GLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNE 255
           NG+   +  +P D     +GS+D TI +WD      LA   LK+  + H   V     ++
Sbjct: 125 NGWVRCVCVDPVDNEWFATGSNDTTIKVWD------LASGKLKLTLAGHVMTVRSIAISQ 178

Query: 256 FNSNVFASVSEDSTLQLHDQREQNTII-------NSIKTTDPFNTLAFSKHSQYLMAAAG 308
            +  +F S SED  ++  D  E+NT++       + + T D   TL        L+A+AG
Sbjct: 179 RHPLMF-SASEDKLVKCWDL-EKNTVVRDYHGHFSGVHTVDVHPTLD-------LIASAG 229

Query: 309 TDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAE 368
            D++V L+D R   VP+ ++ GH+  I  ++  P  D  ++S   D  V +WDI    A 
Sbjct: 230 RDAVVRLWDIRT-RVPVMTLAGHKGPINQVKCFP-VDPQIMSGSADSTVRLWDIRAGKAM 287

Query: 369 QI 370
           +I
Sbjct: 288 KI 289

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 96/226 (42%), Gaps = 30/226 (13%)

Query: 164 DIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIAL 223
           D+IA+      V +++    +    + TL  HK     +   P D  +++SGS D T+ L
Sbjct: 223 DLIASAGRDAVVRLWDI---RTRVPVMTLAGHKGPINQVKCFPVDP-QIMSGSADSTVRL 278

Query: 224 WDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVF-ASVSEDSTLQLHDQREQNTII 282
           WDI+     A K +KI  + H+  V     N   S+V  AS S+  + +L D      ++
Sbjct: 279 WDIR-----AGKAMKIL-THHSKSVRAIAGNPSESSVATASTSDIRSWRLQD----GQLL 328

Query: 283 NSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRN----LSVPLYSMNG---HEDSI 335
            + ++ D       S +   ++ A G D  +  YD +       +P   + G    E  I
Sbjct: 329 TNFRSEDTGIINCLSVNPDGVLFAGGDDGHLSFYDYKTGHKFQDLPTIKVPGSLESERGI 388

Query: 336 TNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEV 381
            +  F   T   LI+  +D+ + +W       +QIP   ++  P +
Sbjct: 389 LSASFD-QTGLRLITGESDKSIKVW-------KQIPGATQETHPNL 426

 Score = 33.5 bits (75), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 24/123 (19%), Positives = 57/123 (46%), Gaps = 17/123 (13%)

Query: 304 MAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN 363
            A    D+ + ++D  +  + L ++ GH  ++ ++  S     ++ S+  D+ V  WD+ 
Sbjct: 141 FATGSNDTTIKVWDLASGKLKL-TLAGHVMTVRSIAIS-QRHPLMFSASEDKLVKCWDLE 198

Query: 364 DIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKL 423
                            V+  + GH S V+   ++P +  L+ASA  + ++++W    ++
Sbjct: 199 --------------KNTVVRDYHGHFSGVHTVDVHPTLD-LIASAGRDAVVRLWDIRTRV 243

Query: 424 PIV 426
           P++
Sbjct: 244 PVM 246

>NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 85/171 (49%), Gaps = 17/171 (9%)

Query: 203 SFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFA 262
           +F PN   ++++G+ D T  +WD    +  A        + H + V    W   N  V A
Sbjct: 150 AFAPNSSSRMVTGAGDNTARIWDCDTQTPKATL------TGHTNWVLCVSWCP-NGEVIA 202

Query: 263 SVSEDSTLQLHDQREQNTIINSIK------TTDPFNTLAFSKHS-QYLMAAAGTDSLVYL 315
           + S D+T++L + +    + ++++      T+  +  +   K   Q  +A+A  D  + +
Sbjct: 203 TGSMDNTIRLWEGKSGKPVGDALRGHLKWITSLAWEPIHLVKAGEQPRLASASKDGTIKI 262

Query: 316 YDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIG 366
           +D+ +  V LY+++GH +S++ +++     G+L S  +D+ V  WD+N  G
Sbjct: 263 WDT-SRRVCLYTLSGHTNSVSCIKWGGQ--GILYSGSHDKTVRAWDMNSEG 310

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 66/302 (21%), Positives = 115/302 (38%), Gaps = 73/302 (24%)

Query: 162 NTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNP------NDKGKLLSG 215
           N ++IAT +   T+ ++   + K       LR H +    L++ P       ++ +L S 
Sbjct: 197 NGEVIATGSMDNTIRLWEGKSGKPVG--DALRGHLKWITSLAWEPIHLVKAGEQPRLASA 254

Query: 216 SDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQ 275
           S DGTI +WD      L         S H + V+  KW      +  S S D T++  D 
Sbjct: 255 SKDGTIKIWDTSRRVCLYTL------SGHTNSVSCIKWG--GQGILYSGSHDKTVRAWDM 306

Query: 276 REQNTIINSIKT-----------------TDPFNTLAFSKHS------------------ 300
             +   IN +K+                   PF+       S                  
Sbjct: 307 NSEGRCINVLKSHAHWVNHLSLSTDYALRVGPFDHTGVEPTSPEDARDKALKNYEKVVKK 366

Query: 301 ----QYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDG-VLISSGNDR 355
               + LM  A  D  ++L++    + PL  M GH+  + ++ FSP  DG  ++S+  D 
Sbjct: 367 NGRVEELMVTASDDFTMFLWNPLKSTKPLGRMTGHQKLVNHVAFSP--DGRYIVSASFDN 424

Query: 356 RVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQ 415
            + +W            D  DG  + I    GH ++V   + + +   L+ S  ++  ++
Sbjct: 425 SIKLW------------DGRDG--KFISTFRGHVASVYQVAWSADCR-LLVSCSKDTTLK 469

Query: 416 VW 417
           VW
Sbjct: 470 VW 471

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 78/144 (54%), Gaps = 16/144 (11%)

Query: 254 NEF-NSNVFASVSEDSTLQLHDQREQNTI--INSIKTTDPFNTLAFSKHSQYLMAA--AG 308
           NEF NS++FAS S+DS +++ D R  + +  +++ K+  PF +L  S+H         +G
Sbjct: 66  NEFTNSDLFASASKDS-VKIFDVRTSSCVATLHNDKSA-PFLSLD-SRHDMLACGTELSG 122

Query: 309 TDSLVYLYDSRNLSVPLYS-MNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGA 367
            D+ +++YD + LS PL S ++ H D IT+ +F P   GVL+S   D  V ++D+ +   
Sbjct: 123 VDAELHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDLTN--- 179

Query: 368 EQIPDDAEDGAPEVIMIHAGHRSA 391
                D ED   +VI   + H   
Sbjct: 180 ----SDEEDALHQVINFASVHSCG 199

>ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL138C
          Length = 1361

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 94/209 (44%), Gaps = 29/209 (13%)

Query: 164 DIIATINGSGTVFIY--NQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTI 221
           + IA    S +V IY  N+++ K S LI+TL  H  +   + FN      L+SG  DG I
Sbjct: 197 NYIAICGTSTSVSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQDGCI 256

Query: 222 ALWDIQENSTLAKKPLKIWDSVHNDIVNDCKW----------------NEFNSNVFASVS 265
            +WD++ +S    +    ++S  +D V D KW                +   SN FASV 
Sbjct: 257 KVWDLRSHSYKVNRSDLNFNS-GSDSVRDVKWMPTYDFASLGADTSLCSSGRSNKFASVH 315

Query: 266 EDSTLQLHDQREQNTIINSIKT-TDPFNTLAFSKHSQYLMAAA--GTDSLVYLYDSRN-- 320
           +   L   D R+ N +   I   + P   + +  H  Y+++    G  +L Y+ D  N  
Sbjct: 316 DSGLLLTFDMRQPNQVERKINAHSGPGLCMHWHPHMDYIISGGRDGKCALWYVGDKVNSM 375

Query: 321 LSVPLYSMNGHEDSIT-NLEFSPHTDGVL 348
           +SVP     GH  + + ++  +P T G L
Sbjct: 376 VSVP----QGHNSATSYSINTAPITTGYL 400

 Score = 34.7 bits (78), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 5/72 (6%)

Query: 295 AFSKHSQYLMAAAGTDSLVYLYDSRNLSV---PLYS-MNGHEDSITNLEFSPHTDGVLIS 350
            F  H  Y+ A  GT + V +YD    S    PL + ++ H  SI +++F+     +LIS
Sbjct: 191 GFHHHKNYI-AICGTSTSVSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLIS 249

Query: 351 SGNDRRVIMWDI 362
            G D  + +WD+
Sbjct: 250 GGQDGCIKVWDL 261

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 83/177 (46%), Gaps = 25/177 (14%)

Query: 208 DKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSED 267
           D   ++S S D T  +WD+Q +  +  + +      H+  V D ++   ++ +FAS   D
Sbjct: 255 DTNLIISSSIDTTCIVWDLQSSHYVKTQLI-----AHDSEVFDVRFLTKSTQLFASCGGD 309

Query: 268 STLQLHDQRE--QNTIIN-----------------SIKTTDPFNTLAFSKHSQYLMAAAG 308
            ++++ D R    +TII                  + K +D    L  S +   ++A   
Sbjct: 310 GSVRVFDLRSLAHSTIIYEPPASSAPGLNADTTTPASKGSDALLRLEPSPYDPNVLATFA 369

Query: 309 TDS-LVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIND 364
            +S  + + D RN   P+ ++ GH  S+  +++ P    VL+S G+D +V+ WD+N+
Sbjct: 370 AESNKIIILDMRNPESPILNLEGHSSSVNEIKWHPTKRNVLLSCGDDCQVLYWDLNN 426

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 80/187 (42%), Gaps = 37/187 (19%)

Query: 253 WNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDP--FNTLAFSKHSQYLMAAAGTD 310
           WN  ++N+  S S D+T  + D +  + +   +   D   F+    +K +Q L A+ G D
Sbjct: 251 WNMVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQ-LFASCGGD 309

Query: 311 SLVYLYDSRNLS-------VPLYSMNG-----------HEDSITNLEFSPHTDGVLIS-S 351
             V ++D R+L+        P  S  G             D++  LE SP+   VL + +
Sbjct: 310 GSVRVFDLRSLAHSTIIYEPPASSAPGLNADTTTPASKGSDALLRLEPSPYDPNVLATFA 369

Query: 352 GNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIH-AGHRSAVNDFSINPNIPWLMASAEE 410
               ++I+ D+ +              PE  +++  GH S+VN+   +P    ++ S  +
Sbjct: 370 AESNKIIILDMRN--------------PESPILNLEGHSSSVNEIKWHPTKRNVLLSCGD 415

Query: 411 ENIIQVW 417
           +  +  W
Sbjct: 416 DCQVLYW 422

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 59/143 (41%), Gaps = 22/143 (15%)

Query: 149 HEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFN--- 205
           H+ E+   RF+ ++T + A+  G G+V ++    D +S   ST+ +          N   
Sbjct: 286 HDSEVFDVRFLTKSTQLFASCGGDGSVRVF----DLRSLAHSTIIYEPPASSAPGLNADT 341

Query: 206 --PNDKGK--LL----SGSDDGTIALWDIQENSTL------AKKPLKIWDSVHNDIVNDC 251
             P  KG   LL    S  D   +A +  + N  +       + P+   +  H+  VN+ 
Sbjct: 342 TTPASKGSDALLRLEPSPYDPNVLATFAAESNKIIILDMRNPESPILNLEG-HSSSVNEI 400

Query: 252 KWNEFNSNVFASVSEDSTLQLHD 274
           KW+    NV  S  +D  +   D
Sbjct: 401 KWHPTKRNVLLSCGDDCQVLYWD 423

>TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {ON}
           Anc_8.316 YDR142C
          Length = 362

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 104/238 (43%), Gaps = 37/238 (15%)

Query: 166 IATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWD 225
           +    G GT+ +++ +N  Q   I   + H    +  ++N   +   +SGS DG + +WD
Sbjct: 76  VLVAQGDGTLTLFDLTNKLQQ--IQIYKEHYSEVFSCNWNMLTRRTFISGSWDGKVKIWD 133

Query: 226 ---------IQENSTLAK-------KPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDST 269
                    ++ N +L         K L+  +S + D +    ++  + N+    S +S 
Sbjct: 134 CARSESVLTLRNNRSLGHTGEHIETKALQR-NSKNKDCIYQALFSPHDPNMAMCCSGNSY 192

Query: 270 LQLHDQREQNTIINSIKTTDPFNTLA--FSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYS 327
           L   D R+ N   NSI       TL+  ++K+  Y++A+AG D  + ++D R +    ++
Sbjct: 193 LTFFDLRQPNQ-QNSILAHSGLETLSCDYNKYRSYIVASAGVDKAIRIWDLRMIKNKPHN 251

Query: 328 M--------------NGHEDSITNLEFSPHTDGVLISSGNDRRVIMW-DINDIGAEQI 370
           M              N HE +I  + +SPH     +++  D    +W D++  G  Q+
Sbjct: 252 MFADISSYNCTNEVVNAHELAIRKILWSPHHSNYFLTTSYDLTCRVWQDLSHDGTRQV 309

>ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL151C (PRP46)
          Length = 425

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/217 (27%), Positives = 95/217 (43%), Gaps = 26/217 (11%)

Query: 202 LSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVF 261
           +  +P D     +GS+D TI +WD      LA   LK+    H   V D   +  +  +F
Sbjct: 119 VCVDPVDNAWFATGSNDSTIRVWD------LATGKLKVTLQGHIMTVRDICISARHPYMF 172

Query: 262 ASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNL 321
            S S+D  ++  D  E+NT++     T           S  L+ +AG DS+V ++D R+ 
Sbjct: 173 -SASQDKLVKCWDL-ERNTVVRDFHGTLSGVHSVDLHPSLDLIVSAGRDSVVRVWDIRSR 230

Query: 322 SVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEV 381
           S  L ++ GH   I  +   P  D  ++S   D  V +WD+              G P  
Sbjct: 231 SCVL-TLAGHRGPINKVRCLP-VDPQIVSCSTDATVKLWDL------------VAGKPMK 276

Query: 382 IMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
            + H  H+  V D + NP   +  ASA  ++ I+ WK
Sbjct: 277 TLTH--HKRNVRDLAFNPT-EFSFASACTDD-IRSWK 309

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 100/213 (46%), Gaps = 25/213 (11%)

Query: 187 ALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHND 246
           +L+    F  EN + L   P  K  LL+G  +G I L D      L K  ++  ++  ND
Sbjct: 5   SLVDLNSFGSEN-WCLKLQPAYKHGLLTGLSNGEICLLDWNTGKPLQK--IRASETAIND 61

Query: 247 I-VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTI--INSIKTTDPFNTLAFSKHSQYL 303
           + + D  +     N+ +S S DS +++ D R  + +  IN+ +T  PF +L  S+H   L
Sbjct: 62  MKIIDSDF--VAGNLISSASIDS-VKVFDIRSNDCVAKINN-ETNSPFLSLD-SRHG--L 114

Query: 304 MAAA----GTDSLVYLYDSRNLSVPLYSM-NGHEDSITNLEFSPHTDGVLISSGNDRRVI 358
           +A      G D+ +++YD R    PL S+ + H D +T ++F P    VL+S   D    
Sbjct: 115 LACGTELQGIDAAIHIYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTN 174

Query: 359 MWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSA 391
           ++D+         DD ED   +VI   + H   
Sbjct: 175 IYDLKQ-------DDEEDALHQVINYASIHSCG 200

>CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON}
           similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003c CDH1 substrate-specific activator of
           APC-dependent proteolysis
          Length = 640

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 77/155 (49%), Gaps = 14/155 (9%)

Query: 212 LLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQ 271
           L  G  +G + ++D+ +   +         S H D V    WN   +++ +S S D T+ 
Sbjct: 391 LAIGQGNGIVEIYDVTKEKCIRTL------SGHLDRVACLSWN---NHILSSGSRDRTIL 441

Query: 272 LHDQREQNTIINSIKTTDP-FNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNG 330
             D R  +     I+T +     L ++ +   L A+ G D++V++YD  + + P  S+N 
Sbjct: 442 HRDVRMADPFFEKIETHEQEICGLKWNTNDNKL-ASGGNDNMVFVYDGTSRT-PFLSINE 499

Query: 331 HEDSITNLEFSPHTDGVLISSGN--DRRVIMWDIN 363
           H+ ++  + +SPH  G+L + G   DR + MW++N
Sbjct: 500 HKAAVKAMAWSPHKQGILATGGGTADRTLKMWNVN 534

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 89/179 (49%), Gaps = 17/179 (9%)

Query: 198 NGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHND--IVNDCKWNE 255
           N + L F P     LL+   +G I++ D + N    K  +KI ++  ND  IVN    N 
Sbjct: 14  NNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQI--KDKIKIGETSINDFEIVN----NN 67

Query: 256 FNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGT-----D 310
           +N       + + +++++D +  N  I +I  T+  N+   S  S + M A GT     D
Sbjct: 68  YNGGSLMVTATNESVKIYDLK-SNDCIKTI--TNEKNSPFLSLDSLHNMMACGTELSGVD 124

Query: 311 SLVYLYDSRNLSVPLYS-MNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAE 368
           + +Y+YD R+   P+ S ++ H D IT+++F P+   VL+S   D    ++D+ +   E
Sbjct: 125 AELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEE 183

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 91/229 (39%), Gaps = 57/229 (24%)

Query: 195 HKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI----VND 250
           H ++   + F+PND   L+SGS DG   ++D+ E            DS+H  I    ++ 
Sbjct: 146 HHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEE--------DSLHQVINYSSIHS 197

Query: 251 CKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTD 310
           C W   +S    ++S   T  +H   +++ ++   K       + F      +    G +
Sbjct: 198 CGW--LSSRRIFTLSHMETFAIHQLNDKSEVLKEPK------PIEFGD----IRNDWGCN 245

Query: 311 SLVYLYDSRNLSVPLYSMNGH-EDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQ 369
            ++ +Y       P Y   G  E+S   L+ SP          N+ ++            
Sbjct: 246 YVIDVY-------PGYIATGKTEESKGQLKISPF---------NNEKI------------ 277

Query: 370 IPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
             D AED    +I+  A     + D  INPN P  M S  E+  +++WK
Sbjct: 278 --DLAEDN--NIIIPQAHGDEVIRDVFINPNDPSNMYSCGEDGNVKLWK 322

>KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa]
           {ON} Anc_4.122 YGL003C
          Length = 568

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 75/341 (21%), Positives = 140/341 (41%), Gaps = 97/341 (28%)

Query: 78  STPVSNRQELILGTHTSGEEDNYLKIAAIDLPDEVVQPSTNSLKAQRXXXXXXXXQKQKP 137
           S+PV+ ++   +GT++S               DE+ +PS+NS++           +K +P
Sbjct: 167 SSPVTPKRLFTIGTNSSNT-------------DELYRPSSNSMRGVSLLTYRSSPKKTRP 213

Query: 138 RSNIKIVKKF-------------------KHEEEITRARFMP-----------------Q 161
            +   +  +F                   K   +I +  +                    
Sbjct: 214 STTTLLNSQFFDSISSMRPESKQLLLSPKKTYRKIAKIPYRVLDAPSLADDFYYDLIDWS 273

Query: 162 NTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLS-GSDDGT 220
           +TD++A   G  ++F+ N SN +   L  T     EN Y  S N    G  L+ G  +G 
Sbjct: 274 STDLLAVALGK-SIFLTNNSNGEVIHLCDT-----ENEY-TSLNWVGSGSHLAVGQSNGI 326

Query: 221 IALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNT 280
           + ++D+ +     KK ++     H+D V    WN +   +  S S          R+ N 
Sbjct: 327 VEIFDVNK-----KKCIRTMLG-HSDRVACLSWNSY---ILTSGS----------RDHNI 367

Query: 281 IINSIKTTDPFNTLAFSK---HSQYL-----------MAAAGTDSLVYLYDSRNLSVPLY 326
           +   +++ DPF    F K   HSQ +           + + G D++V +YD R  + P  
Sbjct: 368 LHRDVRSPDPF----FEKIESHSQEVCGLKWNVDENKLVSGGNDNIVNVYD-RTSTKPFM 422

Query: 327 SMNGHEDSITNLEFSPHTDGVLISSGN--DRRVIMWDINDI 365
           +M  H+ ++  L++S H  G+L + G   DR + +W++N++
Sbjct: 423 TMTEHKAAVKALDWSSHKRGILATGGGTADRHLKIWNVNNM 463

>ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {ON}
           similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 560

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 77/157 (49%), Gaps = 18/157 (11%)

Query: 212 LLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQ 271
           L  G  +G + ++D+     + KK ++   S H D V    WN +   V  S S D  + 
Sbjct: 311 LAVGQGNGLVEIYDV-----VKKKCIRTL-SGHMDRVACLSWNNY---VLTSGSRDRRIL 361

Query: 272 LHDQREQNTIINSIKT-TDPFNTLAFSKHSQYLMAAAGTDSLVYLYDS--RNLSVPLYSM 328
             D R  ++    I+  T     L ++     L A+ G D+++++YDS  RN   P+ + 
Sbjct: 362 HRDVRIPDSYFERIEAHTQEVCGLKWNVDDNKL-ASGGNDNMLFVYDSTARN---PVLTF 417

Query: 329 NGHEDSITNLEFSPHTDGVLISSGN--DRRVIMWDIN 363
           N H  ++  + +SPH  GVL S G   DRR+ +W++N
Sbjct: 418 NEHTAAVKAMAWSPHKRGVLGSGGGTADRRLKVWNVN 454

>TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.122
           YGL003C
          Length = 556

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 76/155 (49%), Gaps = 14/155 (9%)

Query: 212 LLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQ 271
           L  G  +G + ++D+     + +K ++   S H D V    WN   +++  S S D  + 
Sbjct: 307 LAIGQANGLVEIYDV-----VKRKCIRTL-SGHKDRVACLSWN---NHILTSGSRDRRIL 357

Query: 272 LHDQREQNTIINSIKT-TDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNG 330
             D R  ++    I+T +     L ++  S  L A+ G D++VY+YD  + S P+     
Sbjct: 358 HRDVRVPDSFFERIETHSQEVCGLKWNPESNKL-ASGGNDNMVYVYDGTSRS-PVLKFEE 415

Query: 331 HEDSITNLEFSPHTDGVLISSGN--DRRVIMWDIN 363
           H  ++  L +SPH  G+L S G   DR++  W++N
Sbjct: 416 HTAAVKALAWSPHKRGILASGGGTADRKLKTWNVN 450

>KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 477

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/240 (22%), Positives = 95/240 (39%), Gaps = 58/240 (24%)

Query: 166 IATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNP------NDKGKLLSGSDDG 219
           +A+ +  G V  +N S  ++   I + + H    +GL   P       ++  +LS  DD 
Sbjct: 83  LASASADGVVKYWNMSTREE---ICSFKAHYGLVHGLCVTPQHLSANKNENYMLSCGDDK 139

Query: 220 TIALWDI------------QENST--------------------------LAKKPLKIWD 241
           T+ LW +            +++ST                           A   + +WD
Sbjct: 140 TVKLWSVNTEDFSSSKNDEEQSSTDGLIKTFHGDYAFLGIDHHRSKPYFVTAGAEINLWD 199

Query: 242 SVHN----------DIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPF 291
           S  +          D V+  K+N+  +++FAS   D+++ L+D R  N+           
Sbjct: 200 SSRSRPTANLSWGADNVSTVKFNQNETDIFASAGSDNSVVLYDLR-TNSPTQKFTQRMRT 258

Query: 292 NTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISS 351
           N L ++    Y    A  D   Y YD RNLS  L+    H  ++ +++FSP  D ++  S
Sbjct: 259 NALCWNPMEAYNFVVASEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTGDEIVTGS 318

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 81/182 (44%), Gaps = 18/182 (9%)

Query: 195 HKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWN 254
           H++  Y ++ N +   KL S S DG +  W++     +       +  VH   V     +
Sbjct: 66  HRDGVYTIAKNYHALNKLASASADGVVKYWNMSTREEICSFKAH-YGLVHGLCVTPQHLS 124

Query: 255 E-FNSNVFASVSEDSTLQL-----------HDQREQNTIINSIKTTDP-FNTLAFSKH-S 300
              N N   S  +D T++L            +  EQ++    IKT    +  L    H S
Sbjct: 125 ANKNENYMLSCGDDKTVKLWSVNTEDFSSSKNDEEQSSTDGLIKTFHGDYAFLGIDHHRS 184

Query: 301 QYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMW 360
           +     AG +  + L+DS + S P  +++   D+++ ++F+ +   +  S+G+D  V+++
Sbjct: 185 KPYFVTAGAE--INLWDS-SRSRPTANLSWGADNVSTVKFNQNETDIFASAGSDNSVVLY 241

Query: 361 DI 362
           D+
Sbjct: 242 DL 243

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 84/183 (45%), Gaps = 25/183 (13%)

Query: 202 LSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVF 261
             +N  D   ++S S D T  +WD+Q +  +  + +      H+  V D ++   ++ +F
Sbjct: 249 FDWNTVDTNLIISSSIDTTCIVWDLQSSHYVKTQLI-----AHDSEVFDVRFLTKSTQLF 303

Query: 262 ASVSEDSTLQLHDQRE--QNTIIN-----------------SIKTTDPFNTLAFSKHSQY 302
           AS   D ++++ D R    +TII                  S+K +D    L  S +   
Sbjct: 304 ASCGGDGSVRVFDLRSLAHSTIIYEPPSSPASGPNAGATTPSLKGSDALLRLEPSPYDPN 363

Query: 303 LMAAAGTDS-LVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWD 361
           ++A    DS  + + D RN   P+ ++ GH  S+  +++ P    VL+S  +D + + WD
Sbjct: 364 VLATFAADSNKIIILDMRNPESPILNLEGHTCSVNEIKWHPTKRNVLLSCSDDCQALYWD 423

Query: 362 IND 364
           +N+
Sbjct: 424 LNN 426

 Score = 30.4 bits (67), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 54/137 (39%), Gaps = 22/137 (16%)

Query: 149 HEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPND 208
           H+ E+   RF+ ++T + A+  G G+V ++    D +S   ST+ +   +      N   
Sbjct: 286 HDSEVFDVRFLTKSTQLFASCGGDGSVRVF----DLRSLAHSTIIYEPPSSPASGPNAGA 341

Query: 209 KGKLLSGS-----------DDGTIALWDIQENSTL------AKKPLKIWDSVHNDIVNDC 251
               L GS           D   +A +    N  +       + P+   +  H   VN+ 
Sbjct: 342 TTPSLKGSDALLRLEPSPYDPNVLATFAADSNKIIILDMRNPESPILNLEG-HTCSVNEI 400

Query: 252 KWNEFNSNVFASVSEDS 268
           KW+    NV  S S+D 
Sbjct: 401 KWHPTKRNVLLSCSDDC 417

>Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON}
           (100720..102258) [1539 nt, 513 aa]
          Length = 512

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 68/300 (22%), Positives = 120/300 (40%), Gaps = 73/300 (24%)

Query: 164 DIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSF------NPNDKGKLLSGSD 217
           ++IAT +   TV ++     K       LR H +    LS+       P ++ +L + S 
Sbjct: 196 ELIATGSMDNTVRLWESKTGKPFG--DALRGHGKWITSLSWEPIHLVTPGERPRLATSSK 253

Query: 218 DGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQRE 277
           DGTI +WD        ++   +  S H   V+  KW     N   S S D T+++ D + 
Sbjct: 254 DGTIKIWDT------TRRVCTMTLSGHTSSVSCVKWG--GQNFLYSGSHDKTVRVWDMKN 305

Query: 278 QNTIINSIK-----------TTD------PFNTLA----------------FSKHSQY-- 302
               IN +K           +TD      PF+                   + K ++   
Sbjct: 306 SGRCINILKNHAHWVNHLSLSTDYALRVGPFDYTGEQPATPEIAKAKALKNYEKVAKRNG 365

Query: 303 ----LMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGV-LISSGNDRRV 357
               LM  A  D  ++L+D    + P+  M GH+  + ++ FSP  DG  ++S+  D  +
Sbjct: 366 KETELMVTASDDFTMFLWDPLRTTKPIARMTGHQKLVNHVAFSP--DGRHIVSASFDNSI 423

Query: 358 IMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
            +W            D+ DG  + I    GH ++V   + + +   L+ S  ++  ++VW
Sbjct: 424 KLW------------DSRDG--KFITTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 468

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 75/152 (49%), Gaps = 15/152 (9%)

Query: 212 LLSGSDDGTIALWD-IQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTL 270
           +++ SDD T+ LWD ++    +A+       + H  +VN   ++    ++  S S D+++
Sbjct: 371 MVTASDDFTMFLWDPLRTTKPIARM------TGHQKLVNHVAFSPDGRHI-VSASFDNSI 423

Query: 271 QLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSL-VYLYDSRNLSVPLYSMN 329
           +L D R+   I            +A+S   + L++ +   +L V+   +R LSV L    
Sbjct: 424 KLWDSRDGKFITTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDIRTRKLSVDL---P 480

Query: 330 GHEDSITNLEFSPHTDGVLISSGN-DRRVIMW 360
           GH+D +  +++S   DG  + SG  D+ V +W
Sbjct: 481 GHKDEVYTVDWS--VDGKRVCSGGKDKMVRIW 510

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 44/221 (19%), Positives = 89/221 (40%), Gaps = 43/221 (19%)

Query: 164 DIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIAL 223
           DII  +     VF         SA+      H       +F P+   ++++G+ D T  +
Sbjct: 112 DIITLVFTPRAVFKVKPVTRSSSAIAG----HGSTILCSAFAPHTSSRMVTGAGDNTARI 167

Query: 224 WDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIIN 283
           WD    + +A        + H++ V    W+  +  + A+ S D+T++L +         
Sbjct: 168 WDCDTQTPMATL------TGHHNWVLCVSWSP-DGELIATGSMDNTVRLWES-------- 212

Query: 284 SIKTTDPFNTLAFSKHSQYL------------------MAAAGTDSLVYLYDSRNLSVPL 325
             KT  PF   A   H +++                  +A +  D  + ++D+    V  
Sbjct: 213 --KTGKPFGD-ALRGHGKWITSLSWEPIHLVTPGERPRLATSSKDGTIKIWDTTR-RVCT 268

Query: 326 YSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIG 366
            +++GH  S++ +++       L S  +D+ V +WD+ + G
Sbjct: 269 MTLSGHTSSVSCVKWGGQN--FLYSGSHDKTVRVWDMKNSG 307

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 34/170 (20%), Positives = 65/170 (38%), Gaps = 29/170 (17%)

Query: 256 FNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYL 315
           F++NV    S D ++ + D      +     TT+   TL F+  + + +      S    
Sbjct: 78  FSANVTTKDSADKSVDIIDNLYSTLLKPGYNTTEDIITLVFTPRAVFKVKPVTRSS---- 133

Query: 316 YDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAE 375
                      ++ GH  +I    F+PHT   +++   D    +WD +     Q P    
Sbjct: 134 ----------SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCD----TQTP---- 175

Query: 376 DGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPI 425
                 +    GH + V   S +P+   L+A+   +N +++W+     P 
Sbjct: 176 ------MATLTGHHNWVLCVSWSPDGE-LIATGSMDNTVRLWESKTGKPF 218

>NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 95/210 (45%), Gaps = 21/210 (10%)

Query: 164 DIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIAL 223
           DII  I     VF         SA+      H       +F PN   ++++G+ D T  +
Sbjct: 115 DIITLIYTPRAVFKVKPVTRSSSAIAG----HGSTILCSAFAPNTSSRMVTGAGDNTARI 170

Query: 224 WDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIIN 283
           WD    +     P        N ++  C     N  V A+ S D+T++L D ++   + +
Sbjct: 171 WDCDTQT-----PKATLTGHFNWVL--CVSYCPNGEVIATGSMDNTIRLWDSKDGKPLGD 223

Query: 284 SIK------TTDPFNTLAFSKHSQY-LMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSIT 336
           +++      T+  +  +   K  +   +A+A  D  + ++D     V LY+M+GH +S++
Sbjct: 224 ALRGHLKWITSLAWEPIHLVKPGESPRLASASKDGTIRIWDITR-RVCLYTMSGHTNSVS 282

Query: 337 NLEFSPHTDGVLISSGNDRRVIMWDINDIG 366
            +++S    G++ S  +D+ V +WD+N  G
Sbjct: 283 CIKWSGQ--GIIYSGSHDKTVRVWDMNADG 310

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 69/315 (21%), Positives = 123/315 (39%), Gaps = 74/315 (23%)

Query: 149 HEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSF---- 204
           H   +    + P N ++IAT +   T+ +++  + K   L   LR H +    L++    
Sbjct: 185 HFNWVLCVSYCP-NGEVIATGSMDNTIRLWDSKDGK--PLGDALRGHLKWITSLAWEPIH 241

Query: 205 --NPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFA 262
              P +  +L S S DGTI +WDI     L         S H + V+  KW+     +  
Sbjct: 242 LVKPGESPRLASASKDGTIRIWDITRRVCLYTM------SGHTNSVSCIKWS--GQGIIY 293

Query: 263 SVSEDSTLQLHDQREQNTIINSIK-----------TTDPFNTLAFSKHS----------- 300
           S S D T+++ D       IN +K           +TD    +    H+           
Sbjct: 294 SGSHDKTVRVWDMNADGKCINILKSHAHWVNHLSLSTDYALRVGAFDHTGAQPASAKDAR 353

Query: 301 -----------------QYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPH 343
                            + LM  A  D  ++L++    + P+  M GH+  + ++ FSP 
Sbjct: 354 DKALANYEKVVKKNGKLEELMVTASDDFTMFLWNPLKSNKPIARMTGHQKLVNHVAFSP- 412

Query: 344 TDG-VLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIP 402
            DG  ++S+  D  + +W            D  DG  + I    GH ++V   + + +  
Sbjct: 413 -DGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVAWSADCR 457

Query: 403 WLMASAEEENIIQVW 417
            L+ S  ++  ++VW
Sbjct: 458 -LLVSCSKDTTLKVW 471

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 58/252 (23%), Positives = 101/252 (40%), Gaps = 62/252 (24%)

Query: 159 MPQNTDIIATINGSGTVFIYNQSNDKQ---------SALISTLRFHKE--------NGYG 201
           M  +T+ ++ I  SG   IY+ S+DK             I+ L+ H            Y 
Sbjct: 274 MSGHTNSVSCIKWSGQGIIYSGSHDKTVRVWDMNADGKCINILKSHAHWVNHLSLSTDYA 333

Query: 202 LSFNPNDK--------------------------GKL----LSGSDDGTIALWD-IQENS 230
           L     D                           GKL    ++ SDD T+ LW+ ++ N 
Sbjct: 334 LRVGAFDHTGAQPASAKDARDKALANYEKVVKKNGKLEELMVTASDDFTMFLWNPLKSNK 393

Query: 231 TLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDP 290
            +A+       + H  +VN   ++  +     S S D++++L D R+   I         
Sbjct: 394 PIARM------TGHQKLVNHVAFSP-DGRYIVSASFDNSIKLWDGRDGKFISTFRGHVAS 446

Query: 291 FNTLAFSKHSQYLMAAAGTDSL-VYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLI 349
              +A+S   + L++ +   +L V+   +R LSV L    GH+D +  +++S   DG  +
Sbjct: 447 VYQVAWSADCRLLVSCSKDTTLKVWDVRTRKLSVDL---PGHKDEVYTVDWS--VDGKRV 501

Query: 350 SSGN-DRRVIMW 360
            SG  D+ V +W
Sbjct: 502 CSGGKDKMVRIW 513

>TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {ON}
           Anc_2.469 YMR093W
          Length = 509

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/219 (29%), Positives = 102/219 (46%), Gaps = 18/219 (8%)

Query: 148 KHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPN 207
           K    +T   F PQ+T   A +  S  V I++ S  +Q  ++ T    K+  Y  SF  N
Sbjct: 37  KEHNSVTHIAFNPQHTHDFA-VTSSTRVQIFS-SRTRQ--VVKTFSRFKDVVYSASFR-N 91

Query: 208 DKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSED 267
           D   L++G   G ++++D     TL    L I  S H   V+  K++  +S    + S+D
Sbjct: 92  DGKLLVAGDATGLVSVFDSYNPRTLL---LSINVSTHP--VHVTKFHSQDSKTLVTASDD 146

Query: 268 STLQLHD-QREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNL-SVPL 325
              +L D        +     +D   TL F   + +L+A    D +V LYD+RN  S P+
Sbjct: 147 RVTRLWDISYAYEPSLELTGASDYVRTLTFIPSAPHLVATGSYDGIVRLYDTRNSGSEPV 206

Query: 326 YSMNGHEDSITN-LEFSPHTDGVLISSGNDRRVIMWDIN 363
           +S+N HE  + N L  SP     LIS+G +    +WD+ 
Sbjct: 207 FSLN-HEQPLENILAISPTQ---LISAGGN-NFKVWDLT 240

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 75/174 (43%), Gaps = 16/174 (9%)

Query: 244 HNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYL 303
           HN + +   +N  +++ FA V+  + +Q+   R +  +    +  D   + +F    + L
Sbjct: 39  HNSVTH-IAFNPQHTHDFA-VTSSTRVQIFSSRTRQVVKTFSRFKDVVYSASFRNDGKLL 96

Query: 304 MAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN 363
           +A   T  LV ++DS N    L S+N     +   +F       L+++ +DR   +WDI+
Sbjct: 97  VAGDAT-GLVSVFDSYNPRTLLLSINVSTHPVHVTKFHSQDSKTLVTASDDRVTRLWDIS 155

Query: 364 DIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
                         A E  +   G    V   +  P+ P L+A+   + I++++
Sbjct: 156 -------------YAYEPSLELTGASDYVRTLTFIPSAPHLVATGSYDGIVRLY 196

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 46/110 (41%), Gaps = 3/110 (2%)

Query: 264 VSEDST--LQLHDQREQNTIINSIK-TTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRN 320
           V+ D+T  + + D     T++ SI  +T P +   F       +  A  D +  L+D   
Sbjct: 97  VAGDATGLVSVFDSYNPRTLLLSINVSTHPVHVTKFHSQDSKTLVTASDDRVTRLWDISY 156

Query: 321 LSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQI 370
              P   + G  D +  L F P    ++ +   D  V ++D  + G+E +
Sbjct: 157 AYEPSLELTGASDYVRTLTFIPSAPHLVATGSYDGIVRLYDTRNSGSEPV 206

>TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {ON}
           Anc_8.672 YPL151C
          Length = 414

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 59/211 (27%), Positives = 98/211 (46%), Gaps = 38/211 (18%)

Query: 214 SGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLH 273
           +GS D TI +WD++         LKI  S H   V D   ++ +  +F S SED  ++  
Sbjct: 120 TGSSDTTIKIWDLESGK------LKITLSGHVMPVRDIAISKRSPYLF-SASEDKLIKCW 172

Query: 274 DQ------REQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYS 327
           D       RE    ++ + T D   TL        L+A AG DS + L+D R+ +  + +
Sbjct: 173 DLEKNMAIREYFGHLSGVNTVDVHPTLD-------LIATAGRDSTIRLWDIRSRTA-VMT 224

Query: 328 MNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAG 387
           + GH+  +T ++  P  D  ++S+ ND  V +WDI               A + I     
Sbjct: 225 LIGHKAPVTTVKCIP-VDPQVVSASNDATVKLWDI--------------VAGKAIKTLTH 269

Query: 388 HRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
           H+  V D ++NP   + +ASA  ++ I+ W+
Sbjct: 270 HKRTVRDIAVNPT-EFSIASACTDD-IRSWR 298

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 70/158 (44%), Gaps = 20/158 (12%)

Query: 261 FASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYD-SR 319
           FA+ S D+T+++ D       I       P   +A SK S YL +A+  D L+  +D  +
Sbjct: 118 FATGSSDTTIKIWDLESGKLKITLSGHVMPVRDIAISKRSPYLFSAS-EDKLIKCWDLEK 176

Query: 320 NLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAP 379
           N+++  Y   GH   +  ++  P  D ++ ++G D  + +WDI    A            
Sbjct: 177 NMAIREYF--GHLSGVNTVDVHPTLD-LIATAGRDSTIRLWDIRSRTA------------ 221

Query: 380 EVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
             +M   GH++ V      P  P  + SA  +  +++W
Sbjct: 222 --VMTLIGHKAPVTTVKCIPVDP-QVVSASNDATVKLW 256

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 99/236 (41%), Gaps = 38/236 (16%)

Query: 140 NIKIVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENG 199
           N+ I + F H   +      P   D+IAT     T+ +++    +    + TL  HK   
Sbjct: 177 NMAIREYFGHLSGVNTVDVHP-TLDLIATAGRDSTIRLWDI---RSRTAVMTLIGHKAPV 232

Query: 200 YGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSN 259
             +   P D  +++S S+D T+ LWDI     +A K +K   + H   V D   N    +
Sbjct: 233 TTVKCIPVDP-QVVSASNDATVKLWDI-----VAGKAIKTL-THHKRTVRDIAVNPTEFS 285

Query: 260 VFASVSED--------STLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDS 311
           + ++ ++D         +L  + + +   I+NSI           S +   +MAA G + 
Sbjct: 286 IASACTDDIRSWRLPEGSLLTNFESDTLGIVNSI-----------SINQDNIMAACGDNG 334

Query: 312 LVYLYDSRN----LSVPLYSMNG---HEDSITNLEFSPHTDGVLISSGNDRRVIMW 360
           ++  +D ++      +   +M+G    E  I +  F   T  + I+   D+ + MW
Sbjct: 335 VLSFFDYKSGHKYQKIATTAMSGSLESEKGILSGTFDA-TGQIFITGETDKSIKMW 389

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 96/204 (47%), Gaps = 25/204 (12%)

Query: 187 ALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHND 246
           +L+ +  F  EN + L   P+ K  LL+G  +G I L D     +L K  +K  ++  ND
Sbjct: 5   SLVESNSFGSEN-WCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQK--IKASETSIND 61

Query: 247 I-VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSI--KTTDPFNTLAFSKHSQYL 303
           + V D   ++F +    S +    +++ D R  N  +  I  +   PF +L  S+H   L
Sbjct: 62  LKVID---SDFAAGHLVSSASIDAVKVFDIR-TNACVAKIHNEANSPFISLD-SRHG--L 114

Query: 304 MAAA----GTDSLVYLYDSRNLSVPLYS-MNGHEDSITNLEFSPHTDGVLISSGNDRRVI 358
           +A      G D+ VY+YD R    PL S ++ H D +T ++F P    VL+S   D    
Sbjct: 115 LACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTN 174

Query: 359 MWDINDIGAEQIPDDAEDGAPEVI 382
           ++D+         D+ ED   +VI
Sbjct: 175 IYDLKQ-------DEEEDALHQVI 191

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 49/106 (46%), Gaps = 15/106 (14%)

Query: 173 GTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTL 232
             V+IY+      + L S +  H ++   + F+P+D   LLSGS DG   ++D++++   
Sbjct: 126 AAVYIYDIRR-WDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEE 184

Query: 233 AKKPLKIWDSVHNDI----VNDCKWNEFNSNVFASVSEDSTLQLHD 274
                   D++H  I    ++ C W   +     ++S   T  +H+
Sbjct: 185 --------DALHQVINYASIHSCGW--LSQKRIYTLSHMETFAIHE 220

>KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.340
           YCR072C
          Length = 515

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 71/300 (23%), Positives = 118/300 (39%), Gaps = 73/300 (24%)

Query: 164 DIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNP------NDKGKLLSGSD 217
           +IIAT +   T+ ++   +D+   L   LR H +    LS+ P       +K +L S S 
Sbjct: 199 EIIATGSMDNTIRLWE--SDRGKPLGEPLRGHLKWITSLSWEPLHLVKAGEKPRLASASK 256

Query: 218 DGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQRE 277
           DGTI +WD      +         S H + V+  KW      V  S S D T+++ D   
Sbjct: 257 DGTIKIWDTVRRVCVYTL------SGHTNSVSCVKWG--GQGVLYSGSHDKTVRVWDMNL 308

Query: 278 QNTIINSIK-----------TTD------PFNTLAFSKHS-------------------- 300
               IN +K           +TD      PF+       S                    
Sbjct: 309 GGKCINILKNHAHWVNHLSLSTDYALRRGPFDHTGTKMASPEEAREKALKNYEKVVKKNG 368

Query: 301 --QYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDG-VLISSGNDRRV 357
             + LM  A  D  ++L++    + PL  M GH+  + ++ FSP  DG  ++S+  D  +
Sbjct: 369 TTEELMVTASDDFTMFLWNPLKSNKPLARMTGHQKLVNHVAFSP--DGRYIVSASFDNSI 426

Query: 358 IMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
            +W            D  DG  + +    GH S+V   + + +   L+ S  ++  ++VW
Sbjct: 427 KLW------------DGRDG--KFLSTFRGHVSSVYQVAWSSDCR-LLVSCSKDTTLKVW 471

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/214 (21%), Positives = 96/214 (44%), Gaps = 22/214 (10%)

Query: 164 DIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIAL 223
           DII  +     VF         SA+      H       +F P+   ++++G+ D T  +
Sbjct: 115 DIITLVYTPRAVFKVKPVTRSSSAIAG----HGSTILCSAFAPHTSSRMVTGAGDNTARI 170

Query: 224 WDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIIN 283
           WD    + +         + H + V    W+  +  + A+ S D+T++L +      +  
Sbjct: 171 WDCDTQTPMTTL------TGHQNWVLCVSWSP-DGEIIATGSMDNTIRLWESDRGKPLGE 223

Query: 284 SIK------TTDPFNTLAFSKHSQY-LMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSIT 336
            ++      T+  +  L   K  +   +A+A  D  + ++D+    V +Y+++GH +S++
Sbjct: 224 PLRGHLKWITSLSWEPLHLVKAGEKPRLASASKDGTIKIWDTVR-RVCVYTLSGHTNSVS 282

Query: 337 NLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQI 370
            +++     GVL S  +D+ V +WD+N +G + I
Sbjct: 283 CVKWG--GQGVLYSGSHDKTVRVWDMN-LGGKCI 313

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 44/99 (44%), Gaps = 15/99 (15%)

Query: 327 SMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHA 386
           ++ GH  +I    F+PHT   +++   D    +WD +     Q P          +    
Sbjct: 138 AIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCD----TQTP----------MTTLT 183

Query: 387 GHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPI 425
           GH++ V   S +P+   ++A+   +N I++W+     P+
Sbjct: 184 GHQNWVLCVSWSPDGE-IIATGSMDNTIRLWESDRGKPL 221

>NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 104/239 (43%), Gaps = 24/239 (10%)

Query: 188 LISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI 247
           L  TL  H      L+ +      LLSGS D T+  W +  +      P++ +   H+ I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKG-HSHI 67

Query: 248 VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAA 307
           V DC   +  +    S S D TL+L D     T    +       ++A  + +  +++ +
Sbjct: 68  VQDCTLTQDGAYAL-SASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGS 126

Query: 308 GTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSP---HTDGV-LISSGNDRRVIMWDIN 363
             D  + ++  +     L ++ GH D ++ +  +P   + D V +IS+GND+ V  W++N
Sbjct: 127 -RDKTIKVWTIKGQC--LATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLN 183

Query: 364 DIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHK 422
                QI  D             GH   VN  + +P+   L+ASA ++  I +W  + K
Sbjct: 184 QF---QIEAD-----------FVGHNGNVNAVTASPDGT-LIASAGKDGEIMLWNLAEK 227

>Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011W
           (SOF1) - 56 kDa nucleolar snRNP protein that shows
           homology to beta subunits of G-proteins and the splicing
           factor Prp4 [contig 94] FULL
          Length = 473

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 83/170 (48%), Gaps = 21/170 (12%)

Query: 187 ALISTLRFHKENGY-GLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKI-WDSVH 244
            LI T  FH E+ + G+  + ++   +  G++   I LWD    ST ++    + W +  
Sbjct: 166 GLIKT--FHGEHAFLGIDHHRSNSNFVTGGAE---INLWD----STRSRPITNLSWGA-- 214

Query: 245 NDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQN---TIINSIKTTDPFNTLAFSKHSQ 301
            D V+  K+N+  +++FAS   D+++ L+D R  +     +  ++T    N L ++    
Sbjct: 215 -DNVSTVKFNQNETDIFASAGSDNSVVLYDLRTNSPTQKFVQKMRT----NALCWNPMEA 269

Query: 302 YLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISS 351
           Y    A  D   Y YD RNLS  L+    H  ++ +++FSP  D ++  S
Sbjct: 270 YNFVVANEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTGDEIVTGS 319

>NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 104/239 (43%), Gaps = 24/239 (10%)

Query: 188 LISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI 247
           L  TL  H      L+ +      LLSGS D T+  W +  +      P++ +   H+ I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKG-HSHI 67

Query: 248 VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAA 307
           V DC   +  +    S S D TL+L D     T    +       ++A  + +  +++ +
Sbjct: 68  VQDCTLTQDGAYAL-SASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGS 126

Query: 308 GTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSP---HTDGV-LISSGNDRRVIMWDIN 363
             D  + ++  +     L ++ GH D ++ +  +P   + D V +IS+GND+ V  W++N
Sbjct: 127 -RDKTIKVWTIKGQC--LATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLN 183

Query: 364 DIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHK 422
                QI  D             GH   VN  + +P+   L+ASA ++  I +W  + K
Sbjct: 184 QF---QIEAD-----------FVGHNGNVNTVTASPDGT-LIASAGKDGEIMLWNLAEK 227

>TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.316
           YDR142C
          Length = 378

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 66/298 (22%), Positives = 122/298 (40%), Gaps = 49/298 (16%)

Query: 171 GSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWD-IQEN 229
           G G++ +++ +   Q   I   + HK+     ++N   KG  +S S DG + +W  ++E 
Sbjct: 82  GDGSLRLFDTT--LQKYPIGIFKEHKKEVLSCNWNLITKGTFVSSSWDGAVKMWSPLREQ 139

Query: 230 STLAKKP--------------LKIWDSVHN----------DIVNDCKWNEFNSNVFASVS 265
           S L   P               KI   V+N          D V   +++  ++N+ A  S
Sbjct: 140 SLLTLLPKSSEQSSKINHNQIAKIPPHVNNNQSTPILQNKDCVYQAQFSPHDNNLIACCS 199

Query: 266 EDSTLQLHDQREQNTII--NSIKTTDPFNTLA--FSKHSQYLMAAAGTDSLVYLYDSR-- 319
            +S + L D REQN     NS        TL   F+K+   ++A++G D+ + ++D R  
Sbjct: 200 GNSYITLFDTREQNNRFNNNSFIAHSGLETLTLDFNKYRPTVLASSGADNSIKIWDMRMI 259

Query: 320 ------NLSVPL---YSMN----GHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIG 366
                 N  +P      MN     H+ ++  + +SPH   +L+S+  D    +W      
Sbjct: 260 RNNNSNNTVMPTSNPICMNEIRKAHDLAVRRVVWSPHQSNLLLSTSYDMTSKVWKDFSFD 319

Query: 367 AEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNI---PWLMASAEEENIIQVWKCSH 421
             +I        P   +I   H      F  + ++   P  +A+   ++ + +W C +
Sbjct: 320 GSKITGKTNSIDPGSGLIKTFHHHTEFVFGADWSLWGQPGFIATTGWDSKVYIWNCFY 377

>Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR198C
           (TAF5) - Probable transcription-associated factor
           protein, probable -transducin type [contig 24] FULL
          Length = 755

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 95/236 (40%), Gaps = 25/236 (10%)

Query: 189 ISTLRFHKENGYGLSFNPNDKGKLLS-GSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI 247
           +    FH  N    S   +D  +L + G  D  I +W +       K P K  +  +N+ 
Sbjct: 418 VCMYTFHNTNSEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNET 477

Query: 248 VNDCKWNEFNSNV------FASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQ 301
           +       ++++         S SED T++L       +++N      P   +AFS    
Sbjct: 478 LVGHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGH 537

Query: 302 YLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWD 361
           Y  A A  D    L+   ++  PL    GH + +  + F P+   V   S +D+   MWD
Sbjct: 538 YF-ATASHDQTARLWSCDHI-YPLRIFAGHLNDVDTVSFHPNGTYVFTGS-SDKTCRMWD 594

Query: 362 INDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
           I               + + + +  GH + V   +++P+  WL ++  E+ +I VW
Sbjct: 595 IT--------------SGDSVRLFLGHTAPVTSTAVSPDGRWL-STGSEDGVINVW 635

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 89/215 (41%), Gaps = 42/215 (19%)

Query: 191 TLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTL-------------AKKPL 237
           TL  H    Y  SF+P+++  LLS S+D T+ LW     ++L             A  PL
Sbjct: 477 TLVGHSGTVYSTSFSPDNR-YLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPL 535

Query: 238 -------------KIWDSVH-------NDIVNDCKWNEFNSN---VFASVSEDSTLQLHD 274
                        ++W   H          +ND     F+ N   VF   S D T ++ D
Sbjct: 536 GHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTG-SSDKTCRMWD 594

Query: 275 QREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGH-ED 333
               +++   +  T P  + A S   ++L +    D ++ ++D       L  M GH ++
Sbjct: 595 ITSGDSVRLFLGHTAPVTSTAVSPDGRWL-STGSEDGVINVWDI-GTGKRLKQMRGHGKN 652

Query: 334 SITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAE 368
           ++ +L +S     VLIS G D  V +WD+    AE
Sbjct: 653 AVYSLSYSKEGH-VLISGGADHSVRVWDVKKSTAE 686

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 20/99 (20%), Positives = 44/99 (44%), Gaps = 16/99 (16%)

Query: 327 SMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHA 386
           ++ GH  ++ +  FSP  +  L+S+  D+ V +W  +   +              ++ + 
Sbjct: 477 TLVGHSGTVYSTSFSPD-NRYLLSASEDKTVRLWSTDTYTS--------------LVNYK 521

Query: 387 GHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPI 425
           GH   + D + +P +    A+A  +   ++W C H  P+
Sbjct: 522 GHNHPIWDVAFSP-LGHYFATASHDQTARLWSCDHIYPL 559

>KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 367

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 111/248 (44%), Gaps = 35/248 (14%)

Query: 171 GSGTVFIYNQSNDKQSALISTLRFHKENG-YGLSFNPNDKGKLLSGSDDGTIALWDIQEN 229
           G+G +FI +   D Q  ++ T  F  ++G + +++N   +  +L    DG++ L+DIQ N
Sbjct: 36  GNGKLFIIDI--DNQGRMLETKSFVTQDGLFDVAWNELHENHVLVAQGDGSLRLFDIQLN 93

Query: 230 STLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTD 289
                 P+ I+   H   V  C WN  N  +F S S D T+++     Q    +S+ T  
Sbjct: 94  D----YPVAIFQE-HEKEVFSCNWNLINKQLFVSSSWDGTVKVWTPMRQ----SSLTTLT 144

Query: 290 PFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLI 349
           P    A +       +A  +  +      R+      S++ +++ I   +FSPH   +++
Sbjct: 145 PKPMTAHN-------SALSSKDIPMSNQKRHT-----SLSKNKNCIYQSQFSPHDPNIVM 192

Query: 350 SSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAE 409
           S   +  V M+D+        P +A   +    M H G  +   DF  N     ++A+  
Sbjct: 193 SCAGNSYVTMFDLRQ------PANANQYS---FMAHNGMETLTCDF--NKYRSHIIATGG 241

Query: 410 EENIIQVW 417
            +N+++VW
Sbjct: 242 VDNMVKVW 249

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 108/238 (45%), Gaps = 41/238 (17%)

Query: 166 IATINGSGTVFIYN-QSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALW 224
           +    G G++ +++ Q ND   A+      H++  +  ++N  +K   +S S DGT+ +W
Sbjct: 76  VLVAQGDGSLRLFDIQLNDYPVAIFQE---HEKEVFSCNWNLINKQLFVSSSWDGTVKVW 132

Query: 225 DIQENS---TLAKKPLKIWDSV-------------------HNDIVNDCKWNEFNSNVFA 262
                S   TL  KP+   +S                    + + +   +++  + N+  
Sbjct: 133 TPMRQSSLTTLTPKPMTAHNSALSSKDIPMSNQKRHTSLSKNKNCIYQSQFSPHDPNIVM 192

Query: 263 SVSEDSTLQLHDQRE-QNTIINSIKTTDPFNTLA--FSKHSQYLMAAAGTDSLVYLYDSR 319
           S + +S + + D R+  N    S    +   TL   F+K+  +++A  G D++V ++D R
Sbjct: 193 SCAGNSYVTMFDLRQPANANQYSFMAHNGMETLTCDFNKYRSHIIATGGVDNMVKVWDLR 252

Query: 320 -------NLSVPLYSMN---GHEDSITNLEFSPHTDGVLISSGNDRRVIMW-DINDIG 366
                  N   P+ S+N   GH+ +I  + +SPH   +L+S+  D    +W D++D G
Sbjct: 253 MVRKMAANSRQPM-SVNEICGHDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQDLSDDG 309

>ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 56/251 (22%), Positives = 96/251 (38%), Gaps = 65/251 (25%)

Query: 207 NDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSE 266
            DK +L S S DGTI +WD    + L         S H + V+  KW      +  + S 
Sbjct: 246 GDKPRLASASKDGTIKIWDASRRTCLYTL------SGHTNSVSCVKWG--GQGLLYTGSH 297

Query: 267 DSTLQLHDQREQNTIINSIKT-----------------TDPFN----------------- 292
           D T+++ D +     IN +K+                   PF                  
Sbjct: 298 DKTIRVWDIKAGGKCINILKSHAHWVNHLSLSTDYAIRVGPFGPDGKASPSPQEARDIAK 357

Query: 293 -----TLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDG- 346
                 +  S   + LM  A  D  ++L++    + PL  M GH+  + ++ FSP  DG 
Sbjct: 358 KNYEKVVRKSGQVEELMVTASDDFTMFLWNPLKSAKPLARMTGHQKLVNHVAFSP--DGR 415

Query: 347 VLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMA 406
            ++S+  D  + +W            D  DG  + I    GH ++V   + + +   L+ 
Sbjct: 416 YIVSASFDNSIKLW------------DGRDG--KFIATFRGHVASVYQVAWSSDCR-LLV 460

Query: 407 SAEEENIIQVW 417
           S  ++  ++VW
Sbjct: 461 SCSKDTTLKVW 471

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 87/173 (50%), Gaps = 21/173 (12%)

Query: 203 SFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFA 262
           +F P+   ++++G+ D T  +WD    +     PL +    H++ V    W+  +  + A
Sbjct: 150 AFAPDTSSRMVTGAGDNTARIWDCATQT-----PLSVLKG-HSNWVLCVAWSP-DGELIA 202

Query: 263 SVSEDSTLQLHDQREQNTIINSIK---------TTDPFNTLAFSKHSQYLMAAAGTDSLV 313
           + S D+T++L + +      +++K         T +P + +A     +  +A+A  D  +
Sbjct: 203 TGSMDNTIRLWESKAGKPWGDAMKGHSKWITSLTWEPLHLVAAGDKPR--LASASKDGTI 260

Query: 314 YLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIG 366
            ++D+   +  LY+++GH +S++ +++     G+L +  +D+ + +WDI   G
Sbjct: 261 KIWDASRRTC-LYTLSGHTNSVSCVKWG--GQGLLYTGSHDKTIRVWDIKAGG 310

>NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {ON}
           Anc_8.316 YDR142C
          Length = 375

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 65/256 (25%), Positives = 117/256 (45%), Gaps = 43/256 (16%)

Query: 171 GSGTVFIYNQSNDKQSALISTLRFHKENG-YGLSFNPNDKGKLLSGSDDGTIALWDIQEN 229
           G+G + I + + + Q  LI T  F  ++  + +++N   + +++    DG++ L+DI   
Sbjct: 36  GNGRLSILDIAPNGQ--LIETKSFLTQDCLFDIAWNEQHEKQVVVAQGDGSLRLFDID-- 91

Query: 230 STLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTD 289
             LAK P+ I++  H   V  C WN  N  +F S S D T+++     + +++    T  
Sbjct: 92  --LAKYPIAIFNE-HKKEVMSCNWNLINKTMFTSSSWDGTVKIWSPTRKESLL----TLR 144

Query: 290 PFNTLAFSKHSQYLMAAAGTDSLVYLYDSR--NLSV-PLYSMN-----GHEDSITNLEFS 341
           P  T  + KH          DS+  +   R  N+ + P + +N      ++D I   +FS
Sbjct: 145 P--TPKWKKH---------LDSMEPIIPKRRNNIQIQPSHKINMPNNNNNKDCIYQSQFS 193

Query: 342 PHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNI 401
           PH   +LI    D    ++D+ D      P + +       + HAG      DF  N   
Sbjct: 194 PHDPNLLICCSGDSYTTIFDLRD------PYNTQRN----FLSHAGMEVLSADF--NKYR 241

Query: 402 PWLMASAEEENIIQVW 417
           P ++A+A  +N I++W
Sbjct: 242 PNVLATAGVDNSIRIW 257

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/273 (19%), Positives = 108/273 (39%), Gaps = 43/273 (15%)

Query: 137 PRSNIKIVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHK 196
           P   +   K F  ++ +    +  Q+   +    G G++ +++   D     I+    HK
Sbjct: 47  PNGQLIETKSFLTQDCLFDIAWNEQHEKQVVVAQGDGSLRLFDI--DLAKYPIAIFNEHK 104

Query: 197 ENGYGLSFNPNDKGKLLSGSDDGTIALWD-IQENSTLAKKPLKIW----DSVH------- 244
           +     ++N  +K    S S DGT+ +W   ++ S L  +P   W    DS+        
Sbjct: 105 KEVMSCNWNLINKTMFTSSSWDGTVKIWSPTRKESLLTLRPTPKWKKHLDSMEPIIPKRR 164

Query: 245 -------------------NDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSI 285
                               D +   +++  + N+    S DS   + D R+      + 
Sbjct: 165 NNIQIQPSHKINMPNNNNNKDCIYQSQFSPHDPNLLICCSGDSYTTIFDLRDPYNTQRNF 224

Query: 286 KTTDPFNTLA--FSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSM------NGHEDSITN 337
            +      L+  F+K+   ++A AG D+ + ++D R L     ++      N H+ ++  
Sbjct: 225 LSHAGMEVLSADFNKYRPNVLATAGVDNSIRIWDFRMLVARDAAICINEIVNAHDLAVRK 284

Query: 338 LEFSPHTDGVLISSGNDRRVIMWDINDIGAEQI 370
           + +SPH   +L+S+  D    +W  ND+  + I
Sbjct: 285 VVWSPHHSDILLSTSYDMSCKIW--NDLSYDPI 315

>TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {ON}
           Anc_6.340 YCR072C
          Length = 515

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 118/300 (39%), Gaps = 73/300 (24%)

Query: 164 DIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNP------NDKGKLLSGSD 217
           ++IAT +   T+ ++   N K       +R H++    LS+ P       ++ KL + S 
Sbjct: 199 ELIATGSMDNTIRLWEGKNGKPFG--EAMRGHQKWITSLSWEPLHLVKAGERPKLATSSK 256

Query: 218 DGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQRE 277
           DGTI +WD      L         S H + V+  KW     N+  S S D T+++ D   
Sbjct: 257 DGTIKVWDTGRRVCLYTL------SGHVNSVSCVKWG--GKNLLYSGSHDKTVRVWDMNL 308

Query: 278 QNTIINSIKT-----------------TDPFNTLAFSKHS-------------------- 300
               IN +K+                   PF+       +                    
Sbjct: 309 GGKCINILKSHAHWVNHLSLSTDYALRVGPFDHTGIMPATPEEARAKALKNYEKVAKRNG 368

Query: 301 --QYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDG-VLISSGNDRRV 357
             + LM  A  D  ++L++    + P+  M GH+  + ++ FSP  DG  ++S+  D  +
Sbjct: 369 SDEELMVTASDDFTMFLWNPSKSTKPISRMTGHQKLVNHVAFSP--DGRYIVSASFDNSI 426

Query: 358 IMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
            +W            D+ DG  + I    GH ++V   + + +   L+AS  ++  ++VW
Sbjct: 427 KLW------------DSRDG--KFITTFRGHVASVYQVAWSSDCR-LLASCSKDTSLKVW 471

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/175 (21%), Positives = 85/175 (48%), Gaps = 18/175 (10%)

Query: 203 SFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFA 262
           SF P+   ++++G+ D T  +WD    + +         S H + V    W+  +  + A
Sbjct: 150 SFAPHTSSRMVTGAGDNTARIWDCDTQTPMVTL------SGHTNWVLCVAWSP-DGELIA 202

Query: 263 SVSEDSTLQLHDQREQNTIINSIK------TTDPFNTLAFSKHSQY-LMAAAGTDSLVYL 315
           + S D+T++L + +       +++      T+  +  L   K  +   +A +  D  + +
Sbjct: 203 TGSMDNTIRLWEGKNGKPFGEAMRGHQKWITSLSWEPLHLVKAGERPKLATSSKDGTIKV 262

Query: 316 YDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQI 370
           +D+    V LY+++GH +S++ +++      +L S  +D+ V +WD+N +G + I
Sbjct: 263 WDT-GRRVCLYTLSGHVNSVSCVKWG--GKNLLYSGSHDKTVRVWDMN-LGGKCI 313

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 77/159 (48%), Gaps = 15/159 (9%)

Query: 205 NPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASV 264
           N +D+  +++ SDD T+ LW    N + + KP+      H  +VN   ++  +     S 
Sbjct: 367 NGSDEELMVTASDDFTMFLW----NPSKSTKPISRMTG-HQKLVNHVAFSP-DGRYIVSA 420

Query: 265 SEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRN--LS 322
           S D++++L D R+   I            +A+S   + L+A+   D+ + ++D R   LS
Sbjct: 421 SFDNSIKLWDSRDGKFITTFRGHVASVYQVAWSSDCR-LLASCSKDTSLKVWDIRTKKLS 479

Query: 323 VPLYSMNGHEDSITNLEFSPHTDGVLISSGN-DRRVIMW 360
           V L    GH D +  +++S   DG  + SG  D+ V +W
Sbjct: 480 VDL---PGHLDEVYTVDWS--VDGKRVCSGGKDKMVRLW 513

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 94/202 (46%), Gaps = 21/202 (10%)

Query: 187 ALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHND 246
           +L+ +  F  EN + L   P+ K  LL+G  +G I L D     ++ K  +K  ++  ND
Sbjct: 5   SLVESNSFGSEN-WCLKLQPSYKHGLLTGLSNGEIRLLDWSTGKSVQK--IKASETAIND 61

Query: 247 IVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIIN-SIKTTDPFNTLAFSKHSQYLMA 305
           +      ++F++    S +    +++ D R  + I     +   PF +L  S+H   L+A
Sbjct: 62  M--KVIGSDFSAGHLVSSASIDAVKVFDIRTNDRIAQIQNEANSPFISLD-SRHG--LLA 116

Query: 306 AA----GTDSLVYLYDSRNLSVPLYSM-NGHEDSITNLEFSPHTDGVLISSGNDRRVIMW 360
                 G D+ VY+YD R    PL S+ + H D +T ++F P    +L+S   D    ++
Sbjct: 117 CGTELQGIDAAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIY 176

Query: 361 DINDIGAEQIPDDAEDGAPEVI 382
           D+         D+ ED   +VI
Sbjct: 177 DLKQ-------DEEEDALHQVI 191

 Score = 30.4 bits (67), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 173 GTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQEN 229
             V+IY+      + L S +  H ++   + F+P+D   LLSGS DG   ++D++++
Sbjct: 126 AAVYIYDIRK-WDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQD 181

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 74/152 (48%), Gaps = 12/152 (7%)

Query: 221 IALWDIQENSTLAKKPLK--IWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQ 278
           I LWDI  +     KPL    W +   D +N  K+N+ ++NV  S   D+++ L+D R  
Sbjct: 198 INLWDINRS-----KPLSDLSWGA---DNINTVKFNQNDANVLGSAGSDNSIVLYDLR-T 248

Query: 279 NTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNL 338
           N+    I  T   N++ ++    +    A  D   Y YD RN+S  L     H  ++ ++
Sbjct: 249 NSATQKIVQTMRVNSMCWNPMEAFNFVVASEDHNAYYYDMRNMSRALNVFKDHVSAVMDV 308

Query: 339 EFSPHTDGVLISSGNDRRVIMWDINDIGAEQI 370
           + SP T   ++++  D+ + ++ IN   + +I
Sbjct: 309 DISP-TGEEVVTASYDKTIRIFPINKGHSREI 339

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 83/197 (42%), Gaps = 31/197 (15%)

Query: 195 HKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDC--- 251
           H++  Y L+ + ND  K+ SGS DG I  WD+     +A      + + +  I   C   
Sbjct: 66  HQDGVYVLAKHYNDLNKIASGSGDGVIKYWDMSSREQIAS-----FKAHYGTITGLCITP 120

Query: 252 -----KWNEFNSNVFASVSEDSTLQL---------HDQREQ-----NTIINSIKTTDPFN 292
                  +  N N   S S+D T++L         H   +Q     N +I        F 
Sbjct: 121 KVNIDSASSGNQNFVLSSSDDKTVKLWSVNHEDFAHVDNDQVINTDNGLIKHYYGEHAFQ 180

Query: 293 TLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSG 352
            L  S+ +   +        + L+D  N S PL  ++   D+I  ++F+ +   VL S+G
Sbjct: 181 GLDHSRMTSNFVTGG---PRINLWDI-NRSKPLSDLSWGADNINTVKFNQNDANVLGSAG 236

Query: 353 NDRRVIMWDINDIGAEQ 369
           +D  ++++D+    A Q
Sbjct: 237 SDNSIVLYDLRTNSATQ 253

>KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1299

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 100/239 (41%), Gaps = 25/239 (10%)

Query: 189 ISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHN-DI 247
           ++ L  H      ++FN      L SG   G I +WD  +  T    P     ++   D 
Sbjct: 97  VAKLAQHTTPVKTVTFNARQHNVLCSGGSKGEIYIWDANKIETPGYAPFVPGTAMTPMDE 156

Query: 248 VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIIN---SIKTTDPFNTLAF----SKHS 300
           +    WN+  ++VFAS        + D + +  +I+   +   T   N L+       +S
Sbjct: 157 IYSLAWNQNQAHVFASAGSSGYASIWDLKAKKEVIHLSYASPVTGQRNQLSIVEWHPNNS 216

Query: 301 QYLMAAAGTDS--LVYLYDSRNLSVPLYSMN-GHEDSITNLEFSPHTDGVLISSGNDRRV 357
             +  A+G DS   + ++D RN +VP+  ++  H   + +L++    + +L+SSG D   
Sbjct: 217 TRIATASGNDSDPSILIWDLRNANVPMQVLSQPHTKGVLSLDWCKQDETLLLSSGRDNVC 276

Query: 358 IMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQV 416
           ++W            + E+G         G+      F+  P  P L ASA  +N I+V
Sbjct: 277 VLW------------NPEEGQSLTQYPTRGNWCFKTKFA--PQTPDLFASASFDNKIEV 321

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 76/173 (43%), Gaps = 24/173 (13%)

Query: 208 DKGKLLS-GSDDGTIALWDIQENSTLAKKPLKIWD--SVHN-----DIVNDCKWNEFN-- 257
           D+  LL+ G+  GTI   D    STL     +IW   S H       I  D K+N+ +  
Sbjct: 18  DRSPLLATGTASGTIDA-DFSSESTL-----EIWSLLSPHEATPQASITADAKFNDLDWS 71

Query: 258 --SNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYL 315
             + + A   E+  ++     E  ++    + T P  T+ F+     ++ + G+   +Y+
Sbjct: 72  HDNAIIAGALENGVVEFFAPEEPRSVAKLAQHTTPVKTVTFNARQHNVLCSGGSKGEIYI 131

Query: 316 YDSRNLSVPLYS--MNGHE----DSITNLEFSPHTDGVLISSGNDRRVIMWDI 362
           +D+  +  P Y+  + G      D I +L ++ +   V  S+G+     +WD+
Sbjct: 132 WDANKIETPGYAPFVPGTAMTPMDEIYSLAWNQNQAHVFASAGSSGYASIWDL 184

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 50/113 (44%), Gaps = 18/113 (15%)

Query: 262 ASVSEDSTLQL------HDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYL 315
           A  S +STL++      H+   Q +I    K    FN L +S H   ++A A  + +V  
Sbjct: 34  ADFSSESTLEIWSLLSPHEATPQASITADAK----FNDLDWS-HDNAIIAGALENGVVEF 88

Query: 316 Y---DSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDI 365
           +   + R+++     +  H   +  + F+     VL S G+   + +WD N I
Sbjct: 89  FAPEEPRSVA----KLAQHTTPVKTVTFNARQHNVLCSGGSKGEIYIWDANKI 137

>KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7.310
           YDL195W gene spans a gap in the genome sequence
          Length = 1307

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 84/198 (42%), Gaps = 31/198 (15%)

Query: 184 KQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKP------- 236
           K +  ++  RFH       S   N    L +G   G I +WD  +  T A+         
Sbjct: 108 KHAGAVTQARFH-------SLQSN---ILATGDSKGGILIWDTNKCLTKAQGGGVVSTYT 157

Query: 237 --LKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTL 294
             L   +    + V    WN+  +++FAS +  S   + D + +  +++ +  T P   L
Sbjct: 158 PMLPAANKSSEEPVQCLAWNKKQAHIFASTNSTSFASIWDLKAKKDVLH-LSYTSPLTGL 216

Query: 295 A--------FSKHSQYLMAAAGTDS--LVYLYDSRNLSVPLYSM-NGHEDSITNLEFSPH 343
                        S Y+    G D+  +V ++D RN + PL  +  GH   I +L++   
Sbjct: 217 KPQLSVVEWHPDQSTYVATGTGNDTGPVVVVWDLRNANTPLQELTGGHSKGILSLDWCQQ 276

Query: 344 TDGVLISSGNDRRVIMWD 361
            + +L+SSG D  V++W+
Sbjct: 277 DETLLLSSGRDNSVVLWN 294

>Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON}
           (237070..238533) [1464 nt, 488 aa]
          Length = 487

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 96/198 (48%), Gaps = 24/198 (12%)

Query: 179 NQSNDKQSALISTLRFHKENGY-GLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPL 237
           ++S + +  LI T  F+ E+ + GL  + N+   +  G+    I LWD     +   KP+
Sbjct: 157 DESVNTKDGLIKT--FYGEHAFQGLDHHRNNSTFVTGGAQ---IQLWD-----SSRSKPI 206

Query: 238 K--IWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQN---TIINSIKTTDPFN 292
               W +   D V + K+N+  +++ AS   D+++ L+D R  +    I+ S+++    N
Sbjct: 207 SNLTWGA---DNVTNVKFNQTETDILASTGSDNSIVLYDLRTNSPTQKIVQSMRS----N 259

Query: 293 TLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSG 352
            + ++    +    A  D   Y YD RN+S  L     H  ++ +++FSP T   L++  
Sbjct: 260 AICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSP-TGTELVTGS 318

Query: 353 NDRRVIMWDINDIGAEQI 370
            D+ + ++DI    + +I
Sbjct: 319 YDKTIRIYDIGHGHSREI 336

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 80/195 (41%), Gaps = 29/195 (14%)

Query: 188 LISTLRFHKENG-YGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAK------------ 234
            I  L +   +G Y ++ N N   KL + S DG +  W++     L              
Sbjct: 58  FIGQLGYGYRDGVYCIAKNYNSLNKLAAASADGVVKYWNMSTREELCSFKAHYGLVTGLC 117

Query: 235 -KPLKIWDSVHNDIVNDC------KWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKT 287
             P K     +   +  C      K    NS  FA+V +D ++   D      +I +   
Sbjct: 118 VSPEKYSSDKNEHFMISCGDDKTIKLWSVNSEDFANVKDDESVNTKD-----GLIKTFYG 172

Query: 288 TDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGV 347
              F  L   +++   +        + L+DS + S P+ ++    D++TN++F+     +
Sbjct: 173 EHAFQGLDHHRNNSTFVTGGAQ---IQLWDS-SRSKPISNLTWGADNVTNVKFNQTETDI 228

Query: 348 LISSGNDRRVIMWDI 362
           L S+G+D  ++++D+
Sbjct: 229 LASTGSDNSIVLYDL 243

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 55/134 (41%), Gaps = 22/134 (16%)

Query: 304 MAAAGTDSLVYLYDSRNLSV--PLYSMNGHEDSITNLEFSPH------TDGVLISSGNDR 355
           +AAA  D +V  +   N+S    L S   H   +T L  SP        +  +IS G+D+
Sbjct: 83  LAAASADGVVKYW---NMSTREELCSFKAHYGLVTGLCVSPEKYSSDKNEHFMISCGDDK 139

Query: 356 RVIMWDINDIGAEQIPDD----AEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEE 411
            + +W +N      + DD     +DG   +   +  H     D   N N  ++   A+  
Sbjct: 140 TIKLWSVNSEDFANVKDDESVNTKDGL--IKTFYGEHAFQGLDHHRN-NSTFVTGGAQ-- 194

Query: 412 NIIQVWKCSHKLPI 425
             IQ+W  S   PI
Sbjct: 195 --IQLWDSSRSKPI 206

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 97/223 (43%), Gaps = 41/223 (18%)

Query: 202 LSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVF 261
             +N  D   ++S S D T  +WD+Q +  +  + +      H+  V D ++   ++ +F
Sbjct: 249 FDWNTVDTNLIISSSIDTTCIVWDLQSSHYVKTQLI-----AHDSEVFDVRFLTKSTQLF 303

Query: 262 ASVSEDSTLQLHDQRE--QNTII------------NSIKTTDPFNTLAF-------SKHS 300
           AS   D ++++ D R    +TII             +  TT P +  ++       S + 
Sbjct: 304 ASCGGDGSVRVFDLRSLAHSTIIYEPPSSSSSSSAPAAGTTTPSSDGSYALLRLEPSPYD 363

Query: 301 QYLMAAAGTDS-LVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIM 359
             ++A    DS  + + D RN   P+ ++ GH  S+  +++ P    VL+S  +D +V+ 
Sbjct: 364 PNVLATFAADSNKIIILDMRNPESPILTLEGHSSSVNEIKWHPTKRNVLLSCSDDCQVLY 423

Query: 360 WDINDI------------GAEQIPDDAEDGAPEVIMIHAGHRS 390
           WD+N+             GA   P +  DG  + +M   G  S
Sbjct: 424 WDLNNSFMEINGGSVKSPGASGTPLEDTDG--DTVMADGGEGS 464

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 34/163 (20%), Positives = 62/163 (38%), Gaps = 28/163 (17%)

Query: 149 HEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALI---------------STLR 193
           H+ E+   RF+ ++T + A+  G G+V +++  +   S +I                T  
Sbjct: 286 HDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSSSSSSAPAAGTTT 345

Query: 194 FHKENGYGL------SFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI 247
              +  Y L       ++PN        +D   I + D++      + P+   +  H+  
Sbjct: 346 PSSDGSYALLRLEPSPYDPNVLATF--AADSNKIIILDMRN----PESPILTLEG-HSSS 398

Query: 248 VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDP 290
           VN+ KW+    NV  S S+D  +   D       IN      P
Sbjct: 399 VNEIKWHPTKRNVLLSCSDDCQVLYWDLNNSFMEINGGSVKSP 441

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 92/215 (42%), Gaps = 45/215 (20%)

Query: 253 WNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDP--FNTLAFSKHSQYLMAAAGTD 310
           WN  ++N+  S S D+T  + D +  + +   +   D   F+    +K +Q L A+ G D
Sbjct: 251 WNTVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQ-LFASCGGD 309

Query: 311 SLVYLYDSRNL--SVPLY-------------------SMNGHEDSITNLEFSPHTDGVLI 349
             V ++D R+L  S  +Y                   S +G   ++  LE SP+   VL 
Sbjct: 310 GSVRVFDLRSLAHSTIIYEPPSSSSSSSAPAAGTTTPSSDGSY-ALLRLEPSPYDPNVLA 368

Query: 350 SSGND-RRVIMWDINDIGAEQIPDDAEDGAPEV-IMIHAGHRSAVNDFSINPNIPWLMAS 407
           +   D  ++I+ D+ +              PE  I+   GH S+VN+   +P    ++ S
Sbjct: 369 TFAADSNKIIILDMRN--------------PESPILTLEGHSSSVNEIKWHPTKRNVLLS 414

Query: 408 AEEENIIQVWKCSHK-LPIVGG---TPEVSVSILE 438
             ++  +  W  ++  + I GG   +P  S + LE
Sbjct: 415 CSDDCQVLYWDLNNSFMEINGGSVKSPGASGTPLE 449

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 60/257 (23%), Positives = 115/257 (44%), Gaps = 50/257 (19%)

Query: 188 LISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI 247
           ++ TL+ H+++ Y L + P    KL+SGS D T+ +WD++         L I D V    
Sbjct: 386 ILMTLQGHEQDIYSLDYFPAGD-KLVSGSGDRTVRIWDLRTGQ--CSLTLSIEDGVTTVA 442

Query: 248 VN--DCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNT--------LAFS 297
           V+  D K+        A+ S D T+++ D  E   ++  + + +  +T        + F+
Sbjct: 443 VSPGDGKY-------IAAGSLDRTVRVWDS-ETGFLVERLDSENELSTGHKDSVYSVVFT 494

Query: 298 KHSQYLMAAAGTDSLVYLYDSRNL------SVPLYSMNGHEDSITNLEFSPHTDGVLISS 351
           +  Q +++ +  D  V L+D R L      +    +  GH+D + ++  +   D  ++S 
Sbjct: 495 RDGQGVISGS-LDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATT-QDDEYILSG 552

Query: 352 GNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHR------SAVNDFSINPNIPWLM 405
             DR V+ W            D   G P  +++  GHR      + VN F + P++  + 
Sbjct: 553 SKDRGVLFW------------DTASGNP--LLMLQGHRNSVISVAVVNGFPLGPDV-GVF 597

Query: 406 ASAEEENIIQVWKCSHK 422
           A+   +   ++WK + K
Sbjct: 598 ATGSGDCKARIWKYTKK 614

>Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C
           (PRP46) - pre-mRNA splicing factor [contig 67] FULL
          Length = 433

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 82/172 (47%), Gaps = 22/172 (12%)

Query: 205 NPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASV 264
           +P D     +GS+D TI +WD      +A   LK+  + H   V     ++ +  +F S 
Sbjct: 130 DPVDNAWFATGSNDTTIKVWD------MASGKLKLTLTGHVMTVRSVAVSQRHPLMF-SA 182

Query: 265 SEDSTLQLHDQ------REQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDS 318
           SED  ++  D       R+ +   + + T D   TL        L+A+AG D++V L+D 
Sbjct: 183 SEDKMVKCWDLERNAAIRDYHGHFSGVNTVDVHPTLD-------LIASAGRDAVVRLWDI 235

Query: 319 RNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQI 370
           R   +P+ ++ GH+  I  ++  P  D  ++S  +D  V +WDI    A +I
Sbjct: 236 RT-RLPVMTLAGHKSPINQVKCFP-VDPQIMSCSSDATVRLWDIRAGKATKI 285

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 57/123 (46%), Gaps = 17/123 (13%)

Query: 304 MAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN 363
            A    D+ + ++D  +  + L ++ GH  ++ ++  S     ++ S+  D+ V  WD+ 
Sbjct: 137 FATGSNDTTIKVWDMASGKLKL-TLTGHVMTVRSVAVS-QRHPLMFSASEDKMVKCWDLE 194

Query: 364 DIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKL 423
              A              I  + GH S VN   ++P +  L+ASA  + ++++W    +L
Sbjct: 195 RNAA--------------IRDYHGHFSGVNTVDVHPTLD-LIASAGRDAVVRLWDIRTRL 239

Query: 424 PIV 426
           P++
Sbjct: 240 PVM 242

>Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar to
           Ashbya gossypii AAR078W
          Length = 603

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 87/177 (49%), Gaps = 17/177 (9%)

Query: 195 HKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI-VNDCKW 253
           H +    LS N   +  L S S D TI LWD+ + + +         S+HN   V+  +W
Sbjct: 309 HTDAVLSLSHNKQYRVVLASTSADQTIKLWDLNQGTAVRSIA-----SIHNGTTVSSSQW 363

Query: 254 NEFNSNVFASVSEDSTLQLHDQREQN----TIINSIKTTDPFNTLAFSKHSQYLMAAAGT 309
           +  + ++  + + DS + L D R  N    +   S+ T +    ++F   +++L   AGT
Sbjct: 364 HPSDGSIILTGAYDSRVALSDVRISNDSEMSKYWSVMTGEEVECVSFVNDNEFL---AGT 420

Query: 310 DSL-VYLYDSRN--LSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVI-MWDI 362
           DS  +Y +D RN   S PL+++  H+  I+++  +     +++SS    +VI +W I
Sbjct: 421 DSGNIYSFDLRNGEKSSPLWTLKAHDSGISSMNVNSFIPNMMVSSAMGEKVIKLWKI 477

>AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR142C (PEX7)
          Length = 370

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 54/254 (21%), Positives = 112/254 (44%), Gaps = 46/254 (18%)

Query: 171 GSGTVFIYNQSNDKQSALISTLRFHKENG-YGLSFNPNDKGKLLSGSDDGTIALWDIQEN 229
           G+G +FI + +   Q  ++ +  F  ++G + +++N   + ++L+   DG++ L+DI   
Sbjct: 36  GNGRLFIMDLT--AQGTMVESNSFLTKDGLFDVAWNELHENQVLAAQGDGSLRLFDI--- 90

Query: 230 STLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTD 289
            TL + P+ ++   H   V  C WN  + + F S S D T+++       +++       
Sbjct: 91  -TLQQYPIALFQE-HQREVFSCNWNLLHKDTFVSSSWDGTVKVWTPARPQSMLT------ 142

Query: 290 PFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDS------ITNLEFSPH 343
                        L+ A    S++    +R L  PL +   H+D+      I   +FSPH
Sbjct: 143 -------------LLPAPANRSVMVEPGARGL--PLSNQQQHKDAADNKDCIYQAQFSPH 187

Query: 344 TDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPW 403
              +++S   +  V ++D+    A            +  + H+G  +   DF  N   P 
Sbjct: 188 DPNLVMSCSGNSYVSLFDLRQPAASN---------QQRFIAHSGLEALSCDF--NKYRPH 236

Query: 404 LMASAEEENIIQVW 417
           ++A+   + +++VW
Sbjct: 237 VIATGGVDKMVKVW 250

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/239 (22%), Positives = 99/239 (41%), Gaps = 45/239 (18%)

Query: 166 IATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWD 225
           +    G G++ +++ +   Q   I+  + H+   +  ++N   K   +S S DGT+ +W 
Sbjct: 76  VLAAQGDGSLRLFDIT--LQQYPIALFQEHQREVFSCNWNLLHKDTFVSSSWDGTVKVWT 133

Query: 226 -IQENSTLAKKPLKIWDSV----------------HNDIVN--DC----KWNEFNSNVFA 262
             +  S L   P     SV                H D  +  DC    +++  + N+  
Sbjct: 134 PARPQSMLTLLPAPANRSVMVEPGARGLPLSNQQQHKDAADNKDCIYQAQFSPHDPNLVM 193

Query: 263 SVSEDSTLQLHDQRE------QNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLY 316
           S S +S + L D R+      Q  I +S        +  F+K+  +++A  G D +V ++
Sbjct: 194 SCSGNSYVSLFDLRQPAASNQQRFIAHSGLEA---LSCDFNKYRPHVIATGGVDKMVKVW 250

Query: 317 D----------SRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMW-DIND 364
           D          SR   V +  M GH  ++  + +SPH   +L+S+  D     W D+ D
Sbjct: 251 DLRMVRQTLTTSRTAPVSINEMQGHSLAVRKVVWSPHHSNILLSTSYDMTCRAWHDLAD 309

>Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093W
           (REAL)
          Length = 513

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 63/218 (28%), Positives = 102/218 (46%), Gaps = 18/218 (8%)

Query: 148 KHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPN 207
           K    +T   F PQ+    A +  S  V I++ S  +Q  +I T    K+  Y  SF  +
Sbjct: 37  KEHNSVTHISFNPQHPHDFA-VTSSTRVQIFS-SRTRQ--VIKTFSRFKDVVYSASFRSD 92

Query: 208 DKGKLLSGSD-DGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSE 266
             GKLL   D  G ++++D     T+    L I  S H   V   K++  ++ V A+ S+
Sbjct: 93  --GKLLCAGDATGLVSVYDSYNPRTIL---LSINASTHPAHVT--KFHTQDNKVLATASD 145

Query: 267 DSTLQLHD-QREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNL-SVP 324
           D   +L D        +     TD   TL+F   + +++A    D L+ LYD+R+  S P
Sbjct: 146 DRVTRLWDISHAYEPQLELTGATDYVRTLSFIPAAPHMVATGSYDGLIRLYDTRSSGSTP 205

Query: 325 LYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDI 362
           +YS+N H+  I N+     T  ++   GN+ +V  WD+
Sbjct: 206 IYSLN-HDQPIENITAVSPTQ-IVSCGGNNFKV--WDL 239

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 67/165 (40%), Gaps = 16/165 (9%)

Query: 263 SVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS 322
           +V+  + +Q+   R +  I    +  D   + +F    + L A   T  LV +YDS N  
Sbjct: 56  AVTSSTRVQIFSSRTRQVIKTFSRFKDVVYSASFRSDGKLLCAGDAT-GLVSVYDSYNPR 114

Query: 323 VPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVI 382
             L S+N         +F    + VL ++ +DR   +WDI+              A E  
Sbjct: 115 TILLSINASTHPAHVTKFHTQDNKVLATASDDRVTRLWDISH-------------AYEPQ 161

Query: 383 MIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW--KCSHKLPI 425
           +   G    V   S  P  P ++A+   + +I+++  + S   PI
Sbjct: 162 LELTGATDYVRTLSFIPAAPHMVATGSYDGLIRLYDTRSSGSTPI 206

>KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {ON}
           Anc_6.276 YPL247C
          Length = 553

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 84/175 (48%), Gaps = 21/175 (12%)

Query: 204 FNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFAS 263
           +N  D   L+S S D T  +WD+Q ++ +  + +      H+  V D ++   ++ +FAS
Sbjct: 288 WNQTDTNLLISSSIDTTCIVWDLQSSNYVKTQLI-----AHDSEVYDVRFLTKSTQLFAS 342

Query: 264 VSEDSTLQLHDQRE--QNTIINSIKTTDPFNTLAFSKHSQYLMA--AAGTDSLV------ 313
              D ++++ D R    +TII     T+P +    S+    L+    + TD+ V      
Sbjct: 343 CGGDGSVRVFDLRSLAHSTIIYE-PPTNPVSNADLSQQQNALLRLEPSPTDANVIATFVS 401

Query: 314 -----YLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN 363
                 + D RN   P+  + GH+ +I  +++ P    +L+S  +D +V+ WD+N
Sbjct: 402 ESNKILILDMRNSESPVLVLEGHKSAINQIKWHPTKRYILLSCSDDCQVLYWDLN 456

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 79/174 (45%), Gaps = 7/174 (4%)

Query: 248 VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDP--FNTLAFSKHSQYLMA 305
           V    WN+ ++N+  S S D+T  + D +  N +   +   D   ++    +K +Q L A
Sbjct: 283 VTSFDWNQTDTNLLISSSIDTTCIVWDLQSSNYVKTQLIAHDSEVYDVRFLTKSTQ-LFA 341

Query: 306 AAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLI--SSGNDRRVIMWDIN 363
           + G D  V ++D R+L+          + ++N + S   + +L    S  D  VI   ++
Sbjct: 342 SCGGDGSVRVFDLRSLAHSTIIYEPPTNPVSNADLSQQQNALLRLEPSPTDANVIATFVS 401

Query: 364 DIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
           +     I D     +P  +++  GH+SA+N    +P   +++ S  ++  +  W
Sbjct: 402 ESNKILILDMRNSESP--VLVLEGHKSAINQIKWHPTKRYILLSCSDDCQVLYW 453

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 5/87 (5%)

Query: 148 KHEEEITRARFMPQNTDIIAT-INGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNP 206
           + +  + R    P + ++IAT ++ S  + I +  N +   L+  L  HK     + ++P
Sbjct: 378 QQQNALLRLEPSPTDANVIATFVSESNKILILDMRNSESPVLV--LEGHKSAINQIKWHP 435

Query: 207 NDKGKLLSGSDDGTIALWDIQENSTLA 233
             +  LLS SDD  +  WD+  NST +
Sbjct: 436 TKRYILLSCSDDCQVLYWDL--NSTFS 460

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 62/143 (43%), Gaps = 8/143 (5%)

Query: 139 SNIKIVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKEN 198
           SN    +   H+ E+   RF+ ++T + A+  G G+V +++  +   S +I     +  +
Sbjct: 313 SNYVKTQLIAHDSEVYDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPTNPVS 372

Query: 199 GYGLSFNPNDKGKL-LSGSDDGTIALWDIQENSTL------AKKPLKIWDSVHNDIVNDC 251
              LS   N   +L  S +D   IA +  + N  L      ++ P+ + +  H   +N  
Sbjct: 373 NADLSQQQNALLRLEPSPTDANVIATFVSESNKILILDMRNSESPVLVLEG-HKSAINQI 431

Query: 252 KWNEFNSNVFASVSEDSTLQLHD 274
           KW+     +  S S+D  +   D
Sbjct: 432 KWHPTKRYILLSCSDDCQVLYWD 454

>NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201
          Length = 475

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 59/245 (24%), Positives = 94/245 (38%), Gaps = 58/245 (23%)

Query: 161 QNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGK------LLS 214
           +N + +AT +  G V  +N S  ++   + + + H     GL   P    K      +LS
Sbjct: 78  KNLNKLATGSADGVVKYWNMSTREE---LCSFKAHYGLITGLCVTPEHLSKQKNENFMLS 134

Query: 215 GSDDGTIALW--------------DIQENSTLAK------------------------KP 236
            SDD T+ LW              DI   S L K                          
Sbjct: 135 CSDDKTVKLWSVNSEDYANLKNAEDINTASGLLKTYYSDFAFQGIDHHRSKSNFVTGGAK 194

Query: 237 LKIWDSVHNDIVNDCKWN-------EFNSN---VFASVSEDSTLQLHDQREQNTIINSIK 286
           +++WDS  +  + D  W        +FN N   + AS   D++L L+D R  N+    I 
Sbjct: 195 IQLWDSNRSKPLTDLSWGADNISTVKFNQNETDILASAGSDNSLVLYDLR-TNSPTQKIV 253

Query: 287 TTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDG 346
            T   N + ++    +    A  D   Y YD RN+S  L     H  ++ +++FSP  D 
Sbjct: 254 QTMRTNAICWNPMEAFNFVVANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDE 313

Query: 347 VLISS 351
           ++  S
Sbjct: 314 IVTGS 318

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 83/186 (44%), Gaps = 26/186 (13%)

Query: 195 HKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWN 254
           H++  Y ++ N  +  KL +GS DG +  W++     L       + + +  I   C   
Sbjct: 66  HRDGVYVIAKNYKNLNKLATGSADGVVKYWNMSTREELCS-----FKAHYGLITGLCVTP 120

Query: 255 EF-----NSNVFASVSEDSTLQL-----------HDQREQNTIINSIKTTDPFNTLAFS- 297
           E      N N   S S+D T++L            +  + NT    +KT   ++  AF  
Sbjct: 121 EHLSKQKNENFMLSCSDDKTVKLWSVNSEDYANLKNAEDINTASGLLKTY--YSDFAFQG 178

Query: 298 -KHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRR 356
             H +         + + L+DS N S PL  ++   D+I+ ++F+ +   +L S+G+D  
Sbjct: 179 IDHHRSKSNFVTGGAKIQLWDS-NRSKPLTDLSWGADNISTVKFNQNETDILASAGSDNS 237

Query: 357 VIMWDI 362
           ++++D+
Sbjct: 238 LVLYDL 243

>Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 119/300 (39%), Gaps = 73/300 (24%)

Query: 164 DIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSF------NPNDKGKLLSGSD 217
           ++IAT +   T+ +++    +   L   LR H +    LS+       P  K +L S S 
Sbjct: 199 EVIATGSMDNTIRLWDPKTGE--CLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSK 256

Query: 218 DGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQRE 277
           DGTI +WD         +  +   S H + V+  KW      +  S S D T+++ D   
Sbjct: 257 DGTIKIWDT------VSRVCQYTMSGHTNSVSCVKWG--GQGLLYSGSHDRTVRVWDMNS 308

Query: 278 QNTIINSIKTTDPF-NTLAFSK-------------------------------------- 298
           Q   IN +K+   + N L+ S                                       
Sbjct: 309 QGRCINILKSHAHWVNHLSLSTDYALRVGAFDHTGQKPTSPEDAQKKALANYEKICKKNG 368

Query: 299 HSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDG-VLISSGNDRRV 357
           +S+ +M  A  D  ++L++    + P+  M GH+  + ++ FSP  DG  ++S+  D  +
Sbjct: 369 NSEEMMVTASDDFTIFLWNPLKSTKPIARMTGHQKLVNHVAFSP--DGRYIVSASFDNSI 426

Query: 358 IMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
            +W            D  DG  + I    GH ++V   + + +   L+ S  ++  ++VW
Sbjct: 427 KLW------------DGRDG--KFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 471

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 88/171 (51%), Gaps = 17/171 (9%)

Query: 203 SFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFA 262
           +F P+   ++++G+ D T  +WD    + +    LK     H + V    W+  +  V A
Sbjct: 150 AFAPHTSSRMVTGAGDNTARIWDCDTQTPM--HTLK----GHFNWVLCVAWSP-DGEVIA 202

Query: 263 SVSEDSTLQLHDQREQNTIINSIK------TTDPFNTLAFSK-HSQYLMAAAGTDSLVYL 315
           + S D+T++L D +    + ++++      T+  +  +   K  S+  +A++  D  + +
Sbjct: 203 TGSMDNTIRLWDPKTGECLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKI 262

Query: 316 YDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIG 366
           +D+ +  V  Y+M+GH +S++ +++     G+L S  +DR V +WD+N  G
Sbjct: 263 WDTVS-RVCQYTMSGHTNSVSCVKWGGQ--GLLYSGSHDRTVRVWDMNSQG 310

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 93/191 (48%), Gaps = 29/191 (15%)

Query: 186 SALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAK--------KPL 237
           + L++ + F  +N + L   P     LL  S +G++ L D    S + K          L
Sbjct: 3   AKLVNQITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSL 61

Query: 238 KIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFS 297
           ++   ++ND  N C        +FA+ S  ++++++D R  ++ + +IK     N++  S
Sbjct: 62  RV---INNDFENGC--------IFAATSL-ASVKIYDVRNGDSPVATIKNDK--NSVFLS 107

Query: 298 KHSQYLMAAAGT-----DSLVYLYDSRNLSVPLYS-MNGHEDSITNLEFSPHTDGVLISS 351
             S++ M   GT     D+ +++YD R  S P+ + ++ H D IT+++F P    +L+S 
Sbjct: 108 LESRHDMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSG 167

Query: 352 GNDRRVIMWDI 362
             D    ++D+
Sbjct: 168 STDGYTNIYDL 178

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 6/60 (10%)

Query: 195 HKENGYGLSFNPNDKGKLLSGSDDGTIALWDI-QENSTLAKKPLKIWDSVHNDIVNDCKW 253
           H ++   + F+P+DK  LLSGS DG   ++D+ QE+   A   +  + S+H+     C W
Sbjct: 147 HHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEALHQVINYASIHS-----CGW 201

>Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 68/300 (22%), Positives = 120/300 (40%), Gaps = 73/300 (24%)

Query: 164 DIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSF------NPNDKGKLLSGSD 217
           ++IAT +   T+ ++N    +   L   LR H +    LS+       P  K +L S S 
Sbjct: 199 EVIATGSMDNTIRLWNPKTGE--CLGDALRGHSKWITCLSWEPIHLVKPGSKPRLASSSK 256

Query: 218 DGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQRE 277
           DGTI +WD    + + +  L    S H + V+  KW      +  S S D T+++ D   
Sbjct: 257 DGTIKIWD--SVNRVCQYTL----SGHTNSVSCVKWG--GQGLLYSGSHDRTVRVWDMNS 308

Query: 278 QNTIINSIKTTDPF-NTLAFSK-------------------------------------- 298
           Q   IN +K+   + N L+ S                                       
Sbjct: 309 QGRCINILKSHAHWVNHLSLSTDYALRVGAFDHTGKKPATSEEAQKKALENYEKICKKNG 368

Query: 299 HSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDG-VLISSGNDRRV 357
            S+ +M  A  D  ++L++    + P+  M GH+  + ++ FSP  DG  ++S+  D  +
Sbjct: 369 SSEEMMVTASDDFTMFLWNPLKSTKPIARMTGHQKLVNHVAFSP--DGRYIVSASFDNSI 426

Query: 358 IMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
            +W            D  DG  + I    GH ++V   + + +   L+ S  ++  ++VW
Sbjct: 427 KLW------------DGRDG--KFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 471

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 85/171 (49%), Gaps = 17/171 (9%)

Query: 203 SFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFA 262
           +F P+   ++++G+ D T  +WD    + +    LK     H + V    W+  +  V A
Sbjct: 150 AFAPHTSSRMVTGAGDNTARIWDCDTQTPM--HTLK----GHFNWVLCVSWSP-DGEVIA 202

Query: 263 SVSEDSTLQLHDQREQNTIINSIKTTDPFNTL-------AFSKHSQYLMAAAGTDSLVYL 315
           + S D+T++L + +    + ++++    + T             S+  +A++  D  + +
Sbjct: 203 TGSMDNTIRLWNPKTGECLGDALRGHSKWITCLSWEPIHLVKPGSKPRLASSSKDGTIKI 262

Query: 316 YDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIG 366
           +DS N  V  Y+++GH +S++ +++     G+L S  +DR V +WD+N  G
Sbjct: 263 WDSVN-RVCQYTLSGHTNSVSCVKWGGQ--GLLYSGSHDRTVRVWDMNSQG 310

>TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {ON}
           Anc_8.316 YDR142C
          Length = 367

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 55/254 (21%), Positives = 108/254 (42%), Gaps = 46/254 (18%)

Query: 171 GSGTVFIYNQSNDKQSALISTLRFHKENG-YGLSFNPNDKGKLLSGSDDGTIALWDIQEN 229
           G+G +FI +   D Q  +  +  F  ++  + +++N   + ++L    DG++ L+D +  
Sbjct: 36  GNGKLFILDI--DPQGKIHESNSFLTQDCLFDVAWNELHENQVLVAQGDGSLRLFDTK-- 91

Query: 230 STLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTD 289
             LA+ P+ I+   H   V  C WN  N N F S S D T+++     +++++    T  
Sbjct: 92  --LAQYPIAIFKE-HQKEVFSCNWNLLNKNTFVSSSWDGTVKIWSPTRKDSLLT--LTPQ 146

Query: 290 PFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHED------SITNLEFSPH 343
           P  T+    HS                    +++P+ +   H D       I   +FSPH
Sbjct: 147 PLKTVNRVDHS--------------------MNIPMSNQRNHADITRNKNCIYQAQFSPH 186

Query: 344 TDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPW 403
              +++    +  + ++D+      Q P           + H+G  +   DF  N   P 
Sbjct: 187 DPNLVMCCSGNSYITIFDL-----RQPPSPTNQ---RNFLGHSGLEALTCDF--NKYRPH 236

Query: 404 LMASAEEENIIQVW 417
            +A+   +N+I++W
Sbjct: 237 TIATGGVDNVIRIW 250

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/206 (22%), Positives = 89/206 (43%), Gaps = 34/206 (16%)

Query: 189 ISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENS---TLAKKPLKIWDSV-- 243
           I+  + H++  +  ++N  +K   +S S DGT+ +W         TL  +PLK  + V  
Sbjct: 97  IAIFKEHQKEVFSCNWNLLNKNTFVSSSWDGTVKIWSPTRKDSLLTLTPQPLKTVNRVDH 156

Query: 244 -----------HNDI------VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIK 286
                      H DI      +   +++  + N+    S +S + + D R+  +  N   
Sbjct: 157 SMNIPMSNQRNHADITRNKNCIYQAQFSPHDPNLVMCCSGNSYITIFDLRQPPSPTNQRN 216

Query: 287 TTDPFN----TLAFSKHSQYLMAAAGTDSLVYLYD----SRNLSVPLYSMN----GHEDS 334
                     T  F+K+  + +A  G D+++ ++D    S+N S P   +N    GHE +
Sbjct: 217 FLGHSGLEALTCDFNKYRPHTIATGGVDNVIRIWDLRMTSKNNSSPSICVNEVVGGHELA 276

Query: 335 ITNLEFSPHTDGVLISSGNDRRVIMW 360
           +  + +SPH   + +S+  D    +W
Sbjct: 277 VRKVCWSPHHSNIFLSTSYDMTCCVW 302

>Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa]
           {ON} YCR072C - Protein required for cell viability
           [contig 17] FULL
          Length = 514

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 68/300 (22%), Positives = 115/300 (38%), Gaps = 73/300 (24%)

Query: 164 DIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNP------NDKGKLLSGSD 217
           ++IAT +   T+ +++  ++K  +    LR H +    L++ P       D+ +L S S 
Sbjct: 198 ELIATGSMDNTIRLWD--SNKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLASASK 255

Query: 218 DGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQRE 277
           DGTI +WD      +         S H + V+  KW      +  S S D T++  D   
Sbjct: 256 DGTIKIWDTTRRVCVLTL------SGHTNSVSCVKWG--GRGILYSGSHDKTIRAWDMAA 307

Query: 278 QNTIIN------------SIKTTDPFNTLAF-------------------------SKHS 300
               IN            S+ T       AF                          K+ 
Sbjct: 308 GGKCINILKSHAHWINHLSLNTDYALRVGAFDHTGEKPSSPEEARAKALKNYEKIAKKNG 367

Query: 301 QY--LMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDG-VLISSGNDRRV 357
           Q   LM  A  D  +YL+D    S P+  M GH+  + ++ FSP  DG  ++S+  D  +
Sbjct: 368 QLEELMVTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAFSP--DGRYIVSASFDNSI 425

Query: 358 IMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
            +W            D  +G    I    GH ++V   + + +   L+ S  ++  ++VW
Sbjct: 426 KLW------------DGRNGT--FIATFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 470

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/205 (21%), Positives = 93/205 (45%), Gaps = 34/205 (16%)

Query: 203 SFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFA 262
           +F P+  G++++GS D T  +WD   N+ +    LK     H + V    W   +  + A
Sbjct: 149 AFAPHTSGRMVTGSGDNTARIWDCNTNTPMYT--LK----GHFNWVLCVAWCP-DGELIA 201

Query: 263 SVSEDSTLQLHDQREQNTIINSIK---------TTDPFNTLAFSKHSQYLMAAAGTDSLV 313
           + S D+T++L D  +  +   +++         T +P + +      Q  +A+A  D  +
Sbjct: 202 TGSMDNTIRLWDSNKGESYGEALRGHAKWITSLTWEPMHLVKAG--DQPRLASASKDGTI 259

Query: 314 YLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDD 373
            ++D+    V + +++GH +S++ +++     G+L S  +D+ +  WD+   G       
Sbjct: 260 KIWDTTR-RVCVLTLSGHTNSVSCVKWGGR--GILYSGSHDKTIRAWDMAAGG------- 309

Query: 374 AEDGAPEVIMIHAGHRSAVNDFSIN 398
                 + I I   H   +N  S+N
Sbjct: 310 ------KCINILKSHAHWINHLSLN 328

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 72/152 (47%), Gaps = 15/152 (9%)

Query: 212 LLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQ 271
           +++ SDD T+ LWD  +    A KP+      H  +VN   ++  +     S S D++++
Sbjct: 373 MVTASDDFTMYLWDPLK----ASKPITRMTG-HQKLVNHVAFSP-DGRYIVSASFDNSIK 426

Query: 272 LHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSR--NLSVPLYSMN 329
           L D R    I            +A+S   + L+ +   D+ + ++D R   LSV L    
Sbjct: 427 LWDGRNGTFIATFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVWDVRTKKLSVDL---P 482

Query: 330 GHEDSITNLEFSPHTDG-VLISSGNDRRVIMW 360
           GH D +  +++S   DG  + S+G D+ V +W
Sbjct: 483 GHNDEVYTVDWS--VDGKRVCSAGKDKMVRIW 512

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 35/78 (44%), Gaps = 14/78 (17%)

Query: 286 KTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTD 345
           KTT+ F T+ ++  +              ++  R ++    ++ GH  +I    F+PHT 
Sbjct: 110 KTTEDFITIVYTPRA--------------VFKVRPVTRSSSAIAGHGSTILCSAFAPHTS 155

Query: 346 GVLISSGNDRRVIMWDIN 363
           G +++   D    +WD N
Sbjct: 156 GRMVTGSGDNTARIWDCN 173

>KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011W
          Length = 478

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 92/211 (43%), Gaps = 23/211 (10%)

Query: 153 ITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLR----------FHKENGYGL 202
           +T +   PQ  + + +     TV +++ ++D  S +    R          FH E+ +  
Sbjct: 118 VTPSYLSPQRENFMLSCGDDKTVKLWSVNSDDFSNVKDDTRLNTDEGIIKTFHGEHAFQS 177

Query: 203 SFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLK--IWDSVHNDIVNDCKWNEFNSNV 260
             +   K   ++G     I LWD     T   KP+    W +   D +N  ++N+   ++
Sbjct: 178 LDHHRQKSNFVTGG--AQIELWD-----TNRSKPISNLSWGA---DNINHVRFNQNEVDI 227

Query: 261 FASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRN 320
            AS   D+++ L+D R  N+    I  T   N++ ++    +    A  D   Y YD RN
Sbjct: 228 LASTGSDNSVVLYDLR-TNSPTQKIVQTMRTNSICWNPVEAFNFVIANEDHNAYYYDMRN 286

Query: 321 LSVPLYSMNGHEDSITNLEFSPHTDGVLISS 351
           +S  L+    H  ++ +++FSP  D V+  S
Sbjct: 287 MSKALHVFKDHVSAVMDVDFSPTGDEVVTGS 317

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/202 (20%), Positives = 85/202 (42%), Gaps = 47/202 (23%)

Query: 166 IATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLS-----FNPNDKGKLLSGSDDGT 220
           +AT +G G +  +N S  ++   +S+ + H     GL       +P  +  +LS  DD T
Sbjct: 83  LATASGDGVIKYWNMSTREE---LSSFKAHYGMVTGLCVTPSYLSPQRENFMLSCGDDKT 139

Query: 221 IALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNT 280
           + LW +                              NS+ F++V +D+ L   +      
Sbjct: 140 VKLWSV------------------------------NSDDFSNVKDDTRLNTDE-----G 164

Query: 281 IINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEF 340
           II +      F +L   +     +        + L+D+ N S P+ +++   D+I ++ F
Sbjct: 165 IIKTFHGEHAFQSLDHHRQKSNFVTGGAQ---IELWDT-NRSKPISNLSWGADNINHVRF 220

Query: 341 SPHTDGVLISSGNDRRVIMWDI 362
           + +   +L S+G+D  V+++D+
Sbjct: 221 NQNEVDILASTGSDNSVVLYDL 242

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 39/94 (41%), Gaps = 12/94 (12%)

Query: 304 MAAAGTDSLVYLYDSRNLSV--PLYSMNGHEDSITNL-----EFSPHTDGVLISSGNDRR 356
           +A A  D ++  +   N+S    L S   H   +T L       SP  +  ++S G+D+ 
Sbjct: 83  LATASGDGVIKYW---NMSTREELSSFKAHYGMVTGLCVTPSYLSPQRENFMLSCGDDKT 139

Query: 357 VIMWDINDIGAEQIPDDAEDGAPEVIM--IHAGH 388
           V +W +N      + DD      E I+   H  H
Sbjct: 140 VKLWSVNSDDFSNVKDDTRLNTDEGIIKTFHGEH 173

>TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa]
           {ON} Anc_6.340 YCR072C
          Length = 515

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 87/174 (50%), Gaps = 18/174 (10%)

Query: 204 FNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFAS 263
           F P+   ++++G+ D T  +WD    + +A        S H + V    W+  +    A+
Sbjct: 151 FAPHTSSRMVTGAGDNTARVWDCDTQTPMATL------SGHQNWVLCVAWSP-DGETIAT 203

Query: 264 VSEDSTLQLHDQREQNTIINSIK------TTDPFNTLAFSKHS-QYLMAAAGTDSLVYLY 316
            S D T++L D +    + +++K      T+  +  L   K   +  +A+A  D  + ++
Sbjct: 204 GSMDCTVRLWDSKAGQPLGDALKGHQKWITSLVWEPLHLVKPGDKPRLASASKDGTIKIW 263

Query: 317 DSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQI 370
           D+    V +Y+++GH +S++ +++     G+L S  +D+ V +WD+N +G + I
Sbjct: 264 DTSR-RVCIYTLSGHTNSVSCVKWGGQ--GLLYSGSHDKTVRVWDMN-VGGKCI 313

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 56/253 (22%), Positives = 96/253 (37%), Gaps = 65/253 (25%)

Query: 205 NPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASV 264
            P DK +L S S DGTI +WD      +         S H + V+  KW      +  S 
Sbjct: 244 KPGDKPRLASASKDGTIKIWDTSRRVCIYTL------SGHTNSVSCVKWG--GQGLLYSG 295

Query: 265 SEDSTLQLHDQREQNTIINSIKT-----------------TDPFNTLA--FSK------- 298
           S D T+++ D       IN +K+                   PF+  A  F+        
Sbjct: 296 SHDKTVRVWDMNVGGKCINILKSHAHWVNHLSLSTEYALRVGPFDHTATKFTSAEEARKK 355

Query: 299 -------------HSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTD 345
                         ++ L+  A  D  ++L+D      PL  + GH+  + ++ FSP  D
Sbjct: 356 ALENYEKIAKRNGKAEELIVTASDDFTMFLWDPTKSGKPLARLTGHQKLVNHVAFSP--D 413

Query: 346 G-VLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWL 404
           G  ++S+  D  + +W            D  +G    I    GH ++V   + + +   L
Sbjct: 414 GRFIVSASFDNSIKLW------------DGRNGT--FISTFRGHVASVYQVAWSSDCR-L 458

Query: 405 MASAEEENIIQVW 417
           + S  ++  ++VW
Sbjct: 459 LVSCSKDTTLKVW 471

>TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.122
           YGL003C
          Length = 732

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 76/152 (50%), Gaps = 14/152 (9%)

Query: 215 GSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHD 274
           G  +G I ++D+ +     +K ++   S H D      WN   S++  S S D T+   D
Sbjct: 486 GQSNGIIEIYDVTK-----RKCIRTL-SGHTDRTACLSWN---SHILTSGSRDRTILHRD 536

Query: 275 QREQNTIINSIKT-TDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHED 333
            R ++     IK+ T     L +++    L++  G D+ V +YD   +  PL +++ H  
Sbjct: 537 VRMKDPFFERIKSHTQEVCGLKWNESDNKLVSG-GNDNTVNIYDG-CMPTPLLTLDEHTA 594

Query: 334 SITNLEFSPHTDGVLISSGN--DRRVIMWDIN 363
           ++  L +SPH  G+L + G   DR++ +W+IN
Sbjct: 595 AVKALAWSPHKRGILATGGGTADRKLKIWNIN 626

>Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON}
           (100800..102569) [1770 nt, 590 aa]
          Length = 589

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 98/205 (47%), Gaps = 20/205 (9%)

Query: 162 NTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTI 221
           +TD++A   G  ++F+ + SN     L  T    K+    LS+       L  G  +G +
Sbjct: 296 STDMLAVALGK-SIFLTDNSNGDVIHLCDT----KDEYTSLSW-VGAGSHLAVGQGNGLM 349

Query: 222 ALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTI 281
            ++D+     + KK ++   S H D V+   WN   +N+ +S S D  +   D R  +  
Sbjct: 350 EIYDV-----VKKKCIRTL-SGHTDRVSCLSWN---NNILSSGSRDRRILHRDVRIADPF 400

Query: 282 INSIKT-TDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEF 340
              I+T T     L ++     L A+ G D++V +YD  +++ P  +   H  ++  + +
Sbjct: 401 FAQIETHTQEVCGLKWNVEENKL-ASGGNDNIVCVYDGTSVT-PTLTFREHTAAVKAIGW 458

Query: 341 SPHTDGVLISSGN--DRRVIMWDIN 363
           SPH  G+L + G   DRR+ +W++N
Sbjct: 459 SPHKRGILATGGGTADRRLKIWNVN 483

>YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}
           UTP15Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 513

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/219 (28%), Positives = 103/219 (47%), Gaps = 20/219 (9%)

Query: 148 KHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPN 207
           K    +T   F PQ+    A +  S  V I++ S  +Q  +I T    K+  Y  SF  +
Sbjct: 37  KEHNSVTHISFNPQHPHDFA-VTSSTRVQIFS-SRTRQ--VIKTFSRFKDVVYSASFRSD 92

Query: 208 DKGKLLSGSD-DGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSE 266
             GKLL   D  G ++++D     T+    L I  S H   V   K++  ++ + A+ S+
Sbjct: 93  --GKLLCAGDATGLVSVYDSYNPRTIL---LSINASTHPTHVT--KFHTQDNKILATASD 145

Query: 267 DSTLQLHD-QREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNL-SVP 324
           D   +L D        +     TD   TL+F   + +L+A    D L+ LYD+R+  S P
Sbjct: 146 DRVTRLWDISNAYEPQLELTGATDYVRTLSFIPAAPHLVATGSYDGLIRLYDTRSSGSTP 205

Query: 325 LYSMNGHEDSITN-LEFSPHTDGVLISSGNDRRVIMWDI 362
           +YS+N H+  + N +  SP    ++   GN+ +V  WD+
Sbjct: 206 IYSLN-HDQPVENVIAVSP--TQIVSCGGNNFKV--WDL 239

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 68/165 (41%), Gaps = 16/165 (9%)

Query: 263 SVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS 322
           +V+  + +Q+   R +  I    +  D   + +F    + L A   T  LV +YDS N  
Sbjct: 56  AVTSSTRVQIFSSRTRQVIKTFSRFKDVVYSASFRSDGKLLCAGDAT-GLVSVYDSYNPR 114

Query: 323 VPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVI 382
             L S+N         +F    + +L ++ +DR   +WDI++             A E  
Sbjct: 115 TILLSINASTHPTHVTKFHTQDNKILATASDDRVTRLWDISN-------------AYEPQ 161

Query: 383 MIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW--KCSHKLPI 425
           +   G    V   S  P  P L+A+   + +I+++  + S   PI
Sbjct: 162 LELTGATDYVRTLSFIPAAPHLVATGSYDGLIRLYDTRSSGSTPI 206

>NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672
          Length = 431

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 112/251 (44%), Gaps = 52/251 (20%)

Query: 143 IVKKFKHEEEITRARFMPQNTDIIATINGSGTVF--IYNQSNDKQSALISTLRFHKE--- 197
           +++++K  +  +    M     I AT + +G++   +++ SND+     S +  H+E   
Sbjct: 46  VLQRYKSVQNESSTNQMESTQLIKATPSNTGSLVEKVFDSSNDQ-----SVMTRHRELIV 100

Query: 198 ---------------NGY-----GLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPL 237
                          NG+      +  +P D     +GS+D TI +WD      LAK  L
Sbjct: 101 QQPEWHAPWKLKRIINGHLGWVRSIEVDPVDNEWFATGSNDTTIKIWD------LAKGKL 154

Query: 238 KIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQ------REQNTIINSIKTTDPF 291
           K+  + H   V D   ++ +  +F S SED  ++  D       R+ +  ++ + + D  
Sbjct: 155 KVTLAGHIMTVRDIAISKRHPYLF-SASEDKLVKCWDLEKNMAIRDYHGHLSGVHSVDIH 213

Query: 292 NTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISS 351
            TL        L+A AG DS+V L+D R   V + ++ GH++ I  +   P  D  ++S 
Sbjct: 214 PTLD-------LIATAGRDSVVRLWDIR-ARVAVMTLIGHKNPINKVHCLP-VDPQIVSC 264

Query: 352 GNDRRVIMWDI 362
             D  + +WDI
Sbjct: 265 STDATIRLWDI 275

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 43/98 (43%), Gaps = 15/98 (15%)

Query: 328 MNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAG 387
           +NGH   + ++E  P  +    +  ND  + +WD+              G  +V +  AG
Sbjct: 115 INGHLGWVRSIEVDPVDNEWFATGSNDTTIKIWDL------------AKGKLKVTL--AG 160

Query: 388 HRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPI 425
           H   V D +I+   P+L  SA E+ +++ W     + I
Sbjct: 161 HIMTVRDIAISKRHPYLF-SASEDKLVKCWDLEKNMAI 197

>ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1147

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/259 (23%), Positives = 110/259 (42%), Gaps = 34/259 (13%)

Query: 136 KPRSNIKIVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFH 195
           KP SN       KH   IT   F PQ+ DI+AT +    V  ++  + ++    ++    
Sbjct: 100 KPSSNAIEHVLHKHFRAITDINFSPQHPDILATCSIDTYVHAWDLRSPQRPFYTTSGWLS 159

Query: 196 KENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNE 255
             +    SFN  +   +L+ +    + +WD+++ ST   K +      H   VN   +N 
Sbjct: 160 GASQVKWSFNDQN---VLASAHGNDVCIWDLRKGSTPLGKLVG-----HGSSVNSVDFNR 211

Query: 256 FNSNVFASVSEDSTLQLHD-QREQNTIINSIKTTDPF---NTLAFSK-----------HS 300
           F      + S D +++  D  +  N  I +I+T  P      L F +           +S
Sbjct: 212 FKRTELMTGSNDGSVKFWDYSKSCNEPIKTIRTDFPIWRGRYLPFGEGCCLMPSVGGFNS 271

Query: 301 QYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEF----SPHTDGV-----LISS 351
            Y+ + A  D +  + DS+    P+Y+  GH+D +T+  +    S  +DG      L++ 
Sbjct: 272 VYVASLAKRDGVEEVNDSK--LQPIYAFKGHDDRVTDFVWRSRSSCGSDGCDREFQLVTW 329

Query: 352 GNDRRVIMWDINDIGAEQI 370
             D  + +W + +   E+I
Sbjct: 330 SKDCDLRLWPVPETVYEKI 348

>YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}
           RSA4WD-repeat protein involved in ribosome biogenesis;
           may interact with ribosomes; required for maturation and
           efficient intra-nuclear transport or pre-60S ribosomal
           subunits, localizes to the nucleolus
          Length = 515

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 120/300 (40%), Gaps = 73/300 (24%)

Query: 164 DIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSF------NPNDKGKLLSGSD 217
           ++IAT +   T+ +++  + +   L   LR H +    LS+       P  K +L S S 
Sbjct: 199 EVIATGSMDNTIRLWDPKSGQ--CLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSK 256

Query: 218 DGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQRE 277
           DGTI +WD         +  +   S H + V+  KW      +  S S D T+++ D   
Sbjct: 257 DGTIKIWDT------VSRVCQYTMSGHTNSVSCVKWG--GQGLLYSGSHDRTVRVWDINS 308

Query: 278 QNTIINSIKTTDPF-NTLAFSK-------------------------------------- 298
           Q   IN +K+   + N L+ S                                       
Sbjct: 309 QGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALENYEKICKKNG 368

Query: 299 HSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDG-VLISSGNDRRV 357
           +S+ +M  A  D  ++L++    + P+  M GH+  + ++ FSP  DG  ++S+  D  +
Sbjct: 369 NSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSP--DGRYIVSASFDNSI 426

Query: 358 IMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
            +W            D  DG  + I    GH ++V   + + +   L+ S  ++  ++VW
Sbjct: 427 KLW------------DGRDG--KFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 471

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 88/171 (51%), Gaps = 17/171 (9%)

Query: 203 SFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFA 262
           +F P+   ++++G+ D T  +WD    + +    LK     H + V    W+  +  V A
Sbjct: 150 AFAPHTSSRMVTGAGDNTARIWDCDTQTPM--HTLK----GHYNWVLCVSWSP-DGEVIA 202

Query: 263 SVSEDSTLQLHDQREQNTIINSIK------TTDPFNTLAFSK-HSQYLMAAAGTDSLVYL 315
           + S D+T++L D +    + ++++      T+  +  +   K  S+  +A++  D  + +
Sbjct: 203 TGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKI 262

Query: 316 YDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIG 366
           +D+ +  V  Y+M+GH +S++ +++     G+L S  +DR V +WDIN  G
Sbjct: 263 WDTVS-RVCQYTMSGHTNSVSCVKWGGQ--GLLYSGSHDRTVRVWDINSQG 310

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 100/204 (49%), Gaps = 25/204 (12%)

Query: 187 ALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHND 246
           +L+ +  F  EN + L   P+ K  LL+G  +G I L D     +L  + +K  ++  ND
Sbjct: 5   SLVESNFFGSEN-WCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSL--QNIKASETAIND 61

Query: 247 I-VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIK--TTDPFNTLAFSKHSQYL 303
           + V D   ++F++    S +    +++ D R  N+ I +I+  +  PF +L  S+H   L
Sbjct: 62  LKVID---SDFSAGHLVSSASIDAVKVFDIR-TNSCIATIQNESNSPFLSLD-SRHG--L 114

Query: 304 MAAA----GTDSLVYLYDSRNLSVPLYSM-NGHEDSITNLEFSPHTDGVLISSGNDRRVI 358
           +A      G D+ V++YD R    PL S+ + H D +T ++F P    +L+S   D    
Sbjct: 115 LACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTN 174

Query: 359 MWDINDIGAEQIPDDAEDGAPEVI 382
           ++D+         D+ ED   +VI
Sbjct: 175 IYDLKQ-------DEEEDALHQVI 191

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 42/196 (21%), Positives = 81/196 (41%), Gaps = 38/196 (19%)

Query: 188 LISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI 247
           L S +  H ++   + F+P+D   LLSGS DG   ++D++++           D++H  I
Sbjct: 140 LRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEE--------DALHQVI 191

Query: 248 ----VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQY- 302
               ++ C W   +     ++S   T  +H+  +++  +   +  D F  +  +    Y 
Sbjct: 192 NYASIHSCGW--LSPKRIYTLSHMETFAIHELNDKSDELREPQPLD-FGDVRKAWDCDYV 248

Query: 303 ------LMAA------AGTDSLV-----YLYDSRNLSVPLYSMNGHEDSIT-NLEFSPHT 344
                 L+A       AG   L+      +Y  +   +P    + H D +  ++  S H 
Sbjct: 249 VDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIP----HAHGDEVVRDIFISAHQ 304

Query: 345 DGVLISSGNDRRVIMW 360
             +L S G D  V +W
Sbjct: 305 SDMLYSCGEDGYVKIW 320

>Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093W
           (REAL)
          Length = 513

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 103/219 (47%), Gaps = 20/219 (9%)

Query: 148 KHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPN 207
           K    +T   F PQ+    A +  S  V I++ S  +Q  +I T    K+  Y  SF  +
Sbjct: 37  KEHNSVTHISFNPQHPHDFA-VTSSTRVQIFS-SRTRQ--VIKTFSRFKDVVYSASFRSD 92

Query: 208 DKGKLLSGSD-DGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSE 266
             GKLL   D  G ++++D     T+    L +  S H   V   K++  +S + A+ S+
Sbjct: 93  --GKLLCAGDATGLVSVYDSYNPRTIL---LSMNASTHPTHVT--KFHTQDSKILATASD 145

Query: 267 DSTLQLHD-QREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNL-SVP 324
           D   +L D        +     TD   TL+F   + +L+A    D LV LYD+R+  S P
Sbjct: 146 DRVTRLWDISNAYEPQLELTGATDYVRTLSFIPAAPHLIATGSYDGLVRLYDTRSSGSTP 205

Query: 325 LYSMNGHEDSITN-LEFSPHTDGVLISSGNDRRVIMWDI 362
           +YS+N H+  I N +  SP    ++   G++ +V  WD+
Sbjct: 206 IYSLN-HDQPIENVIAVSP--TQIVSCGGSNFKV--WDL 239

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 67/165 (40%), Gaps = 16/165 (9%)

Query: 263 SVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS 322
           +V+  + +Q+   R +  I    +  D   + +F    + L A   T  LV +YDS N  
Sbjct: 56  AVTSSTRVQIFSSRTRQVIKTFSRFKDVVYSASFRSDGKLLCAGDAT-GLVSVYDSYNPR 114

Query: 323 VPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVI 382
             L SMN         +F      +L ++ +DR   +WDI++             A E  
Sbjct: 115 TILLSMNASTHPTHVTKFHTQDSKILATASDDRVTRLWDISN-------------AYEPQ 161

Query: 383 MIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW--KCSHKLPI 425
           +   G    V   S  P  P L+A+   + +++++  + S   PI
Sbjct: 162 LELTGATDYVRTLSFIPAAPHLIATGSYDGLVRLYDTRSSGSTPI 206

>TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/252 (24%), Positives = 108/252 (42%), Gaps = 43/252 (17%)

Query: 188 LISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI 247
           L  TL  H      L+ +      L+S S D T+  W +  +      P++ +   HN I
Sbjct: 8   LRGTLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQQYGVPVRSFKG-HNHI 66

Query: 248 VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAA 307
           V DC      +    S S D TL+L +          + T + +    F+ H   +M+ A
Sbjct: 67  VQDCALTADGAYAL-SASWDKTLRLWN----------VATGETYQR--FTGHKSDVMSVA 113

Query: 308 -GTDSLVYLYDSRNLSVPLYSMNG--------HEDSITNLEFSPHT----DGV-LISSGN 353
               + + +  SR+ ++ ++S+ G        H D ++ +  +P+     D V LIS+G+
Sbjct: 114 IDRKASMIISGSRDKTIKVWSIKGDCLATLLGHNDWVSQVRVAPNEKQEDDNVTLISAGS 173

Query: 354 DRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENI 413
           D+ V  W+IN     QI  D             GH + +N  + +P+   L+ASA ++  
Sbjct: 174 DKMVKAWNINQF---QIEAD-----------FVGHNNYINSITASPDGS-LVASAGKDGD 218

Query: 414 IQVWKCSHKLPI 425
           I +W    K P+
Sbjct: 219 IMLWNLKQKTPL 230

>NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {ON}
           Anc_5.429 YDR364C
          Length = 448

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 86/193 (44%), Gaps = 17/193 (8%)

Query: 195 HKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWN 254
           H      L+F PN    LLSG +D  + +WD      L    L+ +   H+  +N   +N
Sbjct: 154 HTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYHKRNL----LRDYKG-HSKAINSLDFN 208

Query: 255 EFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVY 314
           +  +N F S S D T+++ D  EQ  +   +      N + F   +         +S +Y
Sbjct: 209 DDGTN-FISSSFDHTIKIWDT-EQGKVKTKLHFKSTPNDVKFRPFNSSEFIVGFANSKIY 266

Query: 315 LYDSR----NLSVPLYSMNGHEDSITNLEFSPHTDGV-LISSGNDRRVIMWDIN-DIGAE 368
            YD+R    +  V +Y  + H  SI  L+F P  DG   ISS  D+ V +WD   ++  +
Sbjct: 267 HYDTRISENDGRVQVY--DHHMSSILALKFFP--DGSKFISSSEDKTVRIWDNQVNVPIK 322

Query: 369 QIPDDAEDGAPEV 381
           QI D  +   P +
Sbjct: 323 QISDTTQYSMPSI 335

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 45/92 (48%), Gaps = 14/92 (15%)

Query: 326 YSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIH 385
           Y+M+GH +  T+L F P++  +L+S GND  V +WD                   ++  +
Sbjct: 149 YAMDGHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYH-------------KRNLLRDY 195

Query: 386 AGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
            GH  A+N    N +    ++S+  ++ I++W
Sbjct: 196 KGHSKAINSLDFNDDGTNFISSS-FDHTIKIW 226

>TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7.310
           YDL195W
          Length = 1265

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 120/308 (38%), Gaps = 84/308 (27%)

Query: 170 NGSGTVFIYNQSND--KQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQ 227
           NGS  +F +NQ ND  + + LI   R H      ++FNP     LLSG + G I      
Sbjct: 83  NGSIEIFKFNQENDSIQSNELIKNNR-HTGPIRSITFNPRQDNLLLSGGE-GII------ 134

Query: 228 ENSTLAKKPLKIWDSVHN------------------------------DIVNDCKWNEFN 257
            NS+ + K L   +++ N                              + ++   WN+  
Sbjct: 135 -NSSNSAKTLPTINNIQNTTSEIFIYDLNDVDNPETLPMSPNMTMNRFETISSLAWNKSL 193

Query: 258 SNVFASVSEDSTLQLHDQREQNTIIN--------------SIKTTDPFNTLAFSKH---- 299
           S+VF++    S + + D + +  +IN              S+    P N+   +      
Sbjct: 194 SHVFSAAGNTSAVSIFDLKAKKEVINLNYINPTTGMKEIFSVVEWHPKNSTRIATATSNN 253

Query: 300 -SQYLMAAAGTDSLVYLYDSRNLSVPLYSMN----------GHEDSITNLEFSPHTDGVL 348
            S  L A A     +Y++D RN + PL  ++          GH D I +L++    +  L
Sbjct: 254 ISNPLNATANAGDSIYIWDLRNSNAPLQILSPQQFENNTIVGHTDGIQSLDWCAQDETFL 313

Query: 349 ISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASA 408
           +SSG D  +++W+         PD    G P        +    + F+  PN P + ASA
Sbjct: 314 LSSGRDNSIMLWN---------PD---SGLPLTKYPKRNNWCFKSKFA--PNFPEIFASA 359

Query: 409 EEENIIQV 416
             +  I+V
Sbjct: 360 SLDGKIEV 367

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/257 (23%), Positives = 115/257 (44%), Gaps = 50/257 (19%)

Query: 188 LISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI 247
           ++ TL+ H+++ Y L + P    KL+SGS D T+ +WD++         L I D V    
Sbjct: 403 ILMTLQGHEQDIYSLDYFPAGD-KLVSGSGDRTVRIWDLRTGQ--CSLTLSIEDGVTTVA 459

Query: 248 VN--DCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNT--------LAFS 297
           V+  D K+        A+ S D T+++ D  E   ++  + + +  +T        + F+
Sbjct: 460 VSPGDGKY-------IAAGSLDRTVRVWDS-ETGFLVERLDSENELSTGHKDSVYSVVFT 511

Query: 298 KHSQYLMAAAGTDSLVYLYDSRNL------SVPLYSMNGHEDSITNLEFSPHTDGVLISS 351
           +  + +++ +  D  V L+D R L      +    +  GH+D + ++  +   D  ++S 
Sbjct: 512 RDGRSVVSGS-LDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATT-QDDEYILSG 569

Query: 352 GNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHR------SAVNDFSINPNIPWLM 405
             DR V+ W            D   G P  +++  GHR      + VN F + P+I  + 
Sbjct: 570 SKDRGVLFW------------DTASGNP--LLMLQGHRNSVISVAVVNGFPLGPDI-GVF 614

Query: 406 ASAEEENIIQVWKCSHK 422
           A+   +   ++WK + K
Sbjct: 615 ATGSGDCKARIWKYTKK 631

>Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 75/168 (44%), Gaps = 17/168 (10%)

Query: 218 DGTIALWDI---QENSTLAKKPLKI--WD----------SVHNDIVNDCKWNEFNSNVFA 262
           DG  A   I   +ENST A    KI  WD          S   D +   ++N+  +++ A
Sbjct: 177 DGESAFQGIDSHRENSTFATGGAKIHLWDVNRLKPISNLSWGADNITSVRFNQNETDILA 236

Query: 263 SVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS 322
           S   D+++ L+D R  N+    I  T   N + ++    +    A  D   Y YD RNLS
Sbjct: 237 STGSDNSIVLYDLR-TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLS 295

Query: 323 VPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQI 370
             L     H  ++ +++FSP  D ++  S  D+ + M+  N   + +I
Sbjct: 296 RSLTVFKDHVSAVMDVDFSPTGDEIVTGS-YDKSIRMYKTNHGHSREI 342

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 87/186 (46%), Gaps = 20/186 (10%)

Query: 195 HKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQEN----STLAKKPLKIWDSVHNDIVND 250
           H++  Y ++ N     KL +GS DG I  W++       S  A   L     V     +D
Sbjct: 66  HRDGIYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLITGLCVTQPHFHD 125

Query: 251 CKWNEFNSNVFASVSEDSTLQL--------HDQR--EQNTIINS---IKTTDPFNTL-AF 296
            K +  N N   S S+D T++L         ++R  + +++ N    ++T D  +     
Sbjct: 126 KKSDWKNQNFMLSCSDDKTVKLWSINVDDYSNKRSSDNDSVTNEEGLVRTFDGESAFQGI 185

Query: 297 SKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRR 356
             H +    A G  + ++L+D   L  P+ +++   D+IT++ F+ +   +L S+G+D  
Sbjct: 186 DSHRENSTFATG-GAKIHLWDVNRLK-PISNLSWGADNITSVRFNQNETDILASTGSDNS 243

Query: 357 VIMWDI 362
           ++++D+
Sbjct: 244 IVLYDL 249

>Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 88/171 (51%), Gaps = 17/171 (9%)

Query: 203 SFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFA 262
           +F P+   ++++G+ D T  +WD    + +    LK     H + V    W+  +  V A
Sbjct: 150 AFAPHTSSRMVTGAGDNTARIWDCDTQTPM--HTLK----GHYNWVLCVSWSP-DGEVIA 202

Query: 263 SVSEDSTLQLHDQREQNTIINSIK------TTDPFNTLAFSK-HSQYLMAAAGTDSLVYL 315
           + S D+T++L D +    + ++++      T+  +  +   K  S+  +A++  D  + +
Sbjct: 203 TGSMDNTIRLWDPKTGECLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKI 262

Query: 316 YDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIG 366
           +D+ +  V  Y+M+GH +S++ +++     G+L S  +DR V +WDIN  G
Sbjct: 263 WDTVS-RVCQYTMSGHTNSVSCVKWGGQ--GLLYSGSHDRTVRVWDINSQG 310

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 119/300 (39%), Gaps = 73/300 (24%)

Query: 164 DIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSF------NPNDKGKLLSGSD 217
           ++IAT +   T+ +++    +   L   LR H +    LS+       P  K +L S S 
Sbjct: 199 EVIATGSMDNTIRLWDPKTGE--CLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSK 256

Query: 218 DGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQRE 277
           DGTI +WD         +  +   S H + V+  KW      +  S S D T+++ D   
Sbjct: 257 DGTIKIWDT------VSRVCQYTMSGHTNSVSCVKWG--GQGLLYSGSHDRTVRVWDINS 308

Query: 278 QNTIINSIKTTDPF-NTLAFSK-------------------------------------- 298
           Q   IN +K+   + N L+ S                                       
Sbjct: 309 QGRCINILKSHAHWVNHLSLSTDYALRVGAFDHTGKRPSTPEDAQKKALENYEKICKKNG 368

Query: 299 HSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDG-VLISSGNDRRV 357
           +S+ +M  A  D  ++L++    + P+  M GH+  + ++ FSP  DG  ++S+  D  +
Sbjct: 369 NSEEMMVTASDDFTMFLWNPLKSTKPVARMTGHQKLVNHVAFSP--DGRYIVSASFDNSI 426

Query: 358 IMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
            +W            D  DG  + I    GH ++V   + + +   L+ S  ++  ++VW
Sbjct: 427 KLW------------DGRDG--KFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 471

>KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1321

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 81/203 (39%), Gaps = 29/203 (14%)

Query: 164 DIIATINGSGTVFIY--NQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTI 221
           + +A    S TV ++  N++N   SAL+S+L  H  +     FN      L+SG  DG +
Sbjct: 205 NYVAVCTNSTTVSLFDINRANQTDSALVSSLAEHTRSVNSFDFNMMQTNLLISGGQDGCV 264

Query: 222 ALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTI 281
            +WDI+ N+     P K        IVN C     N+  F S+ +   +  +     N  
Sbjct: 265 KIWDIRTNN-----PTK--------IVNTCDV-RINT-TFGSIRDIKWMPGY-----NFS 304

Query: 282 INSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFS 341
            N    TD         H  Y  A+      +  +D R  + P   +N H      L + 
Sbjct: 305 GNDRNYTD------LRSHGGYKFASIHDSGALLKFDMRQPNQPEKRINAHTGPGLCLNWH 358

Query: 342 PHTDGVLISSGNDRRVIMWDIND 364
           PH D  + S G D +  +W   D
Sbjct: 359 PHQD-YIASGGRDGKCCLWYFGD 380

>KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {ON}
           Anc_3.259 YDR030C
          Length = 369

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/221 (23%), Positives = 95/221 (42%), Gaps = 29/221 (13%)

Query: 207 NDKGKLLSGSDDGTIALWDIQE--------NSTLAKKPLKIWDSVHNDIVNDCKWNEFNS 258
           NDK   L+G+++GT++LW++          N+ LA+   K     H   +ND KW   + 
Sbjct: 59  NDKTSFLAGNNNGTVSLWNLDNTLSTSHILNNKLARTSTK--PHSHLFGINDMKWYSIDD 116

Query: 259 NVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDS 318
            +F +   D  ++L D    N  IN        N       +Q+++     D    L D 
Sbjct: 117 GMFFTCGNDKFVKLWD---TNKFINVQDLEFNSNLFQMDTANQFILVTLD-DYYPRLIDL 172

Query: 319 RNLSVPLYSMNGHEDSIT-NLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDG 377
           RN+++ +     H +S T   + +P  D ++ SS ND  + +WD+  +    I +     
Sbjct: 173 RNMNLGITIFGKHLNSKTLCCKINPVRDNLIASSDNDGMIRIWDVR-MNYRSIEE----- 226

Query: 378 APEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
                     H  ++ND   N N   L+++  +   IQ+W+
Sbjct: 227 -------WKAHSRSINDMVWNDNGTKLISTGVDGK-IQIWR 259

>YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}
           SOF1Essential protein required for biogenesis of 40S
           (small) ribosomal subunit; has similarity to the beta
           subunit of trimeric G-proteins and the splicing factor
           Prp4p
          Length = 489

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 74/168 (44%), Gaps = 17/168 (10%)

Query: 218 DGTIALWDI---QENSTLAKKPLKI--WDSVHNDIVNDCKWN-------EFNSN---VFA 262
           DG  A   I   +ENST A    KI  WD      V+D  W        +FN N   + A
Sbjct: 177 DGESAFQGIDSHRENSTFATGGAKIHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILA 236

Query: 263 SVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS 322
           S   D+++ L+D R  N+    I  T   N + ++    +    A  D   Y YD RNLS
Sbjct: 237 STGSDNSIVLYDLR-TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLS 295

Query: 323 VPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQI 370
             L     H  ++ +++FSP  D ++  S  D+ + ++  N   + +I
Sbjct: 296 RSLNVFKDHVSAVMDVDFSPTGDEIVTGS-YDKSIRIYKTNHGHSREI 342

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 85/186 (45%), Gaps = 20/186 (10%)

Query: 195 HKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQEN----STLAKKPLKIWDSVHNDIVND 250
           H++  Y ++ N     KL +GS DG I  W++       S  A   L     V     +D
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQPRFHD 125

Query: 251 CKWNEFNSNVFASVSEDSTLQL----------HDQREQNTIINS---IKTTDPFNTL-AF 296
            K +  + N   S S+D T++L           +  + +++ N    I+T D  +     
Sbjct: 126 KKPDLKSQNFMLSCSDDKTVKLWSINVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGI 185

Query: 297 SKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRR 356
             H +    A G  + ++L+D   L  P+  ++   D+IT+L+F+ +   +L S+G+D  
Sbjct: 186 DSHRENSTFATGG-AKIHLWDVNRLK-PVSDLSWGADNITSLKFNQNETDILASTGSDNS 243

Query: 357 VIMWDI 362
           ++++D+
Sbjct: 244 IVLYDL 249

>TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 94/218 (43%), Gaps = 18/218 (8%)

Query: 149 HEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPND 208
           HE  +   RF P     IA+ +   T  +++   + +  L      H +  + L+F  +D
Sbjct: 264 HERRVAGCRFHPFGR-YIASASFDNTWRLWDAETNHELLLQEG---HGKEVFCLAFQ-SD 318

Query: 209 KGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDS 268
              L S   D T  +WDI+  +        +  S H   +    W+     V A+ S D 
Sbjct: 319 GSLLCSAGLDCTGMIWDIRSGNC------AMVLSGHTKPIYSVDWSPRGFEV-ATASGDG 371

Query: 269 TLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLY--DSRNLSVPLY 326
           T+ + D R+ N     +      + + F KH+   + + G D  + +Y  DS N    + 
Sbjct: 372 TVNIWDIRKTNQPQVLLAHNSIVSGIRFEKHNGKFLMSCGYDKNINVYSGDSWN---KIT 428

Query: 327 SMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIND 364
            + GH D I  L+   H DG ++S+G DR V  W++++
Sbjct: 429 ILKGHTDKILALDLGTH-DGSVVSAGWDRSVKSWNVDN 465

>SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {ON}
           similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198C TAF5 Subunit (90 kDa) of TFIID and SAGA
           complexes involved in RNA polymerase II transcription
           initiation and in chromatin modification
          Length = 749

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/237 (22%), Positives = 97/237 (40%), Gaps = 27/237 (11%)

Query: 189 ISTLRFHKENGYGLSFNPNDKGKLLS-GSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI 247
           +    FH  N        +D   L + G  D  I LW +      +K P K  + ++N  
Sbjct: 412 VCMYTFHNTNRDMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTT 471

Query: 248 VNDCKWNEFNSNV------FASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQ 301
           +       ++++         S SED T++L      +++++      P   ++FS    
Sbjct: 472 LIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGH 531

Query: 302 YLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGN-DRRVIMW 360
           Y  A A  D    L+   ++  PL    GH + +  + F  H +G  + +G+ D+   MW
Sbjct: 532 YF-ATASHDQTARLWSCDHI-YPLRIFAGHLNDVDCVSF--HPNGTYVFTGSTDKTCRMW 587

Query: 361 DINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
           DI              G  + + +  GH + V   +++P+  WL ++  E+ II VW
Sbjct: 588 DI--------------GTGDSVRLFLGHTAPVISTAVSPDGRWL-STGSEDGIINVW 629

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 88/217 (40%), Gaps = 44/217 (20%)

Query: 190 STLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKK-------------- 235
           +TL  H    Y  SF+P++K  LLS S+D T+ LW +   S+L                 
Sbjct: 470 TTLIGHSGTVYSTSFSPDNK-YLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSP 528

Query: 236 -----------------------PLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQL 272
                                  PL+I+    ND+  DC     N     + S D T ++
Sbjct: 529 LGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDV--DCVSFHPNGTYVFTGSTDKTCRM 586

Query: 273 HDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGH- 331
            D    +++   +  T P  + A S   ++L +    D ++ ++D       L  M GH 
Sbjct: 587 WDIGTGDSVRLFLGHTAPVISTAVSPDGRWL-STGSEDGIINVWDI-GTGKRLKQMRGHG 644

Query: 332 EDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAE 368
           ++++ +L +S     VL+S G D  V +WD+    AE
Sbjct: 645 KNAVYSLSYSKE-GTVLVSGGADHSVRVWDLKRSTAE 680

 Score = 37.7 bits (86), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 43/96 (44%), Gaps = 16/96 (16%)

Query: 330 GHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHR 389
           GH  ++ +  FSP  +  L+S+  D+ V +W ++   +              ++ + GH 
Sbjct: 474 GHSGTVYSTSFSPD-NKYLLSASEDKTVRLWSMDTYSS--------------LVSYKGHN 518

Query: 390 SAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPI 425
             V D S +P +    A+A  +   ++W C H  P+
Sbjct: 519 HPVWDVSFSP-LGHYFATASHDQTARLWSCDHIYPL 553

>SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]
           {ON} highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 476

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 80/179 (44%), Gaps = 14/179 (7%)

Query: 194 FHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLK--IWDSVHNDIVNDC 251
           FH E  +    +   K   ++G     I LWD     T   KP+    W +   D V   
Sbjct: 170 FHGEYAFQSIDHHRTKSTFVTGG--AQIELWD-----TGRSKPVSNLSWGA---DNVTSV 219

Query: 252 KWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDS 311
           K+N+  +++ AS   D+++ L+D R  N+    I  T   N + ++    +    A  D 
Sbjct: 220 KFNQNETDILASTGSDNSVVLYDLR-TNSPTQKIVQTMRTNAICWNPMEAFNFVIANEDH 278

Query: 312 LVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQI 370
             Y YD RN+S  L     H  ++ +++FSP  D ++  S  D+ V ++ +N   + +I
Sbjct: 279 NAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDEIVTGS-YDKTVRIYQVNHGHSREI 336

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 36/184 (19%), Positives = 79/184 (42%), Gaps = 22/184 (11%)

Query: 195 HKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWN 254
           H++  Y ++ N +   KL + S DG +  W++       ++ L  + + +  +   C   
Sbjct: 66  HRDGVYVVAKNYHALNKLATASGDGVVKYWNMS-----TREELCSFKAHYGLVTGLCVTP 120

Query: 255 EF-----NSNVFASVSEDSTLQL-----------HDQREQNTIINSIKTTDPFNTLAFSK 298
           +      N N   S  +D  ++L            D  E NT    +KT           
Sbjct: 121 QHLSKNKNENYMLSCGDDKMIKLWSVNSDDFSSTRDNDELNTGDGLLKTFHGEYAFQSID 180

Query: 299 HSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVI 358
           H +         + + L+D+   S P+ +++   D++T+++F+ +   +L S+G+D  V+
Sbjct: 181 HHRTKSTFVTGGAQIELWDT-GRSKPVSNLSWGADNVTSVKFNQNETDILASTGSDNSVV 239

Query: 359 MWDI 362
           ++D+
Sbjct: 240 LYDL 243

>ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL317W (PFS2)
          Length = 449

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 52/230 (22%), Positives = 105/230 (45%), Gaps = 17/230 (7%)

Query: 136 KPRSNIKIVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFH 195
           +P  N+  V    H E +    F   +   + T +    + I+N SN +Q  ++S    H
Sbjct: 149 QPNFNMVKVLDRAHTECMRDISFSYSDQKFV-TCSDDNVLKIWNFSNGQQERVLSG---H 204

Query: 196 KENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNE 255
             +     ++P   G ++SGS D  I LWD +    ++     I    H  I    K+  
Sbjct: 205 HWDVKSCDWHPK-MGLIVSGSKDNLIKLWDPRTGRNVST----ILGLKHTVI--KTKFQP 257

Query: 256 FNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLV-- 313
              N+ A VS+D +++++D R+    + +I+    + +L++   ++ + +    +  +  
Sbjct: 258 TQGNLLAVVSKDKSIKIYDMRQHMRELQTIRDDMDYMSLSWHPINETIFSVGCYNGAIKH 317

Query: 314 --YLYDSRNLSVPLYSM-NGHEDSITNLEFSPHTDGVLISSGNDRRVIMW 360
              L+D+ N +   +++   HE S+T+L +SP    +L S+  DR +  W
Sbjct: 318 FDLLHDNSNSTPACHTIPYAHEKSVTSLAYSP-VGHILASAAKDRTIRFW 366

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 75/160 (46%), Gaps = 27/160 (16%)

Query: 212 LLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQ 271
           L+SG  DGTI +W  Q N  +    +K+ D  H + + D  ++ ++   F + S+D+ L+
Sbjct: 136 LISGDADGTIKIW--QPNFNM----VKVLDRAHTECMRDISFS-YSDQKFVTCSDDNVLK 188

Query: 272 L--HDQREQNTIINS----IKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYD---SRNLS 322
           +      +Q  +++     +K+ D    +        L+ +   D+L+ L+D    RN+S
Sbjct: 189 IWNFSNGQQERVLSGHHWDVKSCDWHPKMG-------LIVSGSKDNLIKLWDPRTGRNVS 241

Query: 323 VPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDI 362
             L    G + ++   +F P    +L     D+ + ++D+
Sbjct: 242 TIL----GLKHTVIKTKFQPTQGNLLAVVSKDKSIKIYDM 277

>KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 372

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 61/256 (23%), Positives = 115/256 (44%), Gaps = 45/256 (17%)

Query: 171 GSGTVFIYNQSNDKQSALISTLRFHKENG-YGLSFNPNDKGKLLSGSDDGTIALWDIQEN 229
           G+G + I +   + Q  L+ +  F  ++G + L++N + + + L    DG++ L+DI+  
Sbjct: 36  GNGKLIILDIMPNGQ--LVESNSFLTQDGLFDLAWNESHENQCLVAQGDGSLRLFDIK-- 91

Query: 230 STLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHD-QREQNTIINSIKTT 288
             L   P+ I+   H   V  C WN     +F S S D  ++L    R Q     S+ T 
Sbjct: 92  --LKDYPIAIYKE-HQREVFSCNWNMIQKQMFVSSSWDGKVKLWSLMRPQ-----SLMTM 143

Query: 289 DPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSM------NGHEDSITNLEFSP 342
            P +T A S  S+    A              + VP+ +       +G+++ I    FSP
Sbjct: 144 SPNDTNAASTLSRTSAVAP-------------VRVPMSNQKEHQHADGNKECIYQATFSP 190

Query: 343 HTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPE-VIMIHAGHRSAVNDFSINPNI 401
           H   +++ S  +  + ++D+      ++P+   +G P+   + H G  +   DF  N   
Sbjct: 191 HDPNLVLCSSGNSFISLYDL------RVPN---NGLPQHQFLGHGGFEALTCDF--NKYR 239

Query: 402 PWLMASAEEENIIQVW 417
           P ++A+   + +I+VW
Sbjct: 240 PHIIATGGVDKMIKVW 255

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/219 (21%), Positives = 92/219 (42%), Gaps = 41/219 (18%)

Query: 189 ISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALW--------------DIQENSTLAK 234
           I+  + H+   +  ++N   K   +S S DG + LW              D    STL++
Sbjct: 97  IAIYKEHQREVFSCNWNMIQKQMFVSSSWDGKVKLWSLMRPQSLMTMSPNDTNAASTLSR 156

Query: 235 ----KPLKI-----WDSVHNDIVNDCKWNEFNS----NVFASVSEDSTLQLHDQREQNTI 281
                P+++      +  H D   +C +    S    N+    S +S + L+D R  N  
Sbjct: 157 TSAVAPVRVPMSNQKEHQHADGNKECIYQATFSPHDPNLVLCSSGNSFISLYDLRVPNNG 216

Query: 282 I--NSIKTTDPFNTLA--FSKHSQYLMAAAGTDSLVYLYDSRNLS---------VPLYSM 328
           +  +       F  L   F+K+  +++A  G D ++ ++D R            + +  +
Sbjct: 217 LPQHQFLGHGGFEALTCDFNKYRPHIIATGGVDKMIKVWDLRMCRKMLSQGHQPININEI 276

Query: 329 NGHEDSITNLEFSPHTDGVLISSGNDRRVIMW-DINDIG 366
            GHE ++  + +SPH   +L+S+  D    +W D++D G
Sbjct: 277 QGHELAVRKVTWSPHHSNMLLSTSYDMTCRVWTDLSDDG 315

>SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {ON}
           similar to uniprot|P40968 Saccharomyces cerevisiae
           YDR364C CDC40 Pre-mRNA splicing factor important for
           catalytic step II of pre-mRNA splicing and plays a role
           in cell cycle progression required for DNA synthesis
           during mitosis and meiosis has WD repeats
          Length = 471

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 94/204 (46%), Gaps = 18/204 (8%)

Query: 188 LISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI 247
           +I T + H      L F P      LSG +D  I +WD+    TL +         H   
Sbjct: 170 IIYTFKGHVNGTTKLKFLPETGHLFLSGGNDNVINIWDMYHERTLLRDYRG-----HRKA 224

Query: 248 VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAF--SKHSQYLMA 305
           V D  +N  +   F SVS D TL++ D  E   + + +K     N   +  + +++Y++ 
Sbjct: 225 VRDINFNS-DGTEFLSVSFDQTLKVWDT-ETGKVKSRLKWHSVPNCATYHPTNNNEYIVG 282

Query: 306 AAGTDSLVYLYDSR--NLSVPLYSMNGHEDSITNLEFSPHTDGV-LISSGNDRRVIMWDI 362
            +  +S +  YDSR  N    + + N H  SI +L++ P  DG   ISS  D+ V +W+ 
Sbjct: 283 LS--NSEIRHYDSRVSNKEGLIQTYNHHLSSIISLKYFP--DGSKFISSSEDKTVRIWEN 338

Query: 363 N-DIGAEQIPDDAEDGAPEVIMIH 385
             +I  +QI D ++   P  + IH
Sbjct: 339 QVNIPIKQISDTSQYSMP-YLEIH 361

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 42/93 (45%), Gaps = 14/93 (15%)

Query: 325 LYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMI 384
           +Y+  GH +  T L+F P T  + +S GND  + +WD+                  ++  
Sbjct: 171 IYTFKGHVNGTTKLKFLPETGHLFLSGGNDNVINIWDMYH-------------ERTLLRD 217

Query: 385 HAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
           + GHR AV D + N +    + S   +  ++VW
Sbjct: 218 YRGHRKAVRDINFNSDGTEFL-SVSFDQTLKVW 249

>AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,
           334 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YMR116C (ASC1); 1-intron
          Length = 334

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 61/249 (24%), Positives = 107/249 (42%), Gaps = 24/249 (9%)

Query: 181 SNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIW 240
           S D+   L  TL  H      LS +P     LLSGS D T+  W +         P++ +
Sbjct: 18  STDEILVLRGTLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSF 77

Query: 241 DSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHS 300
              H+ IV DC     +     S S D TL+L D +    I   +       +++    +
Sbjct: 78  KG-HSHIVQDCT-VTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRA 135

Query: 301 QYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHT---DGV-LISSGNDRR 356
             +++A+  D  V ++++    V   ++ GH D ++N+  +P     D V +IS+G D+ 
Sbjct: 136 TQIVSAS-RDKTVKVWNTVGDCV--VTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKV 192

Query: 357 VIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQV 416
           V +WD+     E           + I    GH + V   + +P+   + ASA ++  I +
Sbjct: 193 VKVWDLQSFTIE----------ADFI----GHNNYVTTVTPSPDGS-IFASAGKDGQIIL 237

Query: 417 WKCSHKLPI 425
           W  + K  +
Sbjct: 238 WNLNEKTAL 246

>Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 75/168 (44%), Gaps = 17/168 (10%)

Query: 218 DGTIALWDI---QENSTLAKKPLKI--WD----------SVHNDIVNDCKWNEFNSNVFA 262
           DG  A   I   +ENST A    KI  WD          S   D +   K+N+  +++ A
Sbjct: 177 DGESAFQGIDSHRENSTFATGGAKIHLWDVNRLKPVSNLSWGADNITSVKFNQSETDILA 236

Query: 263 SVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS 322
           S   D+++ L+D R  N+    I  T   N + ++    +    A  D   Y YD RNLS
Sbjct: 237 STGSDNSIVLYDLR-TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLS 295

Query: 323 VPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQI 370
             L     H  ++ +++FSP  D ++  S  D+ + ++  N   + +I
Sbjct: 296 RSLNVFKDHVSAVMDVDFSPTGDEIVTGS-YDKSIRIYKTNHGHSREI 342

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 84/186 (45%), Gaps = 20/186 (10%)

Query: 195 HKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQEN----STLAKKPLKIWDSVHNDIVND 250
           H++  Y ++ N     KL +GS DG I  W++       S  A   L     V     +D
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLITGLCVTQPRFHD 125

Query: 251 CKWNEFNSNVFASVSEDSTLQL----------HDQREQNTIINS---IKTTDPFNTL-AF 296
            K +  N N   S S+D T++L              + +++ N    ++T D  +     
Sbjct: 126 KKPDLKNQNFMLSCSDDKTVKLWSINVDDFSNKSSSDNDSVTNEEGLVRTFDGESAFQGI 185

Query: 297 SKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRR 356
             H +    A G  + ++L+D   L  P+ +++   D+IT+++F+     +L S+G+D  
Sbjct: 186 DSHRENSTFATG-GAKIHLWDVNRLK-PVSNLSWGADNITSVKFNQSETDILASTGSDNS 243

Query: 357 VIMWDI 362
           ++++D+
Sbjct: 244 IVLYDL 249

>NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 92/229 (40%), Gaps = 70/229 (30%)

Query: 190 STLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVN 249
           +TL  H    Y  SF+P++K  L+SGS+D T+ LW +  N+TL      +    HN  V 
Sbjct: 580 TTLIGHSGAVYSTSFSPDNK-YLISGSEDKTVRLWSLDTNTTL------VSYKGHNHPVW 632

Query: 250 DCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGT 309
           D K++    + FA+ S D T +L                                     
Sbjct: 633 DVKFSPL-GHYFATASHDQTARLW------------------------------------ 655

Query: 310 DSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSG-NDRRVIMWDINDIGAE 368
            S  ++Y       PL    GH   +  + F  H +G  + +G +D+   MWD++     
Sbjct: 656 -SCDHIY-------PLRIFAGHLSDVDCVSF--HPNGCYVFTGSSDKTCRMWDVS----- 700

Query: 369 QIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
                      + + +  GH + V   +++P+  WL ++  E+ II VW
Sbjct: 701 ---------TGDSVRLFLGHTAPVISTAVSPDGRWL-STGSEDGIINVW 739

>Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa]
           {ON} similar to Ashbya gossypii AFR199C
          Length = 318

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 107/243 (44%), Gaps = 26/243 (10%)

Query: 188 LISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI 247
           L  TL  H      L+ +P     LLS S D T+  W +         P+K +   H+ I
Sbjct: 9   LRGTLEGHNGWVTSLATSPAQPNMLLSASRDKTLITWRLTGEDQQYGVPVKSFKG-HSHI 67

Query: 248 VNDCKWNEFNSNVFA-SVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAA 306
           + DC     N   +A S S D TL+L D     ++I  +       +++    +  +++A
Sbjct: 68  IQDC--TVTNDGKYALSASWDKTLRLWDLASGESLIRFVGHKSDVMSVSIDAGATQIVSA 125

Query: 307 AGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDG----VLISSGNDRRVIMWDI 362
           +  D  V ++++    V   ++ GH D ++++  +P  +      +IS+G D+ V +WD+
Sbjct: 126 S-RDKTVKVWNTVGECV--VTLLGHNDWVSHVRIAPKDNADDPVTVISAGMDKVVKVWDL 182

Query: 363 NDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHK 422
                E           + I    GH + VN  + +P+   + ASA ++  I +W  + K
Sbjct: 183 QSFTIE----------ADFI----GHNNYVNTVTPSPDGS-IFASAGKDGQIMLWNLNAK 227

Query: 423 LPI 425
           + +
Sbjct: 228 IAL 230

 Score = 37.0 bits (84), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 51/254 (20%), Positives = 99/254 (38%), Gaps = 77/254 (30%)

Query: 207 NDKGKLLSGSDDGTIALWDIQENSTLAK--------------------------KPLKIW 240
           ND    LS S D T+ LWD+    +L +                          K +K+W
Sbjct: 75  NDGKYALSASWDKTLRLWDLASGESLIRFVGHKSDVMSVSIDAGATQIVSASRDKTVKVW 134

Query: 241 DSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHS 300
           ++V   +V     N++ S+V  +  +++                    DP   +      
Sbjct: 135 NTVGECVVTLLGHNDWVSHVRIAPKDNA-------------------DDPVTVI------ 169

Query: 301 QYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDG-VLISSGNDRRVIM 359
                +AG D +V ++D ++ ++      GH + +  +  SP  DG +  S+G D ++++
Sbjct: 170 -----SAGMDKVVKVWDLQSFTIEA-DFIGHNNYVNTVTPSP--DGSIFASAGKDGQIML 221

Query: 360 WDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKC 419
           W++N     +I   + D   EV  +           + +PN  WL A+      I+++  
Sbjct: 222 WNLN----AKIALYSLDAKDEVFAV-----------AFSPNRYWLTAATASG--IKIFDL 264

Query: 420 SHKLPIVGGTPEVS 433
             +LP+    PE +
Sbjct: 265 EQRLPVDDLKPEFA 278

>Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {ON}
           YKR036C (REAL)
          Length = 646

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 65/276 (23%), Positives = 114/276 (41%), Gaps = 45/276 (16%)

Query: 189 ISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIV 248
           +  LR H      +  +  +   L++GS D T+ +WD+  +  L      +  ++   I+
Sbjct: 357 VGELRGHLATVNCMQMDKTNYNILITGSKDATLKMWDLNLSKELYLDHSPLRQNMEETII 416

Query: 249 NDCKWN-----------EFNSNVFASVSEDSTLQLHDQREQNTI--INSIKT---TDPFN 292
             C  N            F+S    S S+D  +   D      +  +N I T    D   
Sbjct: 417 TPCIHNFELHNDEITALSFDSEALISGSKDKKIFHWDLATGKCVQELNLIFTPTHNDTKT 476

Query: 293 TLAFSKHSQYLMA----------------AAGT-DSLVYLYDSRNLSVPLYSMNGHEDSI 335
           +    K+  YL+                 A GT D +V L+D R +  P+ S+ GH D I
Sbjct: 477 STRSGKNGTYLLGTEAPMIGALQCYNSALATGTKDGVVRLWDLR-IGKPVRSLEGHTDGI 535

Query: 336 TNLEFSPHTDGVLISSGNDRRVIMWDIN-----DIGAEQIPDDAEDGAPEVIMIHAGHRS 390
           T+L+F       L++   D  V +WD+      D+ A  +P  + D   ++I + A  R 
Sbjct: 536 TSLKFDSEK---LVTGSMDNSVRIWDLRTSSIVDVIAYDLPVTSLDFDDKLITVGANER- 591

Query: 391 AVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIV 426
            VN F++  +  W+  + E  N ++  + S ++ IV
Sbjct: 592 GVNIFNMERDEHWM--TPEPPNSLKRDELSERIAIV 625

>NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363
          Length = 621

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 56/252 (22%), Positives = 104/252 (41%), Gaps = 70/252 (27%)

Query: 182 NDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWD 241
           N K+  ++  L+ H+++ Y L + P D  KL+SGS D +I +WD++              
Sbjct: 369 NIKERKIVMVLKGHEQDIYSLDYFP-DGQKLVSGSGDRSIRIWDLKTG------------ 415

Query: 242 SVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQ 301
                                               Q ++  SI+  D   T+A S +  
Sbjct: 416 ------------------------------------QCSLTLSIE--DGVTTVAVSPNEG 437

Query: 302 YLMAAAGTDSLVYLYDS------RNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGN-D 354
            L+AA   D  V ++DS        L     S NGH+DS+ ++ F+   DG  + SG+ D
Sbjct: 438 KLIAAGSLDRSVRIWDSSTGFLVERLDSDNESGNGHQDSVYSVAFT--KDGQHVVSGSLD 495

Query: 355 RRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENII 414
           R V +W++          D + G  +  + + GH+  V   + + +  ++ + +++  +I
Sbjct: 496 RTVKLWNLG---------DTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVI 546

Query: 415 QVWKCSHKLPIV 426
            +W      PI+
Sbjct: 547 -IWDKDSGNPIL 557

>YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}
           CDH1Cell-cycle regulated activator of the
           anaphase-promoting complex/cyclosome (APC/C), which
           directs ubiquitination of cyclins resulting in mitotic
           exit; targets the APC/C to specific substrates including
           Cdc20p, Ase1p, Cin8p and Fin1p
          Length = 566

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 79/155 (50%), Gaps = 14/155 (9%)

Query: 212 LLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQ 271
           L  G  +G + ++D+     + +K ++   S H D V    WN   ++V  S S D  + 
Sbjct: 317 LAVGQANGLVEIYDV-----MKRKCIRTL-SGHIDRVACLSWN---NHVLTSGSRDHRIL 367

Query: 272 LHDQREQNTIINSIKT-TDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNG 330
             D R  +    +I++ T     L ++     L A+ G D++V++Y+  + S P+ + + 
Sbjct: 368 HRDVRMPDPFFETIESHTQEVCGLKWNVADNKL-ASGGNDNVVHVYEGTSKS-PILTFDE 425

Query: 331 HEDSITNLEFSPHTDGVLISSGN--DRRVIMWDIN 363
           H+ ++  + +SPH  GVL + G   DRR+ +W++N
Sbjct: 426 HKAAVKAMAWSPHKRGVLATGGGTADRRLKIWNVN 460

>CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some
           similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084c TUP1
          Length = 836

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 106/221 (47%), Gaps = 22/221 (9%)

Query: 202 LSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNS-NV 260
           + F+P+ K  L +G++D  I +WDI++     KK + +      DI +    + F S + 
Sbjct: 561 VCFSPDGK-FLATGAEDKLIRIWDIEQ-----KKIVMVLKGHEQDIYS---LDYFPSGDK 611

Query: 261 FASVSEDSTLQLHDQRE-QNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSR 319
             S S D T+++ D +  Q T+  SI+  D   T+A S      +AA   D  V ++DS 
Sbjct: 612 LVSGSGDRTVRIWDLKTGQCTLTLSIE--DGVTTVAVSPGDGKFIAAGSLDRAVRVWDSD 669

Query: 320 N--LSVPLYSMN----GHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDD 373
              L   L S N    GH+DS+ ++ F+   +GV +S   DR V +W++ ++        
Sbjct: 670 TGFLVERLDSENELGTGHKDSVYSVVFTRDGNGV-VSGSLDRSVKLWNLRNVNHNNADGK 728

Query: 374 AEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENII 414
              G  EV   + GH+  V   +   +  ++++ +++  ++
Sbjct: 729 PTSGTCEV--TYTGHKDFVLSVATTEDDEYILSGSKDRGVL 767

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 59/132 (44%), Gaps = 19/132 (14%)

Query: 287 TTDPF-NTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTD 345
           TTD +  ++ FS   ++L A    D L+ ++D     + +  + GHE  I +L++ P  D
Sbjct: 553 TTDLYIRSVCFSPDGKFL-ATGAEDKLIRIWDIEQKKI-VMVLKGHEQDIYSLDYFPSGD 610

Query: 346 GVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLM 405
             L+S   DR V +WD+   G   +    EDG              V   +++P     +
Sbjct: 611 K-LVSGSGDRTVRIWDLK-TGQCTLTLSIEDG--------------VTTVAVSPGDGKFI 654

Query: 406 ASAEEENIIQVW 417
           A+   +  ++VW
Sbjct: 655 AAGSLDRAVRVW 666

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 59/256 (23%), Positives = 110/256 (42%), Gaps = 43/256 (16%)

Query: 184 KQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQEN-STLAKKPLKIWDS 242
           +Q  ++  L+ H+++ Y L + P+   KL+SGS D T+ +WD++    TL    L I D 
Sbjct: 585 EQKKIVMVLKGHEQDIYSLDYFPSGD-KLVSGSGDRTVRIWDLKTGQCTLT---LSIEDG 640

Query: 243 VHNDIVN--DCKWNEFNSNVFASVSEDSTLQLHDQR--EQNTIINSIKTTDPFNTLAFSK 298
           V    V+  D K+    S   A    DS      +R   +N +    K  D   ++ F++
Sbjct: 641 VTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHK--DSVYSVVFTR 698

Query: 299 HSQYLMAAAGTDSLVYLYDSRNL-----------SVPLYSMNGHEDSITNLEFSPHTDGV 347
               +++ +  D  V L++ RN+                +  GH+D + ++  +   D  
Sbjct: 699 DGNGVVSGS-LDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATT-EDDEY 756

Query: 348 LISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPW---- 403
           ++S   DR V+ W            D   G P  +++  GHR++V   ++N   P     
Sbjct: 757 ILSGSKDRGVLFW------------DKVSGNP--LLMLQGHRNSVISVAVNHGHPLGPNY 802

Query: 404 -LMASAEEENIIQVWK 418
            + A+   +   ++WK
Sbjct: 803 HIFATGSGDCKARIWK 818

>KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} similar
           to uniprot|P21304 Saccharomyces cerevisiae YLR196W PWP1
          Length = 579

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 88/189 (46%), Gaps = 17/189 (8%)

Query: 191 TLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVH-NDIVN 249
            L  H +    L+ +   +  L S S D T+ LWD+ E   +A + +    S+H N  V+
Sbjct: 288 VLTHHTDAVLSLAHSKQFRAVLASTSADHTVKLWDLNEG--IAARSVA---SIHSNKNVS 342

Query: 250 DCKWNEFNSNVFASVSEDSTLQLHDQR----EQNTIINSIKTTDPFNTLAFSKHSQYLMA 305
             +W+  + +V  +   DS + L D R     Q +   S+ T +    + F+  + ++  
Sbjct: 343 SSQWHSTSGSVLLTGGYDSRVALSDVRIAEDSQMSKYWSVMTGEDVECVQFADENTFM-- 400

Query: 306 AAGTDSL-VYLYDSRNL--SVPLYSMNGHEDSITNLEFSPHTDGVLISSG-NDRRVIMWD 361
             GTDS  VY +D R    S PL+++N H+  I+ L  +P    +L +    ++ V  W 
Sbjct: 401 -CGTDSGNVYSFDIRQGEGSKPLWTLNAHDAGISALNVNPFIPNLLATGAMGEKTVKFWK 459

Query: 362 INDIGAEQI 370
           I++ G   +
Sbjct: 460 ISESGPSMV 468

>SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963
           bp, 320 aa] {ON} highly similar to with YMR116C
           uniprot|P38011 Saccharomyces cerevisiae YMR116C ASC1 WD
           repeat protein (G- beta like protein) involved in
           translation regulation required for repression of Gcn4p
           activity in the absence of amino-acid starvation core
           component of the ribosome ortholog of mammalian RACK1
          Length = 320

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 56/250 (22%), Positives = 112/250 (44%), Gaps = 29/250 (11%)

Query: 185 QSALISTLR--FHKENGY--GLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIW 240
           +SA +  LR      NG+   L+ +P     LLS S D T+  W +  +      P++ +
Sbjct: 3   ESAEVLVLRGTLEGHNGWVTSLATSPAQPNLLLSASRDKTLITWKLTGDDQQYGVPVRSF 62

Query: 241 DSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHS 300
              H+ I+ DC     +     S S D T++L +      +   +       ++A  + +
Sbjct: 63  KG-HSHIIQDCTVTA-DGEYALSASWDKTIRLWELATGKCVKRFVGHKSDVLSVAIDRRA 120

Query: 301 QYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDG-----VLISSGNDR 355
             +++A+  D  V ++++  L   + ++ GH D ++ +  +P+ D       +IS+G D+
Sbjct: 121 TQIVSAS-RDKTVKVWNT--LGECMVTLLGHNDWVSQVRVAPNEDPEDKTVTVISAGMDK 177

Query: 356 RVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQ 415
            V +W+++     QI  D             GH + VN  + +P+   L+ASA ++  I 
Sbjct: 178 VVKVWNLHSF---QIEAD-----------FIGHNNYVNTVTASPDGS-LVASAGKDGQIM 222

Query: 416 VWKCSHKLPI 425
           +W  + K  +
Sbjct: 223 LWNLTEKTAL 232

>SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 69/300 (23%), Positives = 112/300 (37%), Gaps = 73/300 (24%)

Query: 164 DIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSF------NPNDKGKLLSGSD 217
           ++IAT +   T+ ++    +K   +   LR H +    LS+       P  K +L S S 
Sbjct: 199 ELIATGSMDNTIRLWE--GNKGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRLASASK 256

Query: 218 DGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQRE 277
           DGTI +WD      L      I  S H   V+  KW      V  S S D T++  D   
Sbjct: 257 DGTIKIWDTTRRVCL------ITLSGHTSSVSCIKWG--GQGVLYSGSHDKTIRAWDMNL 308

Query: 278 QNTIIN------------SIKTTDPFNTLAFSKHSQY----------------------- 302
               IN            S+ T       AF   S+                        
Sbjct: 309 GGKCINILKSHAHWVNHLSLSTDYALRIGAFDHTSEKPSTPEEAQKRALKNYEKIAKRNG 368

Query: 303 ----LMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGV-LISSGNDRRV 357
               LM  A  D  +YL++    + P+  M GH+  + ++ FSP  DG  ++S+  D  +
Sbjct: 369 EVEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSP--DGRHIVSASFDNSI 426

Query: 358 IMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
            +W            +  DG  + I    GH ++V   + + +   L+ S  ++  ++VW
Sbjct: 427 KLW------------NGRDG--KFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 471

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 88/175 (50%), Gaps = 18/175 (10%)

Query: 203 SFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFA 262
           +F P+   ++++G+ D T  +WD    + ++   LK     H + V    W+  +  + A
Sbjct: 150 AFAPHTSSRMITGAGDNTARIWDCNTQTPMST--LK----GHFNWVLCVSWSP-DGELIA 202

Query: 263 SVSEDSTLQLHDQREQNTIINSIK------TTDPFNTLAFSKHSQY-LMAAAGTDSLVYL 315
           + S D+T++L +  +   + ++++      T+  +  +   K  Q   +A+A  D  + +
Sbjct: 203 TGSMDNTIRLWEGNKGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRLASASKDGTIKI 262

Query: 316 YDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQI 370
           +D+    V L +++GH  S++ +++     GVL S  +D+ +  WD+N +G + I
Sbjct: 263 WDTTR-RVCLITLSGHTSSVSCIKWGGQ--GVLYSGSHDKTIRAWDMN-LGGKCI 313

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 64/148 (43%), Gaps = 30/148 (20%)

Query: 279 NTIIN-SIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITN 337
           N+I+   +KTT+ F TL ++  +              ++  + ++    ++ GH  +I  
Sbjct: 103 NSILKPGLKTTEDFITLVYTPRA--------------VFKVKPVTRSSSAIAGHGSTILC 148

Query: 338 LEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSI 397
             F+PHT   +I+   D    +WD N     Q P          +    GH + V   S 
Sbjct: 149 SAFAPHTSSRMITGAGDNTARIWDCN----TQTP----------MSTLKGHFNWVLCVSW 194

Query: 398 NPNIPWLMASAEEENIIQVWKCSHKLPI 425
           +P+   L+A+   +N I++W+ +   P+
Sbjct: 195 SPDGE-LIATGSMDNTIRLWEGNKGQPV 221

>SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]
           {ON} similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 555

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 97/206 (47%), Gaps = 22/206 (10%)

Query: 162 NTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLS-GSDDGT 220
           +TD++  + G  +VF+ + + ++   L  T     EN Y  S N    G  L+ G  +G 
Sbjct: 262 STDVLGVVLGK-SVFLTDNATNEVVQLCDT-----ENEY-TSINWVGAGSHLAVGQGNGL 314

Query: 221 IALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNT 280
           + ++DI     + +K ++   S H D V    WN   +++  S S D  +   D R    
Sbjct: 315 VEIYDI-----VKRKCIRTL-SGHMDRVACLSWN---NHILTSGSRDRKILHRDVRMPEP 365

Query: 281 IINSIKT-TDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLE 339
               ++T T     L ++     L A+ G D++VY+YD  +   P   +  H  ++  + 
Sbjct: 366 YFEQVETHTQEVCGLKWNTDENRL-ASGGNDNVVYVYDGTSRK-PTLKLAEHTAAVKAIA 423

Query: 340 FSPHTDGVLISSGN--DRRVIMWDIN 363
           +SPH  G+L + G   D+++ +W++N
Sbjct: 424 WSPHKRGILATGGGTADKKMKIWNVN 449

>TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {ON}
           Anc_5.201 YLL011W
          Length = 488

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 71/154 (46%), Gaps = 14/154 (9%)

Query: 200 YGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLK--IWDSVHNDIVNDCKWNEFN 257
           +GL  + N+   +  G+    I LWD   +     KP+    W +   D V   K+N+  
Sbjct: 177 FGLDHHRNNSTFVTGGAQ---IQLWDANRS-----KPISNLTWGA---DNVTSVKFNQTE 225

Query: 258 SNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYD 317
           +++ AS   D+++ L+D R  N+    I+ +   N + ++    +    A  D   Y YD
Sbjct: 226 TDILASTGSDNSIVLYDLR-TNSPTQKIRQSMRTNAICWNPMEAFNFVIANEDHNAYYYD 284

Query: 318 SRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISS 351
            RN+S  L     H  ++ +++FSP  D ++  S
Sbjct: 285 MRNMSRALNVFKDHVSAVMDVDFSPTGDEIVTGS 318

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 74/189 (39%), Gaps = 34/189 (17%)

Query: 185 QSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVH 244
           +S  IS L +  +N   + FN  +   L S   D +I L+D++ NS       KI  S+ 
Sbjct: 202 RSKPISNLTWGADNVTSVKFNQTETDILASTGSDNSIVLYDLRTNSPTQ----KIRQSMR 257

Query: 245 NDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLM 304
            + +  C WN   +  F   +ED     +D R  +  +N            F  H   +M
Sbjct: 258 TNAI--C-WNPMEAFNFVIANEDHNAYYYDMRNMSRALN-----------VFKDHVSAVM 303

Query: 305 ----AAAGTDSLVYLYDSRNLSVPLYSMN-GHEDSITNLEFSPHTDGV--------LISS 351
               +  G + +   YD    ++ +Y  N GH   + + +   H   V        +IS 
Sbjct: 304 DVDFSPTGDEIVTGSYDK---TIRIYKTNQGHSREVYHTKRMQHVFQVKYSMDSKYIISG 360

Query: 352 GNDRRVIMW 360
            +D  V +W
Sbjct: 361 SDDGNVRLW 369

 Score = 31.2 bits (69), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 35/184 (19%), Positives = 82/184 (44%), Gaps = 22/184 (11%)

Query: 195 HKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWN 254
           H++  Y ++ N N   KL S S DG +  +++       ++ +  + + +  +   C   
Sbjct: 66  HRDGVYTIAKNYNQLNKLASSSADGVVKYFNMS-----TREEICSFKAHYGLVTGLCVRP 120

Query: 255 EF-----NSNVFASVSEDSTLQL----HDQREQNTIINSIKTTDPFNTLAFSKHSQYLMA 305
           E      N +   S  +D T++L     +    N   ++I   D      +  H+ + + 
Sbjct: 121 ETSATNKNEHYMISCGDDKTVKLWSVDSNDFSNNKKDDTIHKGDGLLKTYYGDHAFFGLD 180

Query: 306 AAGTDSL-------VYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVI 358
               +S        + L+D+ N S P+ ++    D++T+++F+     +L S+G+D  ++
Sbjct: 181 HHRNNSTFVTGGAQIQLWDA-NRSKPISNLTWGADNVTSVKFNQTETDILASTGSDNSIV 239

Query: 359 MWDI 362
           ++D+
Sbjct: 240 LYDL 243

>TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {ON}
           Anc_4.309 YLR429W
          Length = 588

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 65/142 (45%), Gaps = 14/142 (9%)

Query: 189 ISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAK-----------KPL 237
           I   R H        F+P D  KL S +DD  IA+W+I E+ TL             KP+
Sbjct: 74  IPLFRGHTAQVLDTDFDPFDDKKLASSADDSKIAIWEIPEDYTLKSYVDEDGEPKVIKPV 133

Query: 238 KIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFS 297
           KI  S H   V    ++    NV AS S D T+++ D   +  ++ ++   D   +++FS
Sbjct: 134 KIL-SGHKRKVGHILYHPVAQNVLASSSLDYTVKIWDIENEKDML-TLTHPDMVTSMSFS 191

Query: 298 KHSQYLMAAAGTDSLVYLYDSR 319
            +  +L A    D  + ++D R
Sbjct: 192 YNGNFL-ATVARDKKLRVWDVR 212

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 51/99 (51%), Gaps = 8/99 (8%)

Query: 323 VPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDI-NDIGAEQIPDDAEDGAPEV 381
           +PL+   GH   + + +F P  D  L SS +D ++ +W+I  D   +   D  EDG P+V
Sbjct: 74  IPLF--RGHTAQVLDTDFDPFDDKKLASSADDSKIAIWEIPEDYTLKSYVD--EDGEPKV 129

Query: 382 I---MIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
           I    I +GH+  V     +P    ++AS+  +  +++W
Sbjct: 130 IKPVKILSGHKRKVGHILYHPVAQNVLASSSLDYTVKIW 168

>TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa]
           {ON} Anc_2.431 YMR116C
          Length = 319

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 102/247 (41%), Gaps = 25/247 (10%)

Query: 181 SNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIW 240
           SN +   L  TL  H      L+ +      LLS S D T+  W +  +      P++ +
Sbjct: 2   SNAEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQQYGVPVRSF 61

Query: 241 DSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHS 300
              H+ IV DC      +    S S D TL+L D     T    +       ++A  + +
Sbjct: 62  KG-HSHIVQDCALTADGAYAL-SASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKA 119

Query: 301 QYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDG-----VLISSGNDR 355
             +++ +  D  V ++  +     L +M GH D ++ +   P  D       +IS+G D+
Sbjct: 120 SMIISGS-RDKTVKVWTIKGQC--LATMLGHNDWVSQVRIVPTEDVNDDTVTVISAGMDK 176

Query: 356 RVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQ 415
            V  W++N     QI  D             GH + VN  + +P+   L+ASA ++  I 
Sbjct: 177 MVKAWNVNQF---QIEAD-----------FIGHNNYVNTVTASPDGS-LIASAGKDGEIM 221

Query: 416 VWKCSHK 422
           +W  + K
Sbjct: 222 LWNLADK 228

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 46/85 (54%), Gaps = 7/85 (8%)

Query: 189 ISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIV 248
           I  L  H +  YGL ++PN    + +GS DGTI LWD+++   L   P       HN IV
Sbjct: 346 IMALEGHIKPIYGLDWSPNGY-DIATGSADGTIRLWDVRKVGILGALP------AHNSIV 398

Query: 249 NDCKWNEFNSNVFASVSEDSTLQLH 273
           ++ K+++ N +   S S D TL ++
Sbjct: 399 SEVKFDKANGHYLVSSSYDKTLNIY 423

>Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON}
           YGL003C (REAL)
          Length = 566

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 79/155 (50%), Gaps = 14/155 (9%)

Query: 212 LLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQ 271
           L  G  +G + ++D+     + +K ++   S H D V    WN   ++V  S S D  + 
Sbjct: 317 LAVGQGNGLVEIYDV-----MKRKCIRTL-SGHVDRVACLSWN---NHVLTSGSRDHRIL 367

Query: 272 LHDQREQNTIINSIKT-TDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNG 330
             D R  +    +I++ T     L ++     L A+ G D++V++Y+  + S P+ + + 
Sbjct: 368 HRDVRMPDPFFETIESHTQEVCGLKWNVIDNKL-ASGGNDNMVHVYEGTSKS-PILTFDE 425

Query: 331 HEDSITNLEFSPHTDGVLISSGN--DRRVIMWDIN 363
           H+ ++  + +SPH  G+L + G   DRR+ +W++N
Sbjct: 426 HKAAVKAMAWSPHKRGILATGGGTADRRLKIWNVN 460

>KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {ON}
           Anc_5.429 YDR364C
          Length = 439

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 88/193 (45%), Gaps = 16/193 (8%)

Query: 202 LSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVF 261
           + F PN     LSG +D  + +WD   +    +K L+ +   H   +    +N+ +++ F
Sbjct: 152 MKFIPNTGHLFLSGGNDNIVKIWDFYHD----RKSLRDYRG-HTKAIKSMSFND-DAHNF 205

Query: 262 ASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNL 321
            + S D T++L D  E   +   +K     N + F   + +       DS +  YD+R  
Sbjct: 206 ITSSFDQTVKLWDT-ETGQVKKRLKFKSTPNCVEFRPANNHEFIVGLADSKIAHYDTRES 264

Query: 322 SVP--LYSMNGHEDSITNLEFSPHTDGV-LISSGNDRRVIMWD--INDIGAEQIPDDAED 376
           S    + + + H  SI +L F P  DG   ISS  D+ V +W+  IN I  +QI D  + 
Sbjct: 265 SKHGLVQTYDHHLGSILSLRFFP--DGSKFISSSEDKTVRIWENQIN-IPIKQISDTTQY 321

Query: 377 GAPEVIMIHAGHR 389
             P  I IH  H+
Sbjct: 322 SMP-FIGIHPEHK 333

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 21/37 (56%)

Query: 326 YSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDI 362
           Y  +GH    T ++F P+T  + +S GND  V +WD 
Sbjct: 140 YKFSGHSSGTTCMKFIPNTGHLFLSGGNDNIVKIWDF 176

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 9/72 (12%)

Query: 174 TVFIYNQSNDKQSALISTLRFHKENGY--GLSFNPNDKGKLLSGSDDGTIALWDIQENST 231
           T++ Y+     +       +  K  GY  GLSF+P+ +  LLSG     I LWD   N +
Sbjct: 343 TIYSYSLRPKYKKHPNKVFKGQKSAGYSIGLSFSPDGR-YLLSGDSRSKIVLWDWNTNKS 401

Query: 232 L------AKKPL 237
           L       KKP+
Sbjct: 402 LKDINIPGKKPI 413

>KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.340
           YCR072C
          Length = 519

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 83/179 (46%), Gaps = 33/179 (18%)

Query: 203 SFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFA 262
           +F P+   ++++G+ D T  +WD    + LA          H++ V    W+  +  V A
Sbjct: 146 AFAPDTSSRMVTGAGDNTARIWDCDTQTPLATL------EGHSNWVLCVSWSP-DGEVIA 198

Query: 263 SVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYL------------------M 304
           + S DST++L +  +   +     ++      A   H +++                  +
Sbjct: 199 TGSMDSTIRLWESTKGKPVGGGNGSSS-----ALKGHMKWITSLSWEPLHLVPDGAKPRL 253

Query: 305 AAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN 363
           A+A  D  + ++D+    V LY+++GH +S+  +++    +G+L S  +D+ V +WD+N
Sbjct: 254 ASASKDGTIKIWDTAR-RVCLYTLSGHSNSVACVKWG--GEGLLYSGSHDKTVRVWDMN 309

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 70/306 (22%), Positives = 123/306 (40%), Gaps = 77/306 (25%)

Query: 164 DIIATINGSGTVFIYNQSNDK----QSALISTLRFHKENGYGLSFNP------NDKGKLL 213
           ++IAT +   T+ ++  +  K     +   S L+ H +    LS+ P        K +L 
Sbjct: 195 EVIATGSMDSTIRLWESTKGKPVGGGNGSSSALKGHMKWITSLSWEPLHLVPDGAKPRLA 254

Query: 214 SGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLH 273
           S S DGTI +WD      L         S H++ V   KW      +  S S D T+++ 
Sbjct: 255 SASKDGTIKIWDTARRVCLYTL------SGHSNSVACVKWG--GEGLLYSGSHDKTVRVW 306

Query: 274 DQREQNT--IINSIK-----------TTD------PFN-------TLAFSKH-------- 299
           D         I+ +K           +TD      PF+       T A +K         
Sbjct: 307 DMNSATVGKCISILKNHAHWVNHLSLSTDYALRIGPFDHTGVKPSTPAEAKRRAQANYDK 366

Query: 300 -------SQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDG-VLISS 351
                  ++ LM  A  D  ++L++ + L+ PL  M GH+  + ++ FSP  DG  ++S+
Sbjct: 367 VAKRNGSAEELMVTASDDFTMFLWNPKKLTKPLARMTGHQKLVNHVAFSP--DGRYIVSA 424

Query: 352 GNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEE 411
             D  + +W            D  DG  + +    GH ++V   + + +   L+ S  ++
Sbjct: 425 SFDNSIKLW------------DGRDG--KFLSTFRGHVASVYQVAWSSDCR-LLVSCSKD 469

Query: 412 NIIQVW 417
             ++VW
Sbjct: 470 TTLKVW 475

>Smik_4.386 Chr4 complement(701174..702304) [1131 bp, 376 aa] {ON}
           YDR142C (REAL)
          Length = 376

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 49/254 (19%), Positives = 110/254 (43%), Gaps = 48/254 (18%)

Query: 171 GSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENS 230
           G+G ++I     + + A +++    ++  + +++N + + ++L    DGT+ L+D    +
Sbjct: 36  GNGKLYILEIGREGKIAEVNSF-LTQDCLFDVAWNESHENQVLVAQGDGTLRLFD----T 90

Query: 231 TLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINS------ 284
           TL + P+ I+   H   V  C WN  N   F S S D ++++     + ++++       
Sbjct: 91  TLKEFPIAIFKE-HEREVFSCNWNLVNRQNFLSSSWDGSIKIWSPLRKQSLMSLTPRPLE 149

Query: 285 -IKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPH 343
             K  DP N +  +K +                           ++ +++ +   +FSPH
Sbjct: 150 ITKMVDPLNAILLNKKNH------------------------TGISKNKNCVYQAQFSPH 185

Query: 344 TDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPW 403
              ++IS   +    ++DI      ++P           ++H+G  +   DF  N   P+
Sbjct: 186 DPNLVISCSGNSYASLFDI------RLPPSKNQNN---FLVHSGLEALTCDF--NKYRPY 234

Query: 404 LMASAEEENIIQVW 417
           ++A+   +N I++W
Sbjct: 235 VVATGGVDNAIRIW 248

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 64/297 (21%), Positives = 122/297 (41%), Gaps = 56/297 (18%)

Query: 171 GSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWD---IQ 227
           G GT+ +++ +   +   I+  + H+   +  ++N  ++   LS S DG+I +W     Q
Sbjct: 81  GDGTLRLFDTT--LKEFPIAIFKEHEREVFSCNWNLVNRQNFLSSSWDGSIKIWSPLRKQ 138

Query: 228 ENSTLAKKPLKIWDSV------------------HNDIVNDCKWNEFNSNVFASVSEDST 269
              +L  +PL+I   V                  + + V   +++  + N+  S S +S 
Sbjct: 139 SLMSLTPRPLEITKMVDPLNAILLNKKNHTGISKNKNCVYQAQFSPHDPNLVISCSGNSY 198

Query: 270 LQLHDQR-----EQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVP 324
             L D R      QN  +  + +     T  F+K+  Y++A  G D+ + ++D R L+  
Sbjct: 199 ASLFDIRLPPSKNQNNFL--VHSGLEALTCDFNKYRPYVVATGGVDNAIRIWDIRMLTTN 256

Query: 325 LYS-------------------MNGHEDSITNLEFSPHTDGVLISSGNDRRVIMW-DI-N 363
             +                   +N H  +I  + +SPH   +L+S+  D    +W D+ N
Sbjct: 257 GSATNNRTTQNQTHNPSCINEIINAHGLAIRKVSWSPHHSNILMSASYDMTCRIWRDLSN 316

Query: 364 DIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNI---PWLMASAEEENIIQVW 417
           D   E    ++ D     I+    H   V  F I+ ++   P  +AS   +  + VW
Sbjct: 317 DGTKETYKTNSTDARKGSILNFTKHSEFV--FGIDWSLWGKPGYVASTAWDGNLFVW 371

>Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON}
           YGL003C (REAL)
          Length = 566

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 80/155 (51%), Gaps = 14/155 (9%)

Query: 212 LLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQ 271
           L  G ++G + ++D+     + +K ++   S H D V    WN   ++V  S S D  + 
Sbjct: 317 LAVGQENGLVEIYDV-----IKRKCIRTL-SGHVDRVACLSWN---NHVLTSGSRDHRIL 367

Query: 272 LHDQREQNTIINSIKT-TDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNG 330
             D R  +    +I++ T     L ++     L A+ G D++V++Y+  + S P+ + + 
Sbjct: 368 HRDVRMPDPFFETIESHTQEVCGLKWNVADNKL-ASGGNDNMVHVYEGTSKS-PILTFDE 425

Query: 331 HEDSITNLEFSPHTDGVLISSGN--DRRVIMWDIN 363
           H+ ++  + +SPH  G+L + G   DR++ +W++N
Sbjct: 426 HKAAVKAMAWSPHKRGILATGGGTADRKLKIWNVN 460

>NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa]
           {ON} Anc_8.288 YDR128W
          Length = 1134

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 60/123 (48%), Gaps = 10/123 (8%)

Query: 244 HNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFS-----K 298
           H+  + D  +N  N ++ A+ S D+ +   D R  +    S   T  + + A       K
Sbjct: 112 HSRAITDINFNPENPDILATCSIDTYVHAWDMRSPHKPFYS---TSAWRSSASQVKWNFK 168

Query: 299 HSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVI 358
            S  L ++ G D  V+++D RN S PL  + GHE S+ +++FS      ++SS ND  V 
Sbjct: 169 DSNILASSHGND--VFIWDLRNGSTPLCQLVGHESSVNSIDFSRFKSTEIMSSSNDGTVK 226

Query: 359 MWD 361
            WD
Sbjct: 227 FWD 229

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 84/202 (41%), Gaps = 21/202 (10%)

Query: 149 HEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPND 208
           H   IT   F P+N DI+AT +    V  ++  +       ST  + + +   + +N  D
Sbjct: 112 HSRAITDINFNPENPDILATCSIDTYVHAWDMRS-PHKPFYSTSAW-RSSASQVKWNFKD 169

Query: 209 KGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDS 268
              +L+ S    + +WD++  ST   + +      H   VN   ++ F S    S S D 
Sbjct: 170 -SNILASSHGNDVFIWDLRNGSTPLCQLVG-----HESSVNSIDFSRFKSTEIMSSSNDG 223

Query: 269 TLQLHDQREQNTIINSIKTTD-PF---NTLAFSKHSQYLMAAAGTDSLVYLY-------D 317
           T++  D    N  +    TTD P      L F  +   +M   G ++ VY+        D
Sbjct: 224 TVKFWDYSVNNEDLTRTVTTDFPIWRGRYLPFG-NGYCIMPQVGGNNSVYMMNLKSEEPD 282

Query: 318 SRNLSV-PLYSMNGHEDSITNL 338
           ++   + P+Y+  GH D I + 
Sbjct: 283 TKTAKLQPIYAFKGHTDRIIDF 304

>TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {ON}
           Anc_5.201 YLL011W
          Length = 481

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 82/178 (46%), Gaps = 21/178 (11%)

Query: 179 NQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLK 238
           +Q+ + Q  L+ T  F+ E+ +    +   K   ++G    TI LWD     T   KPL 
Sbjct: 157 DQNLNSQDGLLKT--FYGEHAFQGIDHHKVKTTFVTGGP--TIQLWD-----TARSKPLS 207

Query: 239 --IWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQN---TIINSIKTTDPFNT 293
              W +   D +   K+N+  +++ AS   D+++ L+D R  +    I+  ++T    N 
Sbjct: 208 NLSWGA---DNITSVKFNQTETDILASTGSDNSIVLYDVRTNSPTQKIVQRLRT----NA 260

Query: 294 LAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISS 351
           + ++    +    A  D   Y YD RN+S  L     H  ++ +++F+P  D ++  S
Sbjct: 261 ICWNPMEAFNFVTANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFAPTGDEIVTGS 318

 Score = 37.7 bits (86), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 39/187 (20%), Positives = 79/187 (42%), Gaps = 28/187 (14%)

Query: 195 HKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLA-----------------KKPL 237
           H++  Y ++ + +D  K+ SGS DG I  W++     +                  + PL
Sbjct: 66  HRDGVYVIAKDYHDLNKVASGSGDGVIKYWNMSSRDEICSFKAHYGLITGLCVSPQRSPL 125

Query: 238 KIWDSVHNDIVND--CKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLA 295
                      +D   K    N + FA+V +D  L       Q+ ++ +      F  + 
Sbjct: 126 NRDQHFMLSCGDDKTVKLWSMNGDDFANVKDDQNLN-----SQDGLLKTFYGEHAFQGID 180

Query: 296 FSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDR 355
             K     +    T   + L+D+   S PL +++   D+IT+++F+     +L S+G+D 
Sbjct: 181 HHKVKTTFVTGGPT---IQLWDTAR-SKPLSNLSWGADNITSVKFNQTETDILASTGSDN 236

Query: 356 RVIMWDI 362
            ++++D+
Sbjct: 237 SIVLYDV 243

>NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {ON}
           Anc_8.288
          Length = 1145

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 84/192 (43%), Gaps = 19/192 (9%)

Query: 244 HNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFS-----K 298
           H+  + D  +N  N ++ A+ S D+ +   D R  +       TT  + + A       K
Sbjct: 116 HSRAITDINFNPENPDILATCSVDTYVHAWDMRSPH---RPFYTTSAWRSGASQVKWNYK 172

Query: 299 HSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVI 358
            S  L +A   D  +Y++D R  S PL+ + GH+ S+ +++F+      ++SS ND  V 
Sbjct: 173 DSNILASAHSND--IYIWDLRMGSTPLHKLVGHDSSVNSIDFNRFKSSEIMSSSNDGTVK 230

Query: 359 MWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINP-----NIPWLMASAEEENI 413
            WDI+  G++          P   +    +    N F I P     N  +L    E+EN+
Sbjct: 231 FWDISK-GSDNCTSTVSTDFP---IWRGRYLPFGNGFCIMPQEGGGNAVYLSTLKEQENL 286

Query: 414 IQVWKCSHKLPI 425
            +  K +   PI
Sbjct: 287 NESNKLTKLQPI 298

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 93/227 (40%), Gaps = 24/227 (10%)

Query: 149 HEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPND 208
           H   IT   F P+N DI+AT +    V  ++  +  +     T    +     + +N  D
Sbjct: 116 HSRAITDINFNPENPDILATCSVDTYVHAWDMRSPHRP--FYTTSAWRSGASQVKWNYKD 173

Query: 209 KGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDS 268
              +L+ +    I +WD++  ST   K +      H+  VN   +N F S+   S S D 
Sbjct: 174 -SNILASAHSNDIYIWDLRMGSTPLHKLVG-----HDSSVNSIDFNRFKSSEIMSSSNDG 227

Query: 269 TLQLHD-QREQNTIINSIKTTDPF---NTLAFSKHSQYLMAAAGTDSLVY---LYDSRNL 321
           T++  D  +  +   +++ T  P      L F  +   +M   G  + VY   L +  NL
Sbjct: 228 TVKFWDISKGSDNCTSTVSTDFPIWRGRYLPFG-NGFCIMPQEGGGNAVYLSTLKEQENL 286

Query: 322 S--------VPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMW 360
           +         P+YS  GH + + +  +       L+ +  + +++ W
Sbjct: 287 NESNKLTKLQPIYSFKGHSERVIDFLWRSRQPSDLMVNDCEFQLVTW 333

>KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1206

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 104/236 (44%), Gaps = 28/236 (11%)

Query: 201 GLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNV 260
           G++F+P+ +  +L      TI LWD +  + L +         H+  V    ++     +
Sbjct: 16  GIAFHPS-RPLVLVALFSSTIQLWDYRMGTLLHRF------EGHDGPVRGIDFHP-TQPI 67

Query: 261 FASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRN 320
           FAS  +D+T+++        +       D   T+ F     +L++A+  D  + +++ +N
Sbjct: 68  FASTGDDATIRIWSLDTNKCLYTFTGHLDYVRTVFFHHELPWLISASD-DQTIRIWNWQN 126

Query: 321 LSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDI-------GAEQIPD- 372
               +  + GH   +   +F P T+ +++S+  D  V +WDI+ +       GA  + D 
Sbjct: 127 RK-EIACLTGHNHFVMCAQFHP-TEDLVVSASLDETVRVWDISGLRKKHSAPGAMSMEDQ 184

Query: 373 --------DAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCS 420
                   D   G   V  I  GH   VN  S +P +P L+ S  ++  +++W+ S
Sbjct: 185 MIAQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGGDDRQVKLWRMS 239

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 90/217 (41%), Gaps = 41/217 (18%)

Query: 212 LLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQ 271
           L+S SDD TI +W+ Q    +A        + HN  V  C       ++  S S D T++
Sbjct: 110 LISASDDQTIRIWNWQNRKEIA------CLTGHNHFVM-CAQFHPTEDLVVSASLDETVR 162

Query: 272 LHD---QREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSM 328
           + D    R++++   ++   D           Q L+     D +V            + +
Sbjct: 163 VWDISGLRKKHSAPGAMSMEDQMIA------QQNLLDGGFGDCVVK-----------FIL 205

Query: 329 NGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGH 388
            GH   +    F P T  +++S G+DR+V +W ++   A +I D              GH
Sbjct: 206 EGHTRGVNWASFHP-TLPLIVSGGDDRQVKLWRMSSTKAWEI-DSCR-----------GH 252

Query: 389 RSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPI 425
            + V+    +P    L+ SA E+  ++VW    ++P+
Sbjct: 253 TNNVDCVIFHPQQN-LIISAGEDKTLRVWDLDKRVPV 288

>KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 326
           aa] {ON} highly similar to uniprot|P38011 Saccharomyces
           cerevisiae YMR116C ASC1 WD repeat protein (G-beta like
           protein) involved in translation regulation required for
           repression of Gcn4p activity in the absence of
           amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 326

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 106/244 (43%), Gaps = 27/244 (11%)

Query: 188 LISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI 247
           L  TL  H      LS +      L+SGS D T+  W + EN      P++ +   H+ I
Sbjct: 10  LRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKG-HSHI 68

Query: 248 VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAA 307
           V D   +  + N   S S D TL+L +    N+    +  T    ++A   +S  +++A+
Sbjct: 69  VQDVVVSA-DGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISAS 127

Query: 308 GTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHT--DG-------VLISSGNDRRVI 358
             D  + ++++  +    Y + GH D +T +  +P    DG         +S+G D+ V 
Sbjct: 128 -RDKTIRVWNT--VGDCAYVLLGHTDWVTKVRVAPKNLEDGEVDDGRITFVSAGMDKIVR 184

Query: 359 MWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418
            W +N+  + +I  D             GH + +N    +P+   L ASA ++  I VW 
Sbjct: 185 SWSLNE-DSYRIEAD-----------FIGHNNYINVVQPSPDGS-LAASAGKDGQIYVWN 231

Query: 419 CSHK 422
             HK
Sbjct: 232 LKHK 235

>KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.544
           YBR198C
          Length = 814

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 104/245 (42%), Gaps = 31/245 (12%)

Query: 190 STLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVN 249
           S L  H    Y  SF+P++K  LLSGS+D T+ LW +  ++TL           HN  V 
Sbjct: 535 SLLIGHSGAVYSTSFSPDNKF-LLSGSEDKTVRLWSMDTHTTLVSY------KGHNHPVW 587

Query: 250 DCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGT 309
           D K++    + FA+ S D T +L        +       +   T++F  +  Y+   +  
Sbjct: 588 DVKFSPM-GHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSA- 645

Query: 310 DSLVYLYD-SRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVI-MWDINDIGA 367
           D    ++D S   SV L+   GH   +     +P  DG  + +G +  VI +WDI     
Sbjct: 646 DKTCRMWDISTGDSVRLFL--GHTAPVLTTAVTP--DGRWLCTGGEDGVINVWDI----- 696

Query: 368 EQIPDDAEDGAPEVIMIHAGH-RSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIV 426
                    G  + +    GH ++A++ FS N     L++   + + ++VW      P  
Sbjct: 697 ---------GTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHS-VRVWDLKKATPEP 746

Query: 427 GGTPE 431
              PE
Sbjct: 747 SAEPE 751

>Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/238 (21%), Positives = 103/238 (43%), Gaps = 32/238 (13%)

Query: 201 GLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSN- 259
           G++F+P+ +  +L      TI LWD +  + L +           D     +  +F+   
Sbjct: 16  GIAFHPS-RPWVLVALFSSTIQLWDYRMGTLLHR---------FEDHEGPVRGLDFHPTQ 65

Query: 260 -VFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDS 318
            +F S  +D T+++        +       D   T+ F +   ++++A+  D  + +++ 
Sbjct: 66  PIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASD-DQTIRIWNW 124

Query: 319 RNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN--------------- 363
           +N    +  + GH   +   +F P TD +++S+  D  + +WDI+               
Sbjct: 125 QNRK-EIACLTGHNHFVMCAQFHP-TDDLIVSASLDETIRIWDISGLRKRHSAPGTNSFE 182

Query: 364 -DIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCS 420
             + A+Q   D   G   V  I  GH   VN  S +P +P L+ SA ++  +++W+ S
Sbjct: 183 EQMNAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSASDDRQVKLWRMS 239

>Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}
           similar to Ashbya gossypii AGL190W
          Length = 374

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/245 (22%), Positives = 105/245 (42%), Gaps = 43/245 (17%)

Query: 159 MPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDD 218
           + +N  + A  +GS  +F  N     Q   ++  + H+   +  ++N  DK   LS S D
Sbjct: 72  LHENQVLAAQGDGSLRLFDIN----LQKYPVAIFQEHEREVFSCNWNLIDKQTFLSSSWD 127

Query: 219 GTIALWD------------------IQENSTLAKKPLKI-------WDSVHNDIVNDCKW 253
           GT+ +W                   +  +ST+ K+ + +       + S + D +    +
Sbjct: 128 GTVKIWSPARKQSLRTLLPTPTNNTVLVDSTVLKQDVPVSNQAQHKYSSNNKDCIYQALY 187

Query: 254 NEFNSNVFASVSEDSTLQLHDQREQ-NTIINSIKTTDPFNTLA--FSKHSQYLMAAAGTD 310
           +  +SN+  S S +S + + D R+  NT   S         L   F+K+  +++A  G D
Sbjct: 188 SPHDSNLVMSCSGNSYVSIFDIRQPVNTEQQSFIAHRGLEALTCDFNKYRPHIVATGGVD 247

Query: 311 SLVYLYD----------SRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMW 360
            L+ ++D          +R+  V +  M GH  ++  + +SPH   +L+S+  D     W
Sbjct: 248 KLIKVWDLRMVRQSLLHTRSSPVSINEMQGHSLAVRRVFWSPHHSDMLLSTSYDMTCRTW 307

Query: 361 -DIND 364
            D+ D
Sbjct: 308 QDLTD 312

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/249 (22%), Positives = 107/249 (42%), Gaps = 34/249 (13%)

Query: 171 GSGTVFIYNQSNDKQSALISTLRFHKENG-YGLSFNPNDKGKLLSGSDDGTIALWDIQEN 229
           G+G +FI + +   Q  ++ +  F  ++G + +++N   + ++L+   DG++ L+DI   
Sbjct: 37  GNGKLFILDIT--PQGKIVESNSFLTKDGLFDVAWNELHENQVLAAQGDGSLRLFDIN-- 92

Query: 230 STLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTD 289
             L K P+ I+   H   V  C WN  +   F S S D T+++     + ++   + T  
Sbjct: 93  --LQKYPVAIFQE-HEREVFSCNWNLIDKQTFLSSSWDGTVKIWSPARKQSLRTLLPT-- 147

Query: 290 PFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLI 349
           P N       +        ++   + Y S N           +D I    +SPH   +++
Sbjct: 148 PTNNTVLVDSTVLKQDVPVSNQAQHKYSSNN-----------KDCIYQALYSPHDSNLVM 196

Query: 350 SSGNDRRVIMWDIND-IGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASA 408
           S   +  V ++DI   +  EQ          +  + H G  +   DF  N   P ++A+ 
Sbjct: 197 SCSGNSYVSIFDIRQPVNTEQ----------QSFIAHRGLEALTCDF--NKYRPHIVATG 244

Query: 409 EEENIIQVW 417
             + +I+VW
Sbjct: 245 GVDKLIKVW 253

>KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]
           {ON} similar to uniprot|Q12417 Saccharomyces cerevisiae
           YPL151C PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 434

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 79/168 (47%), Gaps = 24/168 (14%)

Query: 202 LSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVF 261
           +  +P D     +GS+D TI +WD      LA   LKI    H   V D   ++ +  +F
Sbjct: 128 VCVDPVDNEWFATGSNDTTIKIWD------LAAGKLKITLIGHVMSVRDIAISKRHPYMF 181

Query: 262 ASVSEDSTLQLHDQREQNTII-------NSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVY 314
            S SED  ++  D  E+NT I       + + T D   +L        ++A AG D++V 
Sbjct: 182 -SASEDKLVKCWDL-ERNTAIRDFHGHLSGVHTVDVHPSLD-------IIATAGRDAVVR 232

Query: 315 LYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDI 362
           L+D R+ S  +  + GH+  I  ++  P  D  +IS   D  V +WDI
Sbjct: 233 LWDIRSRS-EIMVLPGHKSPINKVKCLP-VDPQIISCSGDATVRLWDI 278

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 70/158 (44%), Gaps = 20/158 (12%)

Query: 261 FASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYD-SR 319
           FA+ S D+T+++ D       I  I        +A SK   Y+ +A+  D LV  +D  R
Sbjct: 138 FATGSNDTTIKIWDLAAGKLKITLIGHVMSVRDIAISKRHPYMFSAS-EDKLVKCWDLER 196

Query: 320 NLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAP 379
           N ++     +GH   +  ++  P  D ++ ++G D  V +WDI               + 
Sbjct: 197 NTAI--RDFHGHLSGVHTVDVHPSLD-IIATAGRDAVVRLWDIR--------------SR 239

Query: 380 EVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
             IM+  GH+S +N     P  P ++ S   +  +++W
Sbjct: 240 SEIMVLPGHKSPINKVKCLPVDPQII-SCSGDATVRLW 276

>NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 103/242 (42%), Gaps = 24/242 (9%)

Query: 188 LISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI 247
           L  TL  H      L+ +      LLS S D T+  W +  +      P++ +   H+ I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKG-HSHI 67

Query: 248 VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAA 307
           V DC   +  +    S S D TL+L D     T    +       ++A  + +  +++ +
Sbjct: 68  VQDCTLTQDGAYAL-SASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGS 126

Query: 308 GTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSP---HTDGV-LISSGNDRRVIMWDIN 363
             D  + ++  +     L ++ GH D ++ +  +P   + D V +IS+GND+ V  W++N
Sbjct: 127 -RDKTIKVWTIKGQC--LATLLGHNDWVSQVRIAPTDQNDDTVTVISAGNDKMVKAWNLN 183

Query: 364 DIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKL 423
                QI  D             GH   VN  + +P+   L+ASA ++  I +W    K 
Sbjct: 184 QF---QIEAD-----------FVGHNGNVNAVTASPDGS-LIASAGKDGEIMLWNLLEKT 228

Query: 424 PI 425
            +
Sbjct: 229 AM 230

>YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}
           TUP1General repressor of transcription, forms complex
           with Cyc8p, involved in the establishment of repressive
           chromatin structure through interactions with histones
           H3 and H4, appears to enhance expression of some genes
          Length = 713

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 105/223 (47%), Gaps = 26/223 (11%)

Query: 202 LSFNPNDKGKLLS-GSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNS-N 259
           + F+P+  GK L+ G++D  I +WDI+      +K + I      DI +    + F S +
Sbjct: 449 VCFSPD--GKFLATGAEDRLIRIWDIEN-----RKIVMILQGHEQDIYS---LDYFPSGD 498

Query: 260 VFASVSEDSTLQLHDQRE-QNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDS 318
              S S D T+++ D R  Q ++  SI+  D   T+A S      +AA   D  V ++DS
Sbjct: 499 KLVSGSGDRTVRIWDLRTGQCSLTLSIE--DGVTTVAVSPGDGKYIAAGSLDRAVRVWDS 556

Query: 319 ------RNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGN-DRRVIMWDINDIGAEQIP 371
                   L     S  GH+DS+ ++ F+   DG  + SG+ DR V +W++ +   +   
Sbjct: 557 ETGFLVERLDSENESGTGHKDSVYSVVFT--RDGQSVVSGSLDRSVKLWNLQNANNKSDS 614

Query: 372 DDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENII 414
                G  EV  I  GH+  V   +   N  ++++ +++  ++
Sbjct: 615 KTPNSGTCEVTYI--GHKDFVLSVATTQNDEYILSGSKDRGVL 655

>Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {ON}
           YDR142C (PEX7) - Member of beta-transducin-related
           (WD-40) protein family [contig 171] FULL
          Length = 367

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/250 (23%), Positives = 110/250 (44%), Gaps = 39/250 (15%)

Query: 171 GSGTVFIYNQSNDKQSALISTLRFHKENG-YGLSFNPNDKGKLLSGSDDGTIALWDIQEN 229
           G+G +FI + +N  Q  +     F  ++G + +++N   + ++L    DG++ L+D Q  
Sbjct: 36  GNGKLFIVDINN--QGIMTEAKSFLTQDGLFDVAWNELHENQVLVAQGDGSLRLFDTQ-- 91

Query: 230 STLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHD-QREQNTIINSIKTT 288
             L   P+ I+   H   V  C WN  N  +F S S D T+++    R ++    + K  
Sbjct: 92  --LTDYPIAIFHE-HEKEVFSCNWNLINKQLFVSSSWDGTVKVWSPTRPKSLATLTPKPM 148

Query: 289 DPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVL 348
              N L  SK              + + + +N +    S++ +++ I   +FSPH   V+
Sbjct: 149 AAQNPLMPSKD-------------IPMSNQQNHT----SLSKNKNCIYQSQFSPHDPNVI 191

Query: 349 ISSGNDRRVIMWDIND-IGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMAS 407
           +S   +  V M+D+    GA Q    A +G   +      +RS +            +A+
Sbjct: 192 MSCAGNSYVTMFDLRQPPGANQYSFLAHNGMETLTCDFNKYRSHI------------VAT 239

Query: 408 AEEENIIQVW 417
              +N+I+VW
Sbjct: 240 GGVDNMIKVW 249

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 101/218 (46%), Gaps = 45/218 (20%)

Query: 189 ISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDI---QENSTLAKKPLKIWD---- 241
           I+    H++  +  ++N  +K   +S S DGT+ +W     +  +TL  KP+   +    
Sbjct: 97  IAIFHEHEKEVFSCNWNLINKQLFVSSSWDGTVKVWSPTRPKSLATLTPKPMAAQNPLMP 156

Query: 242 ---------------SVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQRE-----QNTI 281
                          S + + +   +++  + NV  S + +S + + D R+     Q + 
Sbjct: 157 SKDIPMSNQQNHTSLSKNKNCIYQSQFSPHDPNVIMSCAGNSYVTMFDLRQPPGANQYSF 216

Query: 282 I--NSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSR-------NLSVPLYSMN--- 329
           +  N ++T     T  F+K+  +++A  G D+++ ++D R       N   P+ S+N   
Sbjct: 217 LAHNGMETL----TCDFNKYRSHIVATGGVDNMIKVWDLRMVRKAASNSRQPM-SVNEIC 271

Query: 330 GHEDSITNLEFSPHTDGVLISSGNDRRVIMW-DINDIG 366
           GH+ +I  + +SPH   +L+S+  D    +W D++D G
Sbjct: 272 GHDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQDLSDDG 309

>CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072c
          Length = 517

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 65/301 (21%), Positives = 118/301 (39%), Gaps = 75/301 (24%)

Query: 164 DIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNP------NDKGKLLSGSD 217
           ++IAT +   T+ +++  + K   L   LR H +    L++ P        K +L S S 
Sbjct: 201 EVIATGSMDNTIRLWDAESGK--PLGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASK 258

Query: 218 DGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQRE 277
           DGTI +WD      L           H + V+  KW      +  S S D T++  D ++
Sbjct: 259 DGTIRIWDSSRRVCLMTL------GGHTNSVSCVKWG--GEGILYSGSHDKTVRAWDMKQ 310

Query: 278 QNTIINSIKTTDPF-NTLAFS--------------------------------------- 297
               IN +K+   + N L+ S                                       
Sbjct: 311 NGKCINILKSHAHWVNHLSLSTDYALRVGAFDYTGVKPANAKEARDKALQNYEKVARKNG 370

Query: 298 KHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDG-VLISSGNDRR 356
           KH + LM  A  D  ++L++    + P+  M GH+  + ++ FSP  DG  ++S+  D  
Sbjct: 371 KHEE-LMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSP--DGKYIVSASFDNS 427

Query: 357 VIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQV 416
           + +W            D ++G    +    GH ++V   + + +   L+ S  ++  ++V
Sbjct: 428 IKLW------------DGKEGT--FLSTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKV 472

Query: 417 W 417
           W
Sbjct: 473 W 473

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 84/173 (48%), Gaps = 21/173 (12%)

Query: 203 SFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFA 262
           +F P+   ++++G  D T  +WD    +       K+  + H + V    W+  +  V A
Sbjct: 152 AFAPHTSSRVVTGGGDNTARIWDCDTQTP------KVTLNGHRNWVLCVSWSA-DGEVIA 204

Query: 263 SVSEDSTLQLHDQREQNTIINSIK---------TTDPFNTLAFSKHSQYLMAAAGTDSLV 313
           + S D+T++L D      + ++++         T +P + +     S+  +A+A  D  +
Sbjct: 205 TGSMDNTIRLWDAESGKPLGDALRGHSKWITSLTWEPIHLV--EPGSKPRLASASKDGTI 262

Query: 314 YLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIG 366
            ++DS +  V L ++ GH +S++ +++    +G+L S  +D+ V  WD+   G
Sbjct: 263 RIWDS-SRRVCLMTLGGHTNSVSCVKWG--GEGILYSGSHDKTVRAWDMKQNG 312

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 44/99 (44%), Gaps = 15/99 (15%)

Query: 327 SMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHA 386
           ++ GH  +I    F+PHT   +++ G D    +W            D +   P+V +   
Sbjct: 140 AIAGHGATILCSAFAPHTSSRVVTGGGDNTARIW------------DCDTQTPKVTL--N 185

Query: 387 GHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPI 425
           GHR+ V   S + +   ++A+   +N I++W      P+
Sbjct: 186 GHRNWVLCVSWSADGE-VIATGSMDNTIRLWDAESGKPL 223

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 60/259 (23%), Positives = 115/259 (44%), Gaps = 52/259 (20%)

Query: 188 LISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI 247
           ++ TL+ H+++ Y L + P+   KL+SGS D T+ +WD++         L I D V    
Sbjct: 412 IVMTLQGHEQDIYSLDYFPSGD-KLVSGSGDRTVRIWDLRTGQ--CSLTLSIEDGVTTVA 468

Query: 248 VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNT--------LAFSKH 299
           V+  +         A+ S D TL++ D  E   ++  + + +   T        + F++ 
Sbjct: 469 VSPGE-----GKFIAAGSLDRTLRVWDS-ETGFLVERLDSENELGTGHKDSVYSVVFTRD 522

Query: 300 SQYLMAAAGTDSLVYLYD-------SRNLSVPL-----YSMNGHEDSITNLEFSPHTDGV 347
            Q +++ +  D  V L++       S+N S P       +  GH+D + ++  +   D  
Sbjct: 523 GQGVVSGS-LDRSVKLWNLHNTGSSSKNDSKPTAATCEVTYTGHKDFVLSVATT-QNDKY 580

Query: 348 LISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAV------NDFSINPNI 401
           ++S   DR V+ W            D + G P  +++  GHR++V      N F + P+ 
Sbjct: 581 ILSGSKDRGVLFW------------DTQSGNP--LLMLQGHRNSVISVAVANGFPLGPDY 626

Query: 402 PWLMASAEEENIIQVWKCS 420
             + A+   +   ++WK S
Sbjct: 627 -GVFATGSGDCKARIWKYS 644

>Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON}
           YCR084C (REAL)
          Length = 709

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 106/223 (47%), Gaps = 26/223 (11%)

Query: 202 LSFNPNDKGKLLS-GSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNS-N 259
           + F+P+  GK L+ G++D  I +WDI++     +K + I      DI +    + F S +
Sbjct: 445 VCFSPD--GKFLATGAEDRLIRIWDIEK-----RKIVMILQGHEQDIYS---LDYFPSGD 494

Query: 260 VFASVSEDSTLQLHDQRE-QNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDS 318
              S S D T+++ D R  Q ++  SI+  D   T+A S      +AA   D  V ++DS
Sbjct: 495 KLVSGSGDRTVRIWDLRTGQCSLTLSIE--DGVTTVAVSPGDGKYIAAGSLDRAVRVWDS 552

Query: 319 ------RNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGN-DRRVIMWDINDIGAEQIP 371
                   L     S  GH+DS+ ++ F+   DG  + SG+ DR V +W++ +   +   
Sbjct: 553 ETGFLVERLDSENESGTGHKDSVYSVVFT--RDGHSVVSGSLDRSVKLWNLQNANNKSDS 610

Query: 372 DDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENII 414
                G  EV  I  GH+  V   +   N  ++++ +++  ++
Sbjct: 611 KAPNSGTCEVTYI--GHKDFVLSVATTQNDEYILSGSKDRGVL 651

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 96/237 (40%), Gaps = 68/237 (28%)

Query: 181 SNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIW 240
           S  K+++  +TL  H    Y +SF+P+++  L+S S+D T+ LW +   + L      + 
Sbjct: 512 SKSKEASNTTTLIGHSGPVYSVSFSPDNR-YLVSASEDKTVRLWSLDTFTCL------VS 564

Query: 241 DSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHS 300
              HN  V D K++    + FA+VS D T +L                            
Sbjct: 565 YKGHNHPVWDVKFSPLG-HYFATVSHDQTARLW--------------------------- 596

Query: 301 QYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMW 360
                     S  ++Y       PL    GH + +  + F P+   VL  S +D+   MW
Sbjct: 597 ----------SCDHIY-------PLRIFAGHLNDVDCVAFHPNGTYVLTGS-SDKTCRMW 638

Query: 361 DINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
           DI      Q  D         + +  GH ++V   +++P+  WL  +  E+ +I VW
Sbjct: 639 DI------QTGDS--------VRLFLGHTASVVSVAVSPDGRWL-TTGSEDGVIIVW 680

>KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 755

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 95/238 (39%), Gaps = 29/238 (12%)

Query: 189 ISTLRFHKENGYGLSFNPNDKGKLLS-GSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI 247
           +    FH  N    S   +D  +L S G  D  + +W +      +K P K  D   N+ 
Sbjct: 418 VCMYTFHNTNSEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSK-QDERSNNA 476

Query: 248 VNDCKWNEFNSNVFA-------SVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHS 300
                     S  F+       S SED T++L       ++++      P   +AFS   
Sbjct: 477 TLVGHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPLG 536

Query: 301 QYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGN-DRRVIM 359
            Y  A A  D    L+   ++  PL    GH + +  + F  H +G  + +G+ D+   M
Sbjct: 537 HYF-ATASHDQTARLWSCDHI-YPLRIFAGHLNDVDTVSF--HPNGTYVFTGSSDKTCRM 592

Query: 360 WDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
           WD++                + + +  GH + V   +++P+  WL ++  E+ II VW
Sbjct: 593 WDMS--------------TGDSVRLFLGHTAPVTATAVSPDGRWL-STGSEDGIINVW 635

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 89/216 (41%), Gaps = 42/216 (19%)

Query: 190 STLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTL-------------AKKP 236
           +TL  H    Y  +F+P+++  LLS S+D T+ LW     ++L             A  P
Sbjct: 476 ATLVGHSGTVYSTAFSPDNR-YLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSP 534

Query: 237 L-------------KIWDSVH-------NDIVNDCKWNEFNSN---VFASVSEDSTLQLH 273
           L             ++W   H          +ND     F+ N   VF   S D T ++ 
Sbjct: 535 LGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTG-SSDKTCRMW 593

Query: 274 DQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGH-E 332
           D    +++   +  T P    A S   ++L +    D ++ ++D       L  M GH +
Sbjct: 594 DMSTGDSVRLFLGHTAPVTATAVSPDGRWL-STGSEDGIINVWDI-GTGKRLKQMRGHGK 651

Query: 333 DSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAE 368
           +++ +L +S     VL+S G D  + +WD+    AE
Sbjct: 652 NAVYSLSYSKEGH-VLVSGGADHSLRVWDVKKSTAE 686

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 57/135 (42%), Gaps = 28/135 (20%)

Query: 303 LMAAAGTDSLVYLY--DSRNLSVPLYS----------MNGHEDSITNLEFSPHTDGVLIS 350
           L +A   DS+V ++  D   LS  L S          + GH  ++ +  FSP  +  L+S
Sbjct: 441 LASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNNATLVGHSGTVYSTAFSPD-NRYLLS 499

Query: 351 SGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEE 410
           +  D+ V +W  +   +              ++ + GH   + D + +P +    A+A  
Sbjct: 500 ASEDKTVRLWSTDTYTS--------------LVSYKGHNHPIWDVAFSP-LGHYFATASH 544

Query: 411 ENIIQVWKCSHKLPI 425
           +   ++W C H  P+
Sbjct: 545 DQTARLWSCDHIYPL 559

>Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON}
           (10035..10568,10902..11324) [957 nt, 319 aa]
          Length = 318

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 106/252 (42%), Gaps = 43/252 (17%)

Query: 188 LISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI 247
           L  TL  H      L+ +      LLS S D T+  W +  N      P++ +   H+ I
Sbjct: 8   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGNDQQYGVPVRSFKG-HSHI 66

Query: 248 VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAA 307
           V DC      +    S S D TL+L +          + T + +    F+ H   +M+ A
Sbjct: 67  VQDCALTADGAYAL-SASWDKTLRLWN----------VATGETYQR--FTGHKSDVMSVA 113

Query: 308 -GTDSLVYLYDSRNLSVPLYS--------MNGHEDSITNLEFSPHTDG-----VLISSGN 353
               + + +  SR+ ++ +++        M GH D ++ +  +P+ +       LIS+G 
Sbjct: 114 IDRKASMIISGSRDKTIKVWTIKGDCLATMLGHNDWVSQVRVAPNENEDDETVRLISAGM 173

Query: 354 DRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENI 413
           D+ V  W++N     QI  D             GH + +N  + +P+   L+ASA ++  
Sbjct: 174 DKMVKAWNVNQF---QIEAD-----------FVGHNNYINTITASPDGT-LIASAGKDGD 218

Query: 414 IQVWKCSHKLPI 425
           I +W    K P+
Sbjct: 219 IMLWNLKEKSPL 230

>CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} similar
           to uniprot|P16649 Saccharomyces cerevisiae YCR084c TUP1
           general transcription repressor
          Length = 643

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 103/244 (42%), Gaps = 52/244 (21%)

Query: 185 QSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVH 244
           Q  ++  LR H+++ Y L +  +   KL+SGS D TI +WD+          L I D V 
Sbjct: 404 QRKIVMVLRGHEQDIYSLDYFQSGN-KLVSGSGDRTIRIWDLHTGQ--CSLTLSIEDGVT 460

Query: 245 NDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLM 304
              V+       N N  A+ S D T+++ D                              
Sbjct: 461 TVAVSPG-----NGNYVAAGSLDRTVRVWD------------------------------ 485

Query: 305 AAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGN-DRRVIMWDIN 363
             + +  LV   DS        +  GH+DS+ ++ F+   DG  I SG+ DR V +W++ 
Sbjct: 486 --SNSGFLVERLDSEG-----ETGVGHKDSVYSVVFT--RDGKNIVSGSLDRSVKLWNLR 536

Query: 364 DI-GAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHK 422
           +I GA   P    +G  E  M + GH+  V   +   N  ++++ +++  +I  W     
Sbjct: 537 NINGASTSPQPKTEGNCE--MTYIGHKDFVLSVTTTENDQYILSGSKDRGVI-FWDKVSG 593

Query: 423 LPIV 426
           +P++
Sbjct: 594 VPLL 597

>KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {ON}
           Anc_5.201 YLL011W
          Length = 485

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 94/210 (44%), Gaps = 31/210 (14%)

Query: 164 DIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIAL 223
           ++I   NGSG             AL+ T  F+ E+ +    +  +K   ++G     I L
Sbjct: 161 ELITKTNGSG-------------ALLKT--FYGEHAFQGIDHHREKPLFVTGG--AKIEL 203

Query: 224 WDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQN---T 280
           WD   ++ L       W +   D +   K+N+  +++ AS   D+++ L+D R  +    
Sbjct: 204 WDNNRSTPLTNLS---WGA---DNITSLKFNQSETDIVASAGSDNSVVLYDLRTNSPTQK 257

Query: 281 IINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEF 340
           I+ S++T    N + ++    +    A  D   Y YD RN+S  L     H  ++ +++F
Sbjct: 258 IVQSMRT----NAICWNPMEPFNFVVANEDHNAYYYDMRNMSRSLNVFKDHVSAVMDVDF 313

Query: 341 SPHTDGVLISSGNDRRVIMWDINDIGAEQI 370
           SP  D ++  S  D+ + ++  N   + +I
Sbjct: 314 SPTGDEIVTGS-YDKTIRIFKTNQGHSREI 342

 Score = 37.0 bits (84), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 42/210 (20%), Positives = 84/210 (40%), Gaps = 46/210 (21%)

Query: 161 QNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNP--------NDKGKL 212
            N + +AT +G G +  +N S  ++     + + H     GL   P        +++  +
Sbjct: 78  HNLNKLATASGDGVIKYWNMSTREEYV---SFKGHYGLVTGLCVTPEGLSVGGLSNQNHM 134

Query: 213 LSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQL 272
           LS  DD TI LW I                              N++ FA++  D  L +
Sbjct: 135 LSCGDDKTIKLWSI------------------------------NNDDFANIKSDEEL-I 163

Query: 273 HDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHE 332
                   ++ +      F  +   +     +        + L+D+ N S PL +++   
Sbjct: 164 TKTNGSGALLKTFYGEHAFQGIDHHREKPLFVTGGAK---IELWDN-NRSTPLTNLSWGA 219

Query: 333 DSITNLEFSPHTDGVLISSGNDRRVIMWDI 362
           D+IT+L+F+     ++ S+G+D  V+++D+
Sbjct: 220 DNITSLKFNQSETDIVASAGSDNSVVLYDL 249

>Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON}
           YCR084C (REAL)
          Length = 713

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 105/223 (47%), Gaps = 26/223 (11%)

Query: 202 LSFNPNDKGKLLS-GSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNS-N 259
           + F+P+  GK L+ G++D  I +WDI+      +K + I      DI +    + F S +
Sbjct: 449 VCFSPD--GKFLATGAEDRLIRIWDIEN-----RKIVMILQGHEQDIYS---LDYFPSGD 498

Query: 260 VFASVSEDSTLQLHDQRE-QNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDS 318
              S S D T+++ D R  Q ++  SI+  D   T+A S      +AA   D  V ++DS
Sbjct: 499 KLVSGSGDRTVRIWDLRTGQCSLTLSIE--DGVTTVAVSPGDGKYIAAGSLDRAVRVWDS 556

Query: 319 ------RNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGN-DRRVIMWDINDIGAEQIP 371
                   L     S  GH+DS+ ++ F+   DG  + SG+ DR V +W++ +   +   
Sbjct: 557 ETGFLVERLDSENESGTGHKDSVYSVVFT--RDGQSVVSGSLDRSVKLWNLQNANNKSDS 614

Query: 372 DDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENII 414
                G  EV  I  GH+  V   +   N  ++++ +++  ++
Sbjct: 615 KTPNSGTCEVTYI--GHKDFVLSVATTQNDEYILSGSKDRGVL 655

>AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL011W
           (SOF1)
          Length = 479

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 71/152 (46%), Gaps = 23/152 (15%)

Query: 205 NPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLK--IWDSVHNDIVNDCKWNEFNSNVFA 262
           NPN     ++G     I LWD+       KKPL    W     D V+  ++N+   ++ A
Sbjct: 188 NPN----FVTGG--AQIQLWDVNR-----KKPLSNLSWGV---DNVSFVRFNQNEEDILA 233

Query: 263 SVSEDSTLQLHDQREQN---TIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSR 319
           S   D+++ L+D R  +    ++  ++T    N L ++    +  A A  D   Y YD R
Sbjct: 234 STGSDNSIVLYDLRTNSPTQKVVQRMRT----NALCWNPMEPFNFAIANEDHNAYYYDMR 289

Query: 320 NLSVPLYSMNGHEDSITNLEFSPHTDGVLISS 351
           N+S  L+    H  ++ +++FSP  + ++  S
Sbjct: 290 NMSRALHVFKDHVSAVMDVDFSPTGEEIVTGS 321

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 36/187 (19%), Positives = 81/187 (43%), Gaps = 25/187 (13%)

Query: 195 HKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAK-------------KPLKIWD 241
           H++  Y L+ N N   KL SGS DG +  W++     L                P  +  
Sbjct: 66  HRDGCYVLAKNYNVLNKLASGSADGVVKYWNMATREELCSFRAHYGLVTGLCVTPTHLSP 125

Query: 242 SVHNDIVNDC------KWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLA 295
           +  +  +  C      K    NS+ F S+ +D+ + + D  +   ++ +      F ++ 
Sbjct: 126 TKKDSFMLSCGDDKTIKLWSVNSDDFNSIKDDTKI-VSDTGD-GALLKTFYGEHAFQSID 183

Query: 296 FSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDR 355
             + +   +        + L+D  N   PL +++   D+++ + F+ + + +L S+G+D 
Sbjct: 184 HHRRNPNFVTGGAQ---IQLWDV-NRKKPLSNLSWGVDNVSFVRFNQNEEDILASTGSDN 239

Query: 356 RVIMWDI 362
            ++++D+
Sbjct: 240 SIVLYDL 246

 Score = 33.5 bits (75), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 53/132 (40%), Gaps = 18/132 (13%)

Query: 306 AAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSP------HTDGVLISSGNDRRVIM 359
           A+G+   V  Y +      L S   H   +T L  +P        D  ++S G+D+ + +
Sbjct: 84  ASGSADGVVKYWNMATREELCSFRAHYGLVTGLCVTPTHLSPTKKDSFMLSCGDDKTIKL 143

Query: 360 WDINDIGAEQIPDDAE------DGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENI 413
           W +N      I DD +      DGA            +++    NPN  ++   A+    
Sbjct: 144 WSVNSDDFNSIKDDTKIVSDTGDGALLKTFYGEHAFQSIDHHRRNPN--FVTGGAQ---- 197

Query: 414 IQVWKCSHKLPI 425
           IQ+W  + K P+
Sbjct: 198 IQLWDVNRKKPL 209

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 41/98 (41%), Gaps = 7/98 (7%)

Query: 189 ISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIV 248
           +S L +  +N   + FN N++  L S   D +I L+D++ NS   K        V     
Sbjct: 209 LSNLSWGVDNVSFVRFNQNEEDILASTGSDNSIVLYDLRTNSPTQK-------VVQRMRT 261

Query: 249 NDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIK 286
           N   WN      FA  +ED     +D R  +  ++  K
Sbjct: 262 NALCWNPMEPFNFAIANEDHNAYYYDMRNMSRALHVFK 299

>Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 89/224 (39%), Gaps = 44/224 (19%)

Query: 183 DKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKK------- 235
           D       TL  H    Y  SF+P++K  LLSGS+D T+ LW +  ++ L          
Sbjct: 514 DADDPTCKTLVGHSGTVYATSFSPDNK-YLLSGSEDKTVRLWSMDTHTALVSYKGHNHPV 572

Query: 236 ------------------------------PLKIWDSVHNDIVNDCKWNEFNSNVFASVS 265
                                         PL+I+    ND+  DC     N     + S
Sbjct: 573 WDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDV--DCVSFHPNGCYVFTGS 630

Query: 266 EDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPL 325
            D T ++ D    +++   +  T P   +A S   ++L +    D ++ ++D       L
Sbjct: 631 SDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWL-STGSEDGIINIWDI-GTGKRL 688

Query: 326 YSMNGH-EDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAE 368
             M GH +++I +L +S   + VLIS G D  V +WD+     E
Sbjct: 689 KQMRGHGKNAIYSLSYSKEGN-VLISGGADHSVRVWDLKKATTE 731

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 67/156 (42%), Gaps = 20/156 (12%)

Query: 263 SVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLS 322
           S SED T++L        +++      P   + FS    Y  A A  D    L+   ++ 
Sbjct: 544 SGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYF-ATASHDQTARLWSCDHI- 601

Query: 323 VPLYSMNGHEDSITNLEFSPHTDGVLISSGN-DRRVIMWDINDIGAEQIPDDAEDGAPEV 381
            PL    GH + +  + F  H +G  + +G+ D+   MWD++                + 
Sbjct: 602 YPLRIFAGHLNDVDCVSF--HPNGCYVFTGSSDKTCRMWDVS--------------TGDS 645

Query: 382 IMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
           + +  GH + V   +++P+  WL ++  E+ II +W
Sbjct: 646 VRLFLGHTAPVICIAVSPDGRWL-STGSEDGIINIW 680

 Score = 34.7 bits (78), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 43/99 (43%), Gaps = 16/99 (16%)

Query: 327 SMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHA 386
           ++ GH  ++    FSP  +  L+S   D+ V +W ++   A              ++ + 
Sbjct: 522 TLVGHSGTVYATSFSP-DNKYLLSGSEDKTVRLWSMDTHTA--------------LVSYK 566

Query: 387 GHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPI 425
           GH   V D + +P +    A+A  +   ++W C H  P+
Sbjct: 567 GHNHPVWDVNFSP-LGHYFATASHDQTARLWSCDHIYPL 604

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 62/125 (49%), Gaps = 10/125 (8%)

Query: 244 HNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFS-----K 298
           H+  + D  +N  + ++ A+ S D+ +   D R  +       TT  + + A       K
Sbjct: 114 HSRAITDINFNSQHPDILATCSIDTYVHAWDMRSPH---RPFYTTSSWRSSASQVKWNFK 170

Query: 299 HSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVI 358
            S  L ++ G D  V+++D R+ S PL+ + GH   + +++FS   +  ++SS ND  V 
Sbjct: 171 DSNILASSHGND--VFIWDLRHGSTPLHKLTGHNSGVNSIDFSRFEENKIMSSSNDGTVK 228

Query: 359 MWDIN 363
            WD++
Sbjct: 229 FWDLS 233

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 75/185 (40%), Gaps = 12/185 (6%)

Query: 136 KPRSNIKIVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFH 195
           KP SN        H   IT   F  Q+ DI+AT +    V  ++  +  +     T    
Sbjct: 101 KPSSNAIEYALHGHSRAITDINFNSQHPDILATCSIDTYVHAWDMRSPHRP--FYTTSSW 158

Query: 196 KENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNE 255
           + +   + +N  D   +L+ S    + +WD++  ST   K      + HN  VN   ++ 
Sbjct: 159 RSSASQVKWNFKD-SNILASSHGNDVFIWDLRHGSTPLHKL-----TGHNSGVNSIDFSR 212

Query: 256 FNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPF---NTLAFSKHSQYLMAAAGTDSL 312
           F  N   S S D T++  D  ++     +I T  P      L F  H   +M   G ++ 
Sbjct: 213 FEENKIMSSSNDGTVKFWDLSKEEKCQQAITTEFPIWRGRYLPFG-HGYCVMPMIGGNNS 271

Query: 313 VYLYD 317
           VYL D
Sbjct: 272 VYLMD 276

>KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247C Hypothetical ORF
          Length = 420

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/255 (20%), Positives = 108/255 (42%), Gaps = 49/255 (19%)

Query: 153 ITRARFMPQ-NTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYG---------- 201
           I+R ++ P  N+  +AT + S  ++ Y+    ++   +S  R++K  G G          
Sbjct: 108 ISRVQWCPNGNSQQLATCSDSLRLWDYSDFVLQERLNLSFCRYNKSGGQGTVAALGQLPP 167

Query: 202 ---LSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNS 258
                +N  D   ++S S D T  +WD+Q  + +  + +      H+  V D K+   ++
Sbjct: 168 VSSFHWNAVDPNLIISSSIDTTCTVWDLQATNYVKTQLI-----AHDSEVFDVKFLTQST 222

Query: 259 NVFASVSEDSTLQLHDQRE--QNTII---------------------------NSIKTTD 289
            +FAS   D ++++ D R    +TII                           ++   ++
Sbjct: 223 QLFASCGGDGSVRVFDLRSLAHSTIIYEPSSQPTAGSSGDSSAASGGSGSGSNSASSGSN 282

Query: 290 PFNTLAFSKHSQYLMAAAGTDS-LVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVL 348
               L  S     ++A    DS  V + D R     + ++ GH  ++  +++ P    VL
Sbjct: 283 ALLRLEPSPFDPNVVATFAHDSNSVLILDMRYPGAAILTLEGHVGAVNQIQWHPSRHNVL 342

Query: 349 ISSGNDRRVIMWDIN 363
           ++ G+D + ++WD+N
Sbjct: 343 LTCGDDCQALLWDLN 357

>KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {ON}
           Anc_6.363 YCR084C
          Length = 665

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 113/235 (48%), Gaps = 25/235 (10%)

Query: 202 LSFNPNDKGKLLS-GSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNS-N 259
           + F+P+  GK L+ G++D  I +WDIQ+     +K + +      D+ +    + F S +
Sbjct: 389 VCFSPD--GKFLATGAEDKLIRIWDIQQ-----RKIVMVLQGHDQDVYS---LDYFPSGD 438

Query: 260 VFASVSEDSTLQLHDQRE-QNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDS 318
              S S D T+++ D +  Q ++  SI+  D   T+A S      +AA   D  V ++DS
Sbjct: 439 KLVSGSGDRTVRIWDLKTGQCSLTLSIE--DGVTTVAVSPGDGKFIAAGSLDRAVRVWDS 496

Query: 319 RN--LSVPLYSMN----GHEDSITNLEFSPHTDGVLISSGN-DRRVIMWDINDIGAEQIP 371
               L   L S N    GH+DS+ ++ F+   DG  + SG+ DR V +W++ D  A    
Sbjct: 497 ETGFLVERLDSENELGTGHKDSVYSVVFTK--DGNKVVSGSLDRSVKLWNLRDNNANSSS 554

Query: 372 DDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIV 426
           +++        + + GH+  V   +   N  ++++ +++  ++  W      P++
Sbjct: 555 NNSNKSNATCDVTYVGHKDFVLSVTTTANDEYILSGSKDRGVL-FWDTKSGNPLL 608

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 57/265 (21%), Positives = 113/265 (42%), Gaps = 55/265 (20%)

Query: 184 KQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSV 243
           +Q  ++  L+ H ++ Y L + P+   KL+SGS D T+ +WD++         L I D V
Sbjct: 413 QQRKIVMVLQGHDQDVYSLDYFPSGD-KLVSGSGDRTVRIWDLKTGQ--CSLTLSIEDGV 469

Query: 244 HNDIVN--DCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNT-------- 293
               V+  D K+        A+ S D  +++ D  E   ++  + + +   T        
Sbjct: 470 TTVAVSPGDGKF-------IAAGSLDRAVRVWDS-ETGFLVERLDSENELGTGHKDSVYS 521

Query: 294 LAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMN-------------GHEDSITNLEF 340
           + F+K    +++ +  D  V L++ R+ +    S N             GH+D + ++  
Sbjct: 522 VVFTKDGNKVVSGS-LDRSVKLWNLRDNNANSSSNNSNKSNATCDVTYVGHKDFVLSVTT 580

Query: 341 SPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPN 400
           + + D  ++S   DR V+ W            D + G P  +++  GHR++V   ++   
Sbjct: 581 TAN-DEYILSGSKDRGVLFW------------DTKSGNP--LLMLQGHRNSVISVAVANR 625

Query: 401 IPW-----LMASAEEENIIQVWKCS 420
            P      + A+   +   ++WK S
Sbjct: 626 TPLGPKYQVFATGSGDCRARIWKFS 650

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 98/229 (42%), Gaps = 16/229 (6%)

Query: 136 KPRSNIKIVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFH 195
           +P  N+  V    H E +    F P +   ++  +    + I+N SN +Q  ++S    H
Sbjct: 151 QPNFNMVKVMDQAHMECVREISFSPTDQKFVS-CSDDNVLKIWNFSNGQQERVLSG---H 206

Query: 196 KENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNE 255
             +     ++P   G ++SGS D  I  WD +  S ++     +    H  I    K+  
Sbjct: 207 HWDVKSCDWHPK-MGLIVSGSKDNLIKFWDPRSGSCVST----MLGFKHTII--STKFQP 259

Query: 256 FNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYL 315
              N+ + +S+D T +++D R+Q   + S++    + TL +    + +      D  +  
Sbjct: 260 KQGNLLSVISKDKTCKVYDIRQQAKELFSVRDDVDYMTLQWHPIDETVFTVGCYDGSIKH 319

Query: 316 YDSRNLSVPLYSMN----GHEDSITNLEFSPHTDGVLISSGNDRRVIMW 360
           +D    + P    +     HE  +T+L +SP    ++ S+  DR +  W
Sbjct: 320 FDLSQENQPNKPTHNIPYAHEKCVTSLAYSP-IGHIMASASKDRTIRFW 367

>TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa]
           {ON} Anc_8.288 YDR128W
          Length = 1178

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 60/123 (48%), Gaps = 10/123 (8%)

Query: 244 HNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFS-----K 298
           H+  V D  +N  + ++ A+ S D+ +   D R  N       TT  +++ A       K
Sbjct: 113 HSRAVTDITFNFDHPDLLATCSIDTYIHAWDMRSPN---RPFYTTTDWHSGASQVQWNYK 169

Query: 299 HSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVI 358
            S  L +A G D  V ++D R  S PLY ++ H  S+ N++F+ H    +++S ND  V 
Sbjct: 170 QSNILASAQGND--VCIWDLRMGSTPLYKLSDHSGSVNNIDFNKHRGTEIMTSSNDGTVK 227

Query: 359 MWD 361
            WD
Sbjct: 228 FWD 230

>Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]
           {ON} YLR196W (PWP1) - similar to beta-transducin
           superfamily [contig 161] FULL
          Length = 561

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 86/185 (46%), Gaps = 17/185 (9%)

Query: 195 HKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVH-NDIVNDCKW 253
           H +    LS +   +  L S S D T+ LWD+  N+ +A +      S+H N  V+  +W
Sbjct: 274 HTDAVLSLSHSKQFRAVLASTSADHTVKLWDL--NAGIAARSFA---SIHSNKNVSSSQW 328

Query: 254 NEFNSNVFASVSEDSTLQLHDQR----EQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGT 309
           +  + +V  +   DS + L D R     Q +   S+ + +    + F+  +  +    GT
Sbjct: 329 HSTSGSVLLTGGYDSRIALTDVRIADDSQMSKYWSVMSGEEVECVQFADENTIM---CGT 385

Query: 310 DSL-VYLYDSRNL--SVPLYSMNGHEDSITNLEFSPHTDGVLISSG-NDRRVIMWDINDI 365
           DS  VY YD R    S PL+++N H+  I+ L  +P    +L +    ++ V +W  ++ 
Sbjct: 386 DSGNVYSYDIRQGEGSKPLWTLNAHDAGISTLNVNPFIPNLLATGAMGEKTVKLWKCSES 445

Query: 366 GAEQI 370
           G   +
Sbjct: 446 GPSMV 450

>SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1140

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 71/140 (50%), Gaps = 5/140 (3%)

Query: 223 LWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQRE-QNTI 281
           +W++  NST A + +      H   + D  ++  +  + A+ S D+ +   D R  Q   
Sbjct: 95  VWNLSRNSTNAIEHIL---HGHFRAITDINFHPHHPEILATCSVDTYVLAWDMRSPQRPY 151

Query: 282 INSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFS 341
            ++ +     + + ++  +  +MA++ +D  V ++D R    PLY++ GHE S+ N++F+
Sbjct: 152 YSTSEWRAGASQVKWNFRNSNIMASSHSDH-VCIWDLRKGCTPLYTLQGHEGSVNNIDFN 210

Query: 342 PHTDGVLISSGNDRRVIMWD 361
              +  ++SS ND  V  WD
Sbjct: 211 KAKETEIMSSSNDGTVKFWD 230

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 79/202 (39%), Gaps = 21/202 (10%)

Query: 149 HEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPND 208
           H   IT   F P + +I+AT +    V  ++  +  Q    ST  + +     + +N  +
Sbjct: 113 HFRAITDINFHPHHPEILATCSVDTYVLAWDMRS-PQRPYYSTSEW-RAGASQVKWNFRN 170

Query: 209 KGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDS 268
              + S   D  + +WD+++  T    PL      H   VN+  +N+       S S D 
Sbjct: 171 SNIMASSHSD-HVCIWDLRKGCT----PLYTLQG-HEGSVNNIDFNKAKETEIMSSSNDG 224

Query: 269 TLQLHDQREQNTIINSIKTTD-PF---NTLAFSKHSQYLMAAAGTDSLVYLY-------- 316
           T++  D    +T       TD P      L F + S  +    G +SL YL         
Sbjct: 225 TVKFWDYSVSDTKPRHTIVTDFPVWRGRYLPFGEGSCIMPIIGGNNSL-YLVNNDGHGGN 283

Query: 317 DSRNLSVPLYSMNGHEDSITNL 338
           +  +   P+Y   GH D +T+ 
Sbjct: 284 EKTSRMQPVYIFKGHTDRVTDF 305

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 21/35 (60%)

Query: 328 MNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDI 362
           ++GH  +IT++ F PH   +L +   D  V+ WD+
Sbjct: 110 LHGHFRAITDINFHPHHPEILATCSVDTYVLAWDM 144

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 90/181 (49%), Gaps = 16/181 (8%)

Query: 189 ISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQEN---STLAKKPLKIWDSVHN 245
           + ++ F  +N + L   P     LL+   +G++ L D  +N   S +      I D V  
Sbjct: 6   VDSINFGADN-WCLKLQPLYNRGLLASLSNGSVQLIDWVKNKQISQIQAHGTTISDMV-- 62

Query: 246 DIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIIN-SIKTTDPFNTLAFSKHSQYLM 304
            ++N+ + N F   + A+ +EDS +++ D R  +T+     + + PF +L  S+H     
Sbjct: 63  -VLNNDRNNGF---LIATAAEDS-VKIFDLRSSDTVATLKNEKSAPFLSLD-SRHGMLAC 116

Query: 305 AA--AGTDSLVYLYDSRNLSVPLYSM-NGHEDSITNLEFSPHTDGVLISSGNDRRVIMWD 361
               +G D+ +++YD +    PL S+ + H D ITN++F P    VL+S   D  V ++D
Sbjct: 117 GTELSGVDAELHIYDMKAWHQPLRSLVDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIYD 176

Query: 362 I 362
           +
Sbjct: 177 L 177

>Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON}
           YCR084C (REAL)
          Length = 700

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 105/223 (47%), Gaps = 26/223 (11%)

Query: 202 LSFNPNDKGKLLS-GSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNS-N 259
           + F+P+  GK L+ G++D  I +WDI+      +K + I      DI +    + F S +
Sbjct: 453 VCFSPD--GKFLATGAEDRLIRIWDIEN-----RKIVMILQGHEQDIYS---LDYFPSGD 502

Query: 260 VFASVSEDSTLQLHDQRE-QNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDS 318
              S S D T+++ D R  Q ++  SI+  D   T+A S      +AA   D  V ++DS
Sbjct: 503 KLVSGSGDRTVRIWDLRTGQCSLTLSIE--DGVTTVAVSPGDGKYIAAGSLDRAVRVWDS 560

Query: 319 ------RNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGN-DRRVIMWDINDIGAEQIP 371
                   L     S  GH+DS+ ++ F+   DG  + SG+ DR V +W++ +   +   
Sbjct: 561 ETGFLVERLDSENESGTGHKDSVYSVVFT--RDGESVVSGSLDRSVKLWNLQNANNKSDS 618

Query: 372 DDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENII 414
                G  EV  I  GH+  V   +   N  ++++ +++  ++
Sbjct: 619 KTPNSGTCEVTYI--GHKDFVLSVATTQNDEYILSGSKDRGVL 659

>Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/238 (21%), Positives = 103/238 (43%), Gaps = 32/238 (13%)

Query: 201 GLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSN- 259
           G++F+P+ +  +L      TI LWD +  + L +           D     +  +F+   
Sbjct: 16  GIAFHPS-RPWVLVALFSSTIQLWDYRMGTLLHR---------FEDHEGPVRGLDFHPTQ 65

Query: 260 -VFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDS 318
            +F S  +D T+++        +       D   T+ F +   ++++A+  D  + +++ 
Sbjct: 66  PIFVSAGDDYTIKVWSLDTNKCLYTLSGHLDYVRTVFFHRELPWIISASD-DQTIRIWNW 124

Query: 319 RNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN--------------- 363
           +N    +  + GH   +   +F P TD +++S+  D  + +WDI+               
Sbjct: 125 QNRK-EIACLTGHNHFVMCAQFHP-TDDLIVSASLDETIRIWDISGLRKRHSAPGTNSFE 182

Query: 364 -DIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCS 420
             + A+Q   D   G   V  I  GH   VN  S +P +P L+ SA ++  +++W+ S
Sbjct: 183 EQMNAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSASDDRQVKLWRMS 239

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 39/70 (55%)

Query: 299 HSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVI 358
           H    + A    ++VY++D R  + PL  + GH  S+ +++F+P  +  ++SSGND  V 
Sbjct: 168 HKNSNVLATSHSNIVYVWDVRKGTSPLSVLEGHSGSVNSIDFNPFNETEIMSSGNDGTVK 227

Query: 359 MWDINDIGAE 368
            WD N +  E
Sbjct: 228 FWDYNKVEDE 237

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 63/260 (24%), Positives = 107/260 (41%), Gaps = 34/260 (13%)

Query: 138 RSNIKIVKKF--KHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFH 195
           RS+ K V+     H   IT   F P   +I+AT     ++  Y  + D +S      R  
Sbjct: 100 RSSSKAVEHVLHGHFRAITDINFHPLQPEILAT----SSIDTYALAWDMRSPKKPYFRTS 155

Query: 196 KENGYGLSFNPNDK-GKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWN 254
                      N K   +L+ S    + +WD+++ ++    PL + +  H+  VN   +N
Sbjct: 156 NWRSGAAQVKWNHKNSNVLATSHSNIVYVWDVRKGTS----PLSVLEG-HSGSVNSIDFN 210

Query: 255 EFNSNVFASVSEDSTLQLHD-QREQNTIINSIKTTDPF---NTLAFSKHSQYLMAAAGTD 310
            FN     S   D T++  D  + ++ +  +I T  P      L F      +M   G +
Sbjct: 211 PFNETEIMSSGNDGTVKFWDYNKVEDELQMTITTEFPVWRGRYLPFGD-GYCIMPMIGGN 269

Query: 311 SLVYL----YDSRNLSV------PLYSMNGHEDSITNLEF-SPHTDGVLISSGNDR--RV 357
           + VYL    +DS N         P Y   GH D +T+  + S H+   +I   +DR  ++
Sbjct: 270 NSVYLANSFHDSGNSESRTTKLQPTYVFKGHTDRVTDFLWRSRHSQNTII---DDREFQL 326

Query: 358 IMWDIN-DIGAEQIPDDAED 376
           + W  + D+    +PD   D
Sbjct: 327 VTWSKDCDLRLWPVPDMVYD 346

>Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/238 (21%), Positives = 103/238 (43%), Gaps = 32/238 (13%)

Query: 201 GLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSN- 259
           G++F+P+ +  +L      TI LWD +  + L +           D     +  +F+   
Sbjct: 16  GIAFHPS-RPWVLVALFSSTIQLWDYRMGTLLHR---------FEDHEGPVRGLDFHPTQ 65

Query: 260 -VFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDS 318
            +F S  +D T+++        +       D   T+ F +   ++++A+  D  + +++ 
Sbjct: 66  PIFVSAGDDYTIKVWSLDTNKCLYTLSGHLDYVRTVFFHRELPWIISASD-DQTIRIWNW 124

Query: 319 RNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN--------------- 363
           +N    +  + GH   +   +F P TD +++S+  D  + +WDI+               
Sbjct: 125 QNRK-EIACLTGHNHFVMCAQFHP-TDDLIVSASLDETIRIWDISGLRKRHSAPSNNSFE 182

Query: 364 -DIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCS 420
             + A+Q   D   G   V  I  GH   VN  S +P +P L+ SA ++  +++W+ S
Sbjct: 183 EQLNAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSASDDRQVKLWRMS 239

>KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {ON}
           Anc_6.276 YPL247C
          Length = 504

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 78/174 (44%), Gaps = 19/174 (10%)

Query: 204 FNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFAS 263
           +N  D   L+S S D T  +WD+Q  + +  + +      H+  V D ++   ++++FAS
Sbjct: 254 WNTVDTNLLVSSSIDTTCIVWDLQSPNYVKTQLI-----AHDSEVYDVRFLSQSTHLFAS 308

Query: 264 VSEDSTLQLHDQRE-------------QNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTD 310
              D ++++ D R              + T+ +     +    L  S     ++A    D
Sbjct: 309 CGGDGSVRVFDLRSLAHSTIVYEPPAGEGTVNDVTAQNNALLRLEPSLMDPNIIATLVAD 368

Query: 311 SL-VYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN 363
           S  + + D RN   P  ++ GH   +  +++ P    VL+S  +D +V+ WD+N
Sbjct: 369 SKDILILDMRNPESPALTLKGHSSLVNQIKWHPTKRNVLLSCSDDCQVLYWDLN 422

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 61/145 (42%), Gaps = 32/145 (22%)

Query: 149 HEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLS----- 203
           H+ E+   RF+ Q+T + A+  G G+V ++    D +S   ST+ +    G G       
Sbjct: 289 HDSEVYDVRFLSQSTHLFASCGGDGSVRVF----DLRSLAHSTIVYEPPAGEGTVNDVTA 344

Query: 204 ------------FNPNDKGKLLSGSDDGTIALWDIQ--ENSTLAKKPLKIWDSVHNDIVN 249
                        +PN    L++ S D  I + D++  E+  L  K        H+ +VN
Sbjct: 345 QNNALLRLEPSLMDPNIIATLVADSKD--ILILDMRNPESPALTLKG-------HSSLVN 395

Query: 250 DCKWNEFNSNVFASVSEDSTLQLHD 274
             KW+    NV  S S+D  +   D
Sbjct: 396 QIKWHPTKRNVLLSCSDDCQVLYWD 420

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 71/173 (41%), Gaps = 5/173 (2%)

Query: 248 VNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDP-FNTLAFSKHSQYLMAA 306
           V    WN  ++N+  S S D+T  + D +  N +   +   D     + F   S +L A+
Sbjct: 249 VTSFDWNTVDTNLLVSSSIDTTCIVWDLQSPNYVKTQLIAHDSEVYDVRFLSQSTHLFAS 308

Query: 307 AGTDSLVYLYDSRNL--SVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIND 364
            G D  V ++D R+L  S  +Y     E ++ ++    +    L  S  D  +I   + D
Sbjct: 309 CGGDGSVRVFDLRSLAHSTIVYEPPAGEGTVNDVTAQNNALLRLEPSLMDPNIIATLVAD 368

Query: 365 IGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
                I D     +P + +   GH S VN    +P    ++ S  ++  +  W
Sbjct: 369 SKDILILDMRNPESPALTL--KGHSSLVNQIKWHPTKRNVLLSCSDDCQVLYW 419

>KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON}
           Anc_4.122 YGL003C
          Length = 617

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 77/157 (49%), Gaps = 14/157 (8%)

Query: 212 LLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQ 271
           L  G  +G + ++D  +   +         S H D V    WN   +++ +S S D  + 
Sbjct: 368 LAVGQRNGLVEIYDAVKGKCIRTL------SGHVDRVACLSWN---NHILSSGSRDHRIL 418

Query: 272 LHDQREQNTIINSIKT-TDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNG 330
             D R  +     I++ T     L ++     L A+ G D++V++YD  + + P+ ++N 
Sbjct: 419 HRDVRMPDPFFERIESHTQEVCGLKWNVDENKL-ASGGNDNIVHVYDGTSRT-PMLTLNE 476

Query: 331 HEDSITNLEFSPHTDGVLISSGN--DRRVIMWDINDI 365
           H+ ++  + +SPH  G+L + G   DR + +W+IN++
Sbjct: 477 HKAAVKAIAWSPHKRGILATGGGTADRCLKIWNINNL 513

>NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 76/167 (45%), Gaps = 38/167 (22%)

Query: 212 LLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQ 271
           L  G  +G + ++D+     + +K ++   S H D V    WN    ++  S S      
Sbjct: 346 LAVGQGNGLVEIYDV-----VKRKCVRTL-SGHVDRVACLSWN---GHILTSGS------ 390

Query: 272 LHDQREQNTIINSIKTTDPFNTLAFSKHSQYL-----------MAAAGTDSLVYLYD--S 318
               R+ N +   ++  DPF     + HSQ +           +A+ G D++V +YD  S
Sbjct: 391 ----RDHNILHRDVRMPDPFFE-RLNTHSQEVCGLQWNTEENKLASGGNDNVVCVYDGTS 445

Query: 319 RNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGN--DRRVIMWDIN 363
           RN   P+     H+ ++  L +SPH  G+L + G   DRR+  W++N
Sbjct: 446 RN---PMIKFIEHKAAVKALAWSPHKRGILATGGGTVDRRLKTWNVN 489

>KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 471

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 76/179 (42%), Gaps = 54/179 (30%)

Query: 185 QSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVH 244
           QS +I  L  H +  YG+S++PN    + +GS DGT+ +WDI++       P  I    H
Sbjct: 343 QSLMI--LEGHAKPIYGVSWSPNGH-HVATGSADGTVKVWDIRK----VGNPFSIL--AH 393

Query: 245 NDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLM 304
           N+IV+D K+++ +     S S D T+             S+  +D +  LA         
Sbjct: 394 NNIVSDVKFDKVSGRTLVSSSYDKTV-------------SVFASDSWLRLA--------- 431

Query: 305 AAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDIN 363
                                 S+ GH D + +++ S H    L SSG DR V +W + 
Sbjct: 432 ----------------------SLKGHTDKVMSIDIS-HDFSHLYSSGWDRSVKLWKLG 467

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 87/180 (48%), Gaps = 18/180 (10%)

Query: 191 TLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVND 250
           T+ F  +N + L   P     LLS   +G + L D    +++   P      VH   ++ 
Sbjct: 8   TISFGSDN-WCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIP------VHGTSISA 60

Query: 251 CKW--NEFNS-NVFASVSEDSTLQLHDQREQNTIINSIKTT--DPFNTLAFSKHSQYLMA 305
            K   N+ +S N F + SEDS +++ D R  N  + +++     PF +L  S+H      
Sbjct: 61  LKVLDNDVDSGNTFVTASEDS-VKIFDLR-LNQCVATVQNAKNSPFISLD-SRHGMLACG 117

Query: 306 A--AGTDSLVYLYDSRNLSVPLYSM-NGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDI 362
              +GTD+ ++LYD + +  P+ S  + H D IT+++F      VL+S   D  V ++D+
Sbjct: 118 TELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDL 177

>CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa]
           {ON} similar to uniprot|Q08281 Saccharomyces cerevisiae
           YOL138c
          Length = 1336

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 81/204 (39%), Gaps = 27/204 (13%)

Query: 163 TDIIATINGSGTVFIY--NQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGT 220
           +++IA  N S  + +Y  N++   +  +I  L  H        FN +    ++SG  DG 
Sbjct: 249 SNVIAICNNSTDISLYDLNRTTPAEDPMIQILSGHTRAINSFDFNMSQTNLIISGGQDGC 308

Query: 221 IALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNT 280
           + +WDI+ +S   +    +     ND + D KW    S+ FAS+   +  +         
Sbjct: 309 VKVWDIRSDSMKRQGRSDLNIKTANDSIRDVKW--MPSHNFASLPSSADGK--------- 357

Query: 281 IINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEF 340
              S+  + P           Y  A+     ++  YD R  +     +N H      L +
Sbjct: 358 ---SLNISSP----------GYTFASIHDTGVLLKYDLRQTTQVDKKINAHSGPGLCLNW 404

Query: 341 SPHTDGVLISSGNDRRVIMWDIND 364
            PH D  + + G D +  +W + D
Sbjct: 405 HPHQD-YIATGGRDGKCSLWYVGD 427

>KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {ON}
           similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 556

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 69/153 (45%), Gaps = 12/153 (7%)

Query: 212 LLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQ 271
           L  G  +G + ++D+++   +   P       H D V    WN   +++  S S D  + 
Sbjct: 307 LAVGQANGLVKIFDVEKKRCIRTIP------GHIDRVACLSWN---NHILTSGSRDRRIL 357

Query: 272 LHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGH 331
             D R        I+T             +  +A+ G D++V++YD  +   P+ ++  H
Sbjct: 358 HRDVRTPEPCFEEIRTHKQEVCGLKWNVDENQLASGGNDNVVFVYDGTSRK-PILTLAEH 416

Query: 332 EDSITNLEFSPHTDGVLISSGN--DRRVIMWDI 362
             ++  + +SPH  GVL + G   D+R+ +W++
Sbjct: 417 TAAVKAMAWSPHRRGVLATGGGTADKRLKIWNV 449

>NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa]
           {ON} Anc_1.247 YJL112W
          Length = 668

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 105/258 (40%), Gaps = 40/258 (15%)

Query: 138 RSNIKI---VKKFK--HEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTL 192
           RSN  +   +  FK  H + IT   F      +    N   TV I++ S  +Q   + + 
Sbjct: 334 RSNYNLGDKIHSFKSAHTDSITCLDFAKSWNTLCTAANYDNTVKIWDLSTTEQ---LGSF 390

Query: 193 RFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKK-----------PLKIWD 241
             HK     L  + N+   L++GS D T+ +W+I     LAKK           P  +  
Sbjct: 391 SGHKATINCLQMS-NNNSLLMTGSKDATVKVWNIDLGIELAKKENNQLEEKDESPCVLTF 449

Query: 242 SVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHD----QREQNTIINSIKTTDPFNTLAFS 297
             H+D +       F+     S S D T++ +D    +  Q    N    +     +  S
Sbjct: 450 DSHSDEITALS---FDGEYLISASRDKTVRQYDIISGKCFQTLATNFGSISKTNGDMLMS 506

Query: 298 KHS------QYLMAA---AGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVL 348
           ++S      QY   A     +D +  L+D R +   + SM GH  +IT+L+F P     L
Sbjct: 507 RNSPVVGALQYYNTALITGSSDGIARLWDLR-IGKVVRSMEGHNGAITSLQFDPIK---L 562

Query: 349 ISSGNDRRVIMWDINDIG 366
            +S  D  + +WD+   G
Sbjct: 563 TTSSTDGDIRVWDLRTAG 580

>AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR198C
           (TAF5)
          Length = 815

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 93/237 (39%), Gaps = 27/237 (11%)

Query: 189 ISTLRFHKENGYGLSFNPNDKGKLLS-GSDDGTIALWDIQENSTLAKKPLKIWDSV---- 243
           +    FH  N        +D  +L++ G  D  I LW +      ++ P K  D+     
Sbjct: 478 VCMYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVT 537

Query: 244 ---HNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHS 300
              H+  V    ++  N     S SED T++L        +++      P   + FS   
Sbjct: 538 LIGHSGPVYSVSFSPDN-RYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLG 596

Query: 301 QYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMW 360
            Y  A    D    L+   ++  PL    GH + +  + F P+   VL  S +D+   MW
Sbjct: 597 HYF-ATGSHDQTARLWSCDHI-YPLRIFAGHLNDVDCVTFHPNGTYVLTGS-SDKTCRMW 653

Query: 361 DINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVW 417
           DI      Q  D         + +  GH ++V   +++P+  WL  +  E+ +I VW
Sbjct: 654 DI------QTGDS--------VRLFLGHTASVVSVAVSPDGRWL-TTGSEDGVIIVW 695

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 64/277 (23%), Positives = 117/277 (42%), Gaps = 36/277 (12%)

Query: 94  SGEEDNYLKIAAID-LPDEVVQPSTNSLKAQRXXXXXXXXQKQKPRSNIKIVKKFKHEEE 152
           +G +D+Y+K+ ++D  P E   PS                 K K  SN   V    H   
Sbjct: 504 AGFQDSYIKLWSLDGTPLESQLPS-----------------KAKDASNT--VTLIGHSGP 544

Query: 153 ITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKL 212
           +    F P N  +++  +   TV ++  S D  + L+S  + H    + + F+P      
Sbjct: 545 VYSVSFSPDNRYLVSA-SEDKTVRLW--SLDTYTCLVS-YKGHNHPVWDVKFSPLGH-YF 599

Query: 213 LSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQL 272
            +GS D T  LW           PL+I+    ND+  DC     N     + S D T ++
Sbjct: 600 ATGSHDQTARLWSCDH-----IYPLRIFAGHLNDV--DCVTFHPNGTYVLTGSSDKTCRM 652

Query: 273 HDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGH- 331
            D +  +++   +  T    ++A S   ++L   +  D ++ ++D       +  M GH 
Sbjct: 653 WDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGS-EDGVIIVWDI-GTGKRIKQMRGHG 710

Query: 332 EDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAE 368
           + ++ +L F+   + +L+S G D+ V +WD+     E
Sbjct: 711 KSAVYSLSFNKEGN-ILVSGGADQSVRVWDLKKFTNE 746

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,238,356
Number of extensions: 2413949
Number of successful extensions: 11878
Number of sequences better than 10.0: 1166
Number of HSP's gapped: 10169
Number of HSP's successfully gapped: 2049
Length of query: 438
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 325
Effective length of database: 40,524,141
Effective search space: 13170345825
Effective search space used: 13170345825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)