Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0K028906.11ON56156127850.0
NCAS0F002006.11ON54956416310.0
Kpol_1032.26.11ON53954615340.0
TBLA0G009806.11ON55856214960.0
TDEL0G046006.11ON52854914810.0
YEL058W (PCM1)6.11ON55756814790.0
Suva_5.106.11ON55356814680.0
KAFR0L003406.11ON54055214620.0
Skud_5.316.11ON55757014590.0
Smik_5.296.11ON55556314580.0
TPHA0M002106.11ON54555314450.0
SAKL0E00902g6.11ON54455614280.0
ZYRO0F00506g6.11ON55056314170.0
CAGL0B03597g6.11ON54055313830.0
Ecym_30146.11ON55156113590.0
Kwal_56.223556.11ON54155113480.0
KNAG0E009406.11ON53855813460.0
KLLA0D00858g6.11ON54155213440.0
ACR015W6.11ON55254213241e-177
KLTH0C11506g6.11ON54455113061e-175
KAFR0B039208.840ON62475960.005
TBLA0B032508.840ON64333930.011
KNAG0J002708.840ON62566920.015
NDAI0K004108.840ON62631910.019
Smik_13.4918.840ON62230900.024
TDEL0B005708.840ON63030900.025
TPHA0I002508.840ON62930900.026
Kpol_1068.88.840ON63230890.034
CAGL0M02981g8.840ON61731890.034
YMR278W (PGM3)8.840ON62230890.035
Skud_13.4508.840ON62231890.037
Suva_13.4668.840ON62230890.039
ZYRO0G14190g8.840ON61030880.045
KLLA0D01573g8.840ON60730880.052
ABL126W8.840ON62430860.071
Kwal_27.102588.840ON62030860.087
KLTH0C03872g8.840ON62151850.095
NCAS0C004108.840ON62533850.11
SAKL0D01474g8.840ON62430840.12
Ecym_46118.840ON63029830.19
TBLA0C00905singletonON49339706.0
Smik_2.2763.401ON2368129706.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0K02890
         (561 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....  1077   0.0  
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...   632   0.0  
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...   595   0.0  
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...   580   0.0  
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...   575   0.0  
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...   574   0.0  
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)   570   0.0  
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...   567   0.0  
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)   566   0.0  
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)   566   0.0  
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...   561   0.0  
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...   554   0.0  
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...   550   0.0  
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...   537   0.0  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...   528   0.0  
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...   523   0.0  
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...   523   0.0  
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...   522   0.0  
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...   514   e-177
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...   507   e-175
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...    42   0.005
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...    40   0.011
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...    40   0.015
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...    40   0.019
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...    39   0.024
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...    39   0.025
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...    39   0.026
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...    39   0.034
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...    39   0.034
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...    39   0.035
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...    39   0.037
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...    39   0.039
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...    39   0.045
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...    39   0.052
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...    38   0.071
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...    38   0.087
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...    37   0.095
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...    37   0.11 
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...    37   0.12 
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...    37   0.19 
TBLA0C00905 Chr3 complement(181152..182633) [1482 bp, 493 aa] {ON}     32   6.0  
Smik_2.276 Chr2 (490292..497398) [7107 bp, 2368 aa] {ON} YBR136W...    32   6.7  

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score = 1077 bits (2785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/561 (95%), Positives = 537/561 (95%)

Query: 1   MSSFMNTNKDQLKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQ 60
           MSSFMNTNKDQLKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQ
Sbjct: 1   MSSFMNTNKDQLKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQ 60

Query: 61  TSNKHSAIGVMVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQL 120
           TSNKHSAIGVMVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQL
Sbjct: 61  TSNKHSAIGVMVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQL 120

Query: 121 LIDSIVTLENDLNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQL 180
           LIDSIVTLENDLNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQL
Sbjct: 121 LIDSIVTLENDLNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQL 180

Query: 181 HFLTNLTNTTGTAEEINYYDHFNKYLSQLQSLYPPFNLPFDNLIIDAANGIGAPQVEKLL 240
           HFLTNLTNTTGTAEEINYYDHFNKYLSQLQSLYPPFNLPFDNLIIDAANGIGAPQVEKLL
Sbjct: 181 HFLTNLTNTTGTAEEINYYDHFNKYLSQLQSLYPPFNLPFDNLIIDAANGIGAPQVEKLL 240

Query: 241 FTXXXXXXXXXXXXXXXXXXXXXXXXLLNMNCGADYVKTNQKLPQGIPKDIDANSTLFCS 300
           FT                        LLNMNCGADYVKTNQKLPQGIPKDIDANSTLFCS
Sbjct: 241 FTKNKFPPLNIKNPIKIINNDSKNPNLLNMNCGADYVKTNQKLPQGIPKDIDANSTLFCS 300

Query: 301 YDGDADRIVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYAN 360
           YDGDADRIVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYAN
Sbjct: 301 YDGDADRIVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYAN 360

Query: 361 GSSTNYISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSELTKL 420
           GSSTNYISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSELTKL
Sbjct: 361 GSSTNYISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSELTKL 420

Query: 421 KESGSSREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLAK 480
           KESGSSREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLAK
Sbjct: 421 KESGSSREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLAK 480

Query: 481 VIVPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAKTQ 540
           VIVPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAKTQ
Sbjct: 481 VIVPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAKTQ 540

Query: 541 EETEWLSKKVCQLVIESVTQG 561
           EETEWLSKKVCQLVIESVTQG
Sbjct: 541 EETEWLSKKVCQLVIESVTQG 561

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/564 (58%), Positives = 406/564 (71%), Gaps = 25/564 (4%)

Query: 5   MNTNKDQLKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNK 64
           M  +K  L+  +N  C T++Y YTYGTAGFRD A +LDTVMF TGI+AC RS+ L     
Sbjct: 1   MTIDKSVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLC---- 56

Query: 65  HSAIGVMVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDS 124
            + +GVMVTASHNPP DNGVK++EP G+ML+QEWEP  T+ ANIAANESF++ Y  +++ 
Sbjct: 57  GTPVGVMVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKVYDFILE- 115

Query: 125 IVTLENDLNIKQ-PPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFL 183
            V+ +     ++  P+LI+GHDSR+SSP L   ++ +A  I+NA I NY  VTTPQLHF+
Sbjct: 116 -VSKDPKFPFQENKPSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFI 174

Query: 184 TNL------TNTTGTAEEINYYDHFNKYLSQLQSLYPPFN--LPFDNLIIDAANGIGAPQ 235
           T+L       NT       NYY++FN   S+ Q LY  FN    F+NLIID+ANGIG P+
Sbjct: 175 TSLWNAKYNKNTNDVISVDNYYNYFNASWSKFQELYD-FNSFKSFENLIIDSANGIGGPK 233

Query: 236 VEKLLFTXXXXXXXXXXXXXXXXXXXXXXXXLLNMNCGADYVKTNQKLPQGIPKDIDANS 295
           V  L+ T                        LLN +CGADYVKTNQKLP+GI     +N 
Sbjct: 234 VTDLISTWPSTLRGNVSIINNSWENPN----LLNNDCGADYVKTNQKLPKGIQNP--SNL 287

Query: 296 TLFCSYDGDADRIVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQ 355
            L CS+DGDADRIVFYYI  +   F+LLDGDKIATLFAKF SNLL    L   LKLGVVQ
Sbjct: 288 NLHCSFDGDADRIVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQ 347

Query: 356 TAYANGSSTNYISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHS 415
           TAYANGSSTNY+++ LKVPVSCTKTGVKHLHHEA TKYDIGIYFEANGHGTV+FS++F  
Sbjct: 348 TAYANGSSTNYLTNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQ 407

Query: 416 ELTKLKESGSSREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLP 475
            L    ++ +++   TLLLF ++INQTVGDAM+DML VI VLS+ +++P+ WD+ YKDLP
Sbjct: 408 VLQNEPKTTATQ---TLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLP 464

Query: 476 NKLAKVIVPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYA 535
           NKLAKVIVPDRS FITT+QER+L  P GLQ  ++ AV+ V+ GRSFVRASGTEDAVRVYA
Sbjct: 465 NKLAKVIVPDRSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYA 524

Query: 536 EAKTQEETEWLSKKVCQLVIESVT 559
           EA TQEETE LS++VC+ V+ SV+
Sbjct: 525 EAATQEETEKLSQEVCKFVLSSVS 548

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/546 (56%), Positives = 382/546 (69%), Gaps = 15/546 (2%)

Query: 16  FNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAIGVMVTAS 75
           F + C TK++ Y YGTAGFRDNA  L+TVMFTTGIVACLRS++L       A+GVM+TAS
Sbjct: 6   FEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISL----GGKAVGVMITAS 61

Query: 76  HNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDSIVTLENDLNIK 135
           HNPPEDNGVKI+EPNG+ML Q WEP AT+ ANIAAN +FD+    + + +     +   K
Sbjct: 62  HNPPEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESGSK 121

Query: 136 QPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFLTNLTNTTGT--A 193
             P +++G DSR+S   L+  ++ SA    NAKIINY  +TTPQLHFLTN  N   +   
Sbjct: 122 VQPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKKSYAV 181

Query: 194 EEINYYDHFNKYLSQLQSLYPPFNLPFDNLIIDAANGIGAPQVEKLLFTXXXXXXXXXXX 253
           +E +YY++F +  +++ +L+   +L   +L ID ANGIG P++++LL             
Sbjct: 182 QESSYYNYFIESWNKITALHNITDLYCSSLTIDTANGIGGPKIQELL------KSWPFAS 235

Query: 254 XXXXXXXXXXXXXLLNMNCGADYVKTNQKLPQGIPKDIDANSTLFCSYDGDADRIVFYYI 313
                        LLN NCGAD+VKTNQKLP G+  +   N  L+CSYDGDADRIVFY+ 
Sbjct: 236 KVTLVNNEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTEND-LYCSYDGDADRIVFYFQ 294

Query: 314 DPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYANGSSTNYISSKLKV 373
           D     F+LLDGDKI+TLFAK  + LL  A LN  + LGVVQTAYANGSSTNY+   L V
Sbjct: 295 D-QDKQFHLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNV 353

Query: 374 PVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSELTK-LKESGSSREIKTL 432
           PVSC KTGVKHLHHEA+T YDIG+YFEANGHGT+IFSD F+    K LK +  S  + TL
Sbjct: 354 PVSCAKTGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSESIAVNTL 413

Query: 433 LLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLAKVIVPDRSKFITT 492
           +  S LINQTVGDA+SDML V++VLSI++LS   WD EY DLPN L KVIVPDRS FITT
Sbjct: 414 VALSHLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITT 473

Query: 493 DQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAKTQEETEWLSKKVCQ 552
           DQERKL+ P+GLQ  +++A++  S GRSFVRASGTEDAVRVYAEA +QEE + L+  V +
Sbjct: 474 DQERKLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTK 533

Query: 553 LVIESV 558
           LV ESV
Sbjct: 534 LVKESV 539

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/562 (54%), Positives = 384/562 (68%), Gaps = 37/562 (6%)

Query: 16  FNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAIGVMVTAS 75
           F++IC+TKN+ YTYGTAGFRD A  LDTVMFTTG VACLRSL    S+   A+GVMVTAS
Sbjct: 14  FHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSL----SHDGKAVGVMVTAS 69

Query: 76  HNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDSIVTLENDLNIK 135
           HNPP DNGVKI+EPNGSML Q+WEP AT  AN+A+    DE  Q +   ++    +LN  
Sbjct: 70  HNPPVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGKIDELVQFVNAKLI----ELNSN 125

Query: 136 QPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFLTNLTN-TTGTAE 194
           + PTLI+G DSR+SS +L+  + + +  +F+AKI++Y  +TTPQLHFLTN  N      +
Sbjct: 126 KVPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYNLEKDLPK 185

Query: 195 EINYYDHFNKYLSQLQSL----YPPFNLPFDNLIIDAANGIGAPQVEKLLFTXXXXXXXX 250
           E +YY HFN    QL S+        +   ++LIID+ANGIG P++E LL          
Sbjct: 186 ETDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLL------KYWK 239

Query: 251 XXXXXXXXXXXXXXXXLLNMNCGADYVKTNQKLPQGIPKDI---DANSTLFCSYDGDADR 307
                            LN NCGADYVKTNQKLP GI  DI    + + + CS+DGDADR
Sbjct: 240 TNYKVRLINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFDGDADR 299

Query: 308 IVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHI--LKLGVVQTAYANGSSTN 365
           +VFYY DP +N FNLLDGDKI+TLFA F S  L +A +++   +KLGVVQTAYANGSSTN
Sbjct: 300 VVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYANGSSTN 359

Query: 366 YISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSEL-------T 418
           Y+   LK+PV+C KTGVKHLHHEA T+YDIG+YFEANGHGT+IFS+ F+  +       +
Sbjct: 360 YLQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQKINAES 419

Query: 419 KLKESGSSREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKL 478
           +++ +   R +KTL + S LINQTVGDA+SDM+ V+AVL+IL  +P  W+KEY DLPNKL
Sbjct: 420 QIENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTDLPNKL 479

Query: 479 AKVIVPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAK 538
           AK++VPDRS F TTDQERKL  P GLQ  + + VA    GRSFVRASGTEDAVRVYAEA 
Sbjct: 480 AKLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYAEAS 539

Query: 539 TQEETEWLSKKVCQLVIESVTQ 560
                     K+CQ V+++  +
Sbjct: 540 DD------VNKLCQEVLDATAE 555

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/549 (54%), Positives = 379/549 (69%), Gaps = 25/549 (4%)

Query: 9   KDQLKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAI 68
           ++ L+S   + C T+ Y Y YGTAGFRD++++LDTVMF TGIVACLRS  L        +
Sbjct: 2   REPLESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGK----PV 57

Query: 69  GVMVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDSIVTL 128
           GVM+TASHNP  DNGVK++EP+GSML+Q WE  AT+ AN+ AN   ++  +  +  + + 
Sbjct: 58  GVMITASHNPSGDNGVKVVEPDGSMLIQSWESTATELANLLANRPLEDI-KAKVGQLTSG 116

Query: 129 ENDLNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFLTNLTN 188
           E+ +     P LI+G DSR S P L++ ++ SAT +F+AKI +Y  +TTPQLHFLTN T 
Sbjct: 117 ESSVR----PQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTNETM 172

Query: 189 TTGT-AEEINYYDHFNKYLSQLQSLYPPFNLPFDNLIIDAANGIGAPQVEKLLFTXXXXX 247
            TG   +E  Y+ HF     Q+ +L  P  LP  N+++D ANGIG P++  LL       
Sbjct: 173 ITGAHVDEQAYFAHFLGAWDQIAAL-QPVKLP--NVVVDCANGIGGPKMSALL------T 223

Query: 248 XXXXXXXXXXXXXXXXXXXLLNMNCGADYVKTNQKLPQGIPKDIDANSTLFCSYDGDADR 307
                              LLN  CGAD+VKT+Q+LP G+  +  AN  L+CS+DGDADR
Sbjct: 224 QWGFAKQCSVINDKCDEPELLNHGCGADFVKTSQRLPNGVKPN--AND-LYCSFDGDADR 280

Query: 308 IVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYANGSSTNYI 367
           +VFYY+D     F+LLDGDKI+TLFA F + LL   KL+ IL +GVVQTAYANGSST Y+
Sbjct: 281 VVFYYLD-QNLGFHLLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYL 339

Query: 368 SSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSELTKLKESGSSR 427
              L+VPVSCTKTGVKHLHHEA+  YDIGIYFEANGHGTV+FS+KFH  +T    +  + 
Sbjct: 340 QDNLQVPVSCTKTGVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTN--HADQTP 397

Query: 428 EIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLAKVIVPDRS 487
           E+K L   ++LINQTVGDA+SDM+AV+AVLSILQ SP+ WD+E+ DLPNKL KV+V DRS
Sbjct: 398 ELKILKYLAKLINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRS 457

Query: 488 KFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAKTQEETEWLS 547
            F TTDQER+LV P GLQ  ++EAVA +  GRSFVRASGTEDAVRVYAEA TQ E + LS
Sbjct: 458 AFTTTDQERRLVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLS 517

Query: 548 KKVCQLVIE 556
             V  LV E
Sbjct: 518 SIVGDLVRE 526

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/568 (54%), Positives = 385/568 (67%), Gaps = 29/568 (5%)

Query: 5   MNTNKDQLKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNK 64
           M  + +QL   +++ C+TKN  ++YGTAGFR  AK LDTVMF+TGI+A LRSL LQ    
Sbjct: 1   MKVDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQ-- 58

Query: 65  HSAIGVMVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAA-NESFDEFYQLLID 123
              +GVM+TASHNP +DNGVKI+EP+GSMLL  WEP A Q AN A+   +F+EF   L  
Sbjct: 59  --YVGVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAK 116

Query: 124 SIVTLENDLNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFL 183
            I   + DLN    P +++G DSR+SSP L+  +  S   +F+A++++   VTTPQLH++
Sbjct: 117 LIEHEKIDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYI 176

Query: 184 TNLTN-------TTGTAEEINYYDHFNKYLSQLQSLYP-PFNLPFDNLIIDAANGIGAPQ 235
           T+L+N       T   A E +YY  F    ++L + Y     L    L ID ANGIG PQ
Sbjct: 177 TDLSNRRKLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQ 236

Query: 236 VEKLLFTXXXXXXXXXXXXXXXXXXXXXXXXLLNMNCGADYVKTNQKLPQGI-PKDIDAN 294
           ++KLL +                        LLN  CGADYVKTNQ+LP+G+ P   D  
Sbjct: 237 LKKLLASEDWDVPAEQVEVINDRSDVPE---LLNFECGADYVKTNQRLPKGLSPSSFD-- 291

Query: 295 STLFCSYDGDADRIVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVV 354
            +L+CS+DGDADR+VFYY+D   + F+LLDGDKI+TLFAKF S  L +A L H LK+GVV
Sbjct: 292 -SLYCSFDGDADRVVFYYVDS-GSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVV 349

Query: 355 QTAYANGSSTNYISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFH 414
           QTAYANGSST YI + L  PVSCTKTGVKHLHHEA T+YDIGIYFEANGHGT+IFS+KFH
Sbjct: 350 QTAYANGSSTAYIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFH 409

Query: 415 ----SELTKLKESGSSREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKE 470
               SEL+K K +G +  ++TL  FSELINQTVGDA+SDMLAV+A L+IL++SP  WD+E
Sbjct: 410 RTIKSELSKSKLNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEE 469

Query: 471 YKDLPNKLAKVIVPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDA 530
           Y DLPNKL K IVPDRS F TTDQERKL+ P GLQ  ++  VA   +GRSFVRASGTEDA
Sbjct: 470 YTDLPNKLVKCIVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDA 529

Query: 531 VRVYAEAKTQEETEWLSKKVCQLVIESV 558
           VRVYAE K   +      + C  V+E V
Sbjct: 530 VRVYAECKDSSKL----GQFCDEVVEHV 553

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/568 (53%), Positives = 380/568 (66%), Gaps = 29/568 (5%)

Query: 5   MNTNKDQLKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNK 64
           M  + DQL+  + E C TKN  Y+YGTAGFR  AK LDTVMFTTGI+A LRSL LQ    
Sbjct: 1   MKIDYDQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQ-- 58

Query: 65  HSAIGVMVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAA-NESFDEFYQLLID 123
              +GVM+TASHNP +DNGVKI+EP+GSMLL  WEP A Q AN A+   +FDEFY  L+ 
Sbjct: 59  --YVGVMITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVK 116

Query: 124 SIVTLENDLNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFL 183
            I   + DL+    P +++G DSR+SSP L+  +  +   +F+A +++   VTTPQLH++
Sbjct: 117 LIEHEKIDLD--AAPHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYV 174

Query: 184 TNLTNTT----GTAEEINYYDHFNKYLSQLQSLYPPF----NLPFDNLIIDAANGIGAPQ 235
           TNL+N      G+A+     D+++ +++    L+        L    L +D ANGIG PQ
Sbjct: 175 TNLSNKRQREGGSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQ 234

Query: 236 VEKLLFTXXXXXXXXXXXXXXXXXXXXXXXXLLNMNCGADYVKTNQKLPQGI-PKDIDAN 294
           ++KLL                          LLN  CGADYVKTNQ+LP+G+ P   D  
Sbjct: 235 LKKLL---ASKDWAVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPD-- 289

Query: 295 STLFCSYDGDADRIVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVV 354
            +L+CS+DGDADR+VFYY+DP  + F+LLDGDKI+TLFAKF S  L +A L   LK+GVV
Sbjct: 290 -SLYCSFDGDADRVVFYYVDP-ESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVV 347

Query: 355 QTAYANGSSTNYISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFH 414
           QTAYANGSST+YI   L  PVSCTKTGVKHLHHEA T+YDIGIYFEANGHGT+IFS KFH
Sbjct: 348 QTAYANGSSTSYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFH 407

Query: 415 ----SELTKLKESGSSREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKE 470
               SEL++ +  GS   + TL  F+ LINQTVGDA+SDMLAV+A LSIL ++P  WDKE
Sbjct: 408 QTIESELSRAQ--GSLLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKE 465

Query: 471 YKDLPNKLAKVIVPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDA 530
           Y DLPNKL K IVPDRS F TTDQERKL  P GLQ  ++  +   ++GRSFVRASGTEDA
Sbjct: 466 YTDLPNKLVKCIVPDRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDA 525

Query: 531 VRVYAEAKTQEETEWLSKKVCQLVIESV 558
           VRVYAE +   + +    +V + V  SV
Sbjct: 526 VRVYAECQDPTKLDQFCNEVVEYVKSSV 553

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score =  567 bits (1462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/552 (55%), Positives = 383/552 (69%), Gaps = 28/552 (5%)

Query: 11  QLKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAIGV 70
           QL+  F + C T+N+ YTYGTAGFR NA  LDTVMFTTGIVA LRSL LQ       IGV
Sbjct: 6   QLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGK----YIGV 61

Query: 71  MVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDSIVTLEN 130
           M+TASHNPP+DNGVKI+EP+G+ML++ WE  AT  ANIA++ +F  F   L   I  L  
Sbjct: 62  MITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKL-- 119

Query: 131 DLNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFLTNLTNTT 190
           +++    P LI+GHDSR+SSP LM   +++A  +F+  +IN+  +TTPQLH+LT L N  
Sbjct: 120 NIDETTTPRLIVGHDSRESSPYLM-ECLQAAAPVFDTIVINHTLITTPQLHYLTMLQNDV 178

Query: 191 GTAEEINYYDHFNKYLSQLQSLYPPFNLPFDNLIIDAANGIGAPQVEKLLFTXXXXXXXX 250
            T  E++YY  F+   + L SLYP  NL F+NLI+D ANG+G+ Q  K L          
Sbjct: 179 VT--EVDYYKFFSTSWNNLFSLYPDLNLTFNNLIVDGANGVGSVQFSKFL-----PYLPQ 231

Query: 251 XXXXXXXXXXXXXXXXLLNMNCGADYVKTNQKLPQGIPKDIDAN-STLFCSYDGDADRIV 309
                           +LN++CGAD+VKTNQKLP GI   ++ N S L+ S+DGDADRIV
Sbjct: 232 LATLTTIINDKHNVPQMLNVDCGADFVKTNQKLPNGI---VNPNPSDLYASFDGDADRIV 288

Query: 310 FYYIDPMTNN--FNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYANGSSTNYI 367
           FYY+D   NN  F+LLDGDKI+T+  K   ++L  ++L + + LGVVQTAYANGSST YI
Sbjct: 289 FYYVD---NNKKFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYI 345

Query: 368 SSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSELTKLKESGSSR 427
           +  LKVPV CTKTGVKHLHH A +K+DIGIYFEANGHGTV+FS+KF+  L K  ++GSS 
Sbjct: 346 TKSLKVPVECTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSS 405

Query: 428 E-----IKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLAKVI 482
           E       +L  FS+LINQTVGD+M+D+LAVIA LSILQLSP+ WD EY+DLPN L K  
Sbjct: 406 EKIHKARLSLFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCT 465

Query: 483 VPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAKTQEE 542
           V +R  F TTD ERKL  P GLQ  ++ AV+    GRSFVRASGTEDAVR+YAEAKT+ E
Sbjct: 466 VLNRFVFKTTDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAE 525

Query: 543 TEWLSKKVCQLV 554
            E LSK+V QLV
Sbjct: 526 VEALSKEVTQLV 537

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/570 (53%), Positives = 383/570 (67%), Gaps = 29/570 (5%)

Query: 5   MNTNKDQLKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNK 64
           M  + +QL+  ++E C+TKN  Y+YGTAGFR  AK LDTVMFTTGI+A LRSL LQ    
Sbjct: 1   MKIDYEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQY- 59

Query: 65  HSAIGVMVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANES-FDEFYQLLID 123
              +GVM+TASHNP +DNGVKI+EP+GSMLL  WEP A Q AN A+  + F+EFY  L+ 
Sbjct: 60  ---VGVMITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVK 116

Query: 124 SIVTLENDLNIKQ-PPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHF 182
            I   + DL      P +++G DSR+SSP L+  +  +   +F+A++++   VTTPQLH+
Sbjct: 117 LIELEKIDLGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHY 176

Query: 183 LTNLTN--------TTGTAEEINYYDHFNKYLSQLQSLYP-PFNLPFDNLIIDAANGIGA 233
           +T+L+N            A E +YY  F    ++L + Y     L    L ID ANGIG 
Sbjct: 177 ITDLSNRREREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGG 236

Query: 234 PQVEKLLFTXXXXXXXXXXXXXXXXXXXXXXXXLLNMNCGADYVKTNQKLPQGI-PKDID 292
           PQ++KLL +                        LLN  CGADYVKTNQ+LP+G+ P   +
Sbjct: 237 PQLKKLLASKDWVVPSDQIEIINDKSDVPK---LLNSECGADYVKTNQRLPKGLSPSSFE 293

Query: 293 ANSTLFCSYDGDADRIVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLG 352
              +L+CS+DGDADR+VFYY+D     F+LLDGDKI+TLFAKF S  L +A L   LK+G
Sbjct: 294 ---SLYCSFDGDADRVVFYYVDSELK-FHLLDGDKISTLFAKFLSKQLEMANLERSLKIG 349

Query: 353 VVQTAYANGSSTNYISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDK 412
           VVQTAYANGSST YI   L  PVSCTKTGVKHLHHEA T+YDIGIYFEANGHGT+IFS+K
Sbjct: 350 VVQTAYANGSSTAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEK 409

Query: 413 FH----SELTKLKESGSSREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWD 468
           FH    SEL+K   +G +  +KTL  F++LINQTVGDAMSDMLAV+A L+IL+++P +WD
Sbjct: 410 FHQTIESELSK--PNGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWD 467

Query: 469 KEYKDLPNKLAKVIVPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTE 528
           +EYKDLPNKL K IVPDRS F TTDQERKL  P GLQ  ++  +A   +GRSFVRASGTE
Sbjct: 468 EEYKDLPNKLVKCIVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTE 527

Query: 529 DAVRVYAEAKTQEETEWLSKKVCQLVIESV 558
           DAVRVYAE +   + +    ++   V  SV
Sbjct: 528 DAVRVYAECQDMSKLDQFCNEIVGYVKASV 557

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score =  566 bits (1458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/563 (53%), Positives = 384/563 (68%), Gaps = 25/563 (4%)

Query: 5   MNTNKDQLKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNK 64
           M  + +QL   +++ C+TKN  Y+YGTAGFR  AK LDTVMFTTGI+A LRSL LQ    
Sbjct: 1   MKIDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQ-- 58

Query: 65  HSAIGVMVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANES-FDEFYQLLID 123
              +GVM+TASHNP +DNGVKI+EP+GSMLL  WEP A Q AN A+  S F+EF   L  
Sbjct: 59  --YVGVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTR 116

Query: 124 SIVTLENDLNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFL 183
            I   +  L+    P +++G DSR+SSP L+  +  +   +F+A++++   VTTPQLH++
Sbjct: 117 LIEHEKIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYI 176

Query: 184 TNLTNTT----GTAE---EINYYDHFNKYLSQLQSLYP-PFNLPFDNLIIDAANGIGAPQ 235
           T+L+N      G+AE   E +YY  F    ++L S Y     L    L IDAANGIG PQ
Sbjct: 177 TDLSNKREREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQ 236

Query: 236 VEKLLFTXXXXXXXXXXXXXXXXXXXXXXXXLLNMNCGADYVKTNQKLPQGIPKDIDANS 295
           ++KLL                          LLN  CGADYVKTNQ+LP+G+     ++ 
Sbjct: 237 LKKLL---TSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPS--SHD 291

Query: 296 TLFCSYDGDADRIVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQ 355
           +L+CS+DGDADR+VFYY+D   + F+LLDGDKI+TLFAKF S  L +A L + L++GVVQ
Sbjct: 292 SLYCSFDGDADRVVFYYVDS-ESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQ 350

Query: 356 TAYANGSSTNYISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFH- 414
           TAYANGSSTNYI + L+ PVSCTKTGVKHLHHEA T+YDIGIYFEANGHGT+IFS+KFH 
Sbjct: 351 TAYANGSSTNYIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQ 410

Query: 415 ---SELTKLKESGSSREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEY 471
              SEL++ +  G    +KTL  FS+LINQTVGDA+SDMLAV+A L+I++++P  WDKEY
Sbjct: 411 VIKSELSRAR--GDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEY 468

Query: 472 KDLPNKLAKVIVPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAV 531
            DLPNKL K IVPDRS F T DQERKL  P GLQ  ++  +A   +GRSFVRASGTEDAV
Sbjct: 469 TDLPNKLVKCIVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAV 528

Query: 532 RVYAEAKTQEETEWLSKKVCQLV 554
           R+YAE +   + +    ++ +LV
Sbjct: 529 RIYAECQDSSQLDQFCNEIVELV 551

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/553 (54%), Positives = 373/553 (67%), Gaps = 19/553 (3%)

Query: 12  LKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAIGVM 71
           L+S F   C T+N+ Y YGTAGFRD+A  LDTVM TTG++ACLRS+ L       A+GVM
Sbjct: 6   LESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGK----AVGVM 61

Query: 72  VTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAA-NESFDEFYQLLIDSIVTLEN 130
           +TASHN P DNGVKI+EP+GSML Q WEP AT+ AN A+   S  EF   L +     + 
Sbjct: 62  ITASHNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKV 121

Query: 131 DLNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFLTNLTNTT 190
           D  I   P L++G DSRDS P L+  +   A  +   KII+Y  +TTPQLHFLTN  NTT
Sbjct: 122 DSGIT--PVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTT 179

Query: 191 GT---AEEINYYDHFNKYLSQLQSLYPPFNLPFDNLIIDAANGIGAPQVEKLLFTXXXXX 247
            +     E +YY  F      + +L+    L    L IDAANGIG P+V KL        
Sbjct: 180 KSRAPVTEDDYYSFFMDAWVSITALHGIKVLQSPRLYIDAANGIGGPKVSKLF------E 233

Query: 248 XXXXXXXXXXXXXXXXXXXLLNMNCGADYVKTNQKLPQGIPKDIDAN-STLFCSYDGDAD 306
                              LLN +CGADYVKTNQ+LP+ I    D++ +TL+CS+DGDAD
Sbjct: 234 VWPQAGQFTLVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDAD 293

Query: 307 RIVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYANGSSTNY 366
           RIVFYY D   N+F+LLDGDKI+TLFA F S  L  A L   + +GVVQTAYANG+STNY
Sbjct: 294 RIVFYYQDAQ-NSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNY 352

Query: 367 ISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSELTKL-KESGS 425
           + + L +PVSC KTGVKHLHHEAIT YD+GIYFEANGHGT++FS+KF      L KE+  
Sbjct: 353 LENVLNIPVSCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCESLLKENNE 412

Query: 426 SREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLAKVIVPD 485
           S E+KTLL F+ LINQTVGDA+SDML V+AVLSI++L+P++WDKEY DLPN L KV+VPD
Sbjct: 413 SLEVKTLLSFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPD 472

Query: 486 RSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAKTQEETEW 545
           RS F TTDQERKL+ P+G Q  ++  VA    GRSFVRASGTEDAVRVYAEA T ++   
Sbjct: 473 RSLFTTTDQERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAA 532

Query: 546 LSKKVCQLVIESV 558
           L+++V + V+ SV
Sbjct: 533 LNEEVSKAVLASV 545

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/556 (53%), Positives = 377/556 (67%), Gaps = 26/556 (4%)

Query: 12  LKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAIGVM 71
           L+  +++ C+T  + YTYGTAGFR  A  LDTVMFTTGI+A +RS+ L    K   +GVM
Sbjct: 7   LEELYDKHCKT-GFTYTYGTAGFRYKADVLDTVMFTTGILAAIRSIYL----KGQYVGVM 61

Query: 72  VTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDSIVTLEND 131
           +TASHNPP+DNGVKI++P G ML Q WEP AT+ AN A+        Q LI ++  L   
Sbjct: 62  ITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGK-----QELIKALDKLITK 116

Query: 132 LNIK--QPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFLTNLTN- 188
           L I   +   + +  DSR+S P L+  +I    ++ N +++++N +TTPQLHFLT   N 
Sbjct: 117 LGIDDTESAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQ 176

Query: 189 -TTGTAEEINYYDHFNKYLSQLQSLYPPFNLPFDNLIIDAANGIGAPQVEKLLFTXXXXX 247
            ++   EE  YY  F+   +++  L+   +LP+  +IIDAANGIG P+V ++L       
Sbjct: 177 GSSSKVEESTYYSAFSSAWTKICGLHDINSLPY-RVIIDAANGIGGPKVSEMLL-----K 230

Query: 248 XXXXXXXXXXXXXXXXXXXLLNMNCGADYVKTNQKLPQGIPKDIDANSTLFCSYDGDADR 307
                              LLN +CGADYVKTNQ  P+G+  + + N  ++CS+DGDADR
Sbjct: 231 NKFFSSTVSVINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSE-NECIYCSFDGDADR 289

Query: 308 IVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYANGSSTNYI 367
           IVFYY D  +  FNLLDGDKI+TLFAKFF  LL  A   + LKLGVVQTAYANGSST Y+
Sbjct: 290 IVFYYHDEKSK-FNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYL 348

Query: 368 SSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSEL-TKLKE---S 423
           SS L+VPVSCT TGVKHLHHEAI  YDIGIYFEANGHGTVIFSD+FH  +  KLKE    
Sbjct: 349 SSILEVPVSCTATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQDE 408

Query: 424 GSSREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLAKVIV 483
            +++ +KTL LF+ LINQTVGDA+SDMLAV+AVL IL+ SP  WD+EY DLPNKL KVIV
Sbjct: 409 KTAKALKTLYLFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIV 468

Query: 484 PDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAKTQEET 543
           PDRS F T++ ER+LV PKGLQ  ++  V     GRSFVRASGTEDAVRVYAEA T+E+ 
Sbjct: 469 PDRSVFKTSNAERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKA 528

Query: 544 EWLSKKVCQLVIESVT 559
           + L+  V  LV  SV+
Sbjct: 529 DRLAASVSDLVSRSVS 544

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/563 (52%), Positives = 374/563 (66%), Gaps = 33/563 (5%)

Query: 10  DQLKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAIG 69
           D L    ++ C   + HY YGTAGFR  A  LDTV+F TGI+ACLRSL L    K   IG
Sbjct: 5   DTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLAL----KGDVIG 60

Query: 70  VMVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFAN-IAANESFDEFYQL-------- 120
           VMVTASHNPP DNGVK++EP+GSM+ + WEP AT+ AN +A   S  E  Q         
Sbjct: 61  VMVTASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRE 120

Query: 121 LIDSIVTLENDLNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQL 180
           L   + +  N  N    PTL++G DSR+S P L++ ++ SA  +F+AKI +   +TTPQL
Sbjct: 121 LKGQLQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQL 180

Query: 181 HFLTNLT-NTTGTAEEINYYDHFNK---YLSQLQSLYPPFNLP-FDNLIIDAANGIGAPQ 235
           HFLT+ T        E  YY+HF +   Y++QL  +    +LP   +L IDAANGIGAP+
Sbjct: 181 HFLTSETAKGVANVTESRYYEHFLQAWDYVAQLHGIGE--SLPTISSLTIDAANGIGAPK 238

Query: 236 VEKLLFTXXXXXXXXXXXXXXXXXXXXXXXXLLNMNCGADYVKTNQKLPQGIPKDIDANS 295
           V++LL                          LLN  CGAD+VK+NQ+ P G     + ++
Sbjct: 239 VQELL------SQWACRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGF----NDST 288

Query: 296 TLFCSYDGDADRIVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQ 355
            L CSYDGDADR+VFYYI+   N F LLDGD+I+ LFA FF+ +L  A L   L LGVVQ
Sbjct: 289 GLGCSYDGDADRVVFYYINE-ANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQ 347

Query: 356 TAYANGSSTNYISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHS 415
           TAYANG+ST Y+   L+VPVSC KTGVKHLHHEA+TKYDIGIYFEANGHGT+IFS KF+ 
Sbjct: 348 TAYANGNSTEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYK 407

Query: 416 ELTKLKESGSSREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLP 475
            + + KE   S  ++TL  FS LINQTVGDA+SDML V+A LSI + +P  W +E+ DLP
Sbjct: 408 VIKEQKER--SVAVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLP 465

Query: 476 NKLAKVIVPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYA 535
           N+LAKV+VPDRS FITTDQER+L +P+GLQ  ++EAV     GRSFVRASGTEDAVRVYA
Sbjct: 466 NRLAKVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYA 525

Query: 536 EAKTQEETEWLSKKVCQLVIESV 558
           EA + E+ E LS  V +LV++SV
Sbjct: 526 EAASLEDVEKLSNTVKELVVKSV 548

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/553 (52%), Positives = 370/553 (66%), Gaps = 26/553 (4%)

Query: 16  FNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAIGVMVTAS 75
           +N+ C T++ HYTYGTAGFR +A+ LD+VMFTTG++A LRS++ Q +     +GVM+TAS
Sbjct: 6   YNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCA----PVGVMITAS 61

Query: 76  HNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDSIVTLENDLNIK 135
           HNPP DNGVKI+E +GSMLLQ+WEP AT+ AN  A+      Y     ++  +  +LNI 
Sbjct: 62  HNPPRDNGVKIVESDGSMLLQDWEPLATRLANSVAD------YHTFESTLNAIMQELNIS 115

Query: 136 --QPPTLILGHDSRDSSPTLMNHIIKSATLIF-NAKIINYNYVTTPQLHFLTNLTNTTGT 192
               P +++GHDSR+SSP L+ +++     +  +A+I N+  +TTPQLHFLT        
Sbjct: 116 PGHAPQIVVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLT----ANPA 171

Query: 193 AEEINYYDHFNKYLSQLQSLYPPFNL-PFDNLIIDAANGIGAPQVEKLLF---TXXXXXX 248
             E  YY +F    +QL  LY       FD L+ID ANGIG PQ  K+L    T      
Sbjct: 172 HFEDYYYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLPHLQ 231

Query: 249 XXXXXXXXXXXXXXXXXXLLNMNCGADYVKTNQKLPQGIPKDIDANSTLFCSYDGDADRI 308
                             +LN  CGAD+VKTNQ+LP+GI  D      L+CS+DGDADR+
Sbjct: 232 KIRLHQIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGINAD---PRNLYCSFDGDADRV 288

Query: 309 VFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYANGSSTNYIS 368
           VFYY+D  +  F+LLDGDKI+TL A F + LL  A L   LKLGVVQTAYANGSST Y++
Sbjct: 289 VFYYVDD-SLTFHLLDGDKISTLLAYFINALLKEAGLAEELKLGVVQTAYANGSSTTYVT 347

Query: 369 SKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSELT-KLKESGSSR 427
            KL+VPVS  KTGVKHLHHEA+T YDIG+YFEANGHGTVIFS  F+  +  +L ++   +
Sbjct: 348 KKLQVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAHDK 407

Query: 428 EIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLAKVIVPDRS 487
              TL L S LINQT+GDA+SDMLA+I VL IL  SP +WD EY DLPNKL KV+VPDRS
Sbjct: 408 STLTLRLLSRLINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDRS 467

Query: 488 KFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAKTQEETEWLS 547
            FITTDQER+LV P GLQ  ++  VA    GRSF+RASGTEDAVRVYAEA+T E TE LS
Sbjct: 468 IFITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKLS 527

Query: 548 KKVCQLVIESVTQ 560
            +V   +IE+V +
Sbjct: 528 TEVTDALIETVKE 540

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score =  528 bits (1359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/561 (51%), Positives = 373/561 (66%), Gaps = 31/561 (5%)

Query: 10  DQLKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAIG 69
           +++   +++ C ++ + Y YGTAGFR  A+ LDTV+FTTG++ACLRS+ L    K   +G
Sbjct: 5   EEVSKLYDKHCCSR-FKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHL----KGQYVG 59

Query: 70  VMVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDSIVTLE 129
            M+TASHNPP+DNGVK+++P G ML QEWE  AT+ AN A+    D  +Q L   +  L 
Sbjct: 60  AMITASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCAS----DGKHQFL-HRLQELM 114

Query: 130 NDLNIK--QPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFLTNLT 187
           N   IK      +++  DSR+S   L+  ++   ++  N  I++Y+ +TTPQLHFLT   
Sbjct: 115 NQFGIKADSEARIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHL 174

Query: 188 NTTGTAE---EIN---YYDHFNKYLSQLQSLYPPFNLPFDNLIIDAANGIGAPQVEKLLF 241
           N    +E   E+N   YY HF   L +L  L+    LP+  L+IDAANG+G  + E+L  
Sbjct: 175 NRQMESERVIEVNEAFYYSHFLSALKELTELFNIPGLPYP-LVIDAANGVGGAKAEELFM 233

Query: 242 TXXXXXXXXXXXXXXXXXXXXXXXXLLNMNCGADYVKTNQKLPQGIPKDIDANSTLFCSY 301
                                    LLN  CGADYVKTNQ LPQGI    D NS L CS+
Sbjct: 234 -----KNTFFKDSTTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINS-LHCSF 287

Query: 302 DGDADRIVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYANG 361
           DGDADR++FYY D +   F+LLDGDKI+TLFAKFF ++L +A +   +KLGVVQTAYANG
Sbjct: 288 DGDADRVIFYYRD-VDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANG 346

Query: 362 SSTNYISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSELTK-L 420
           SST Y+S  L VPVSCT TGVK+LH +A+  YD+GIYFEANGHGTVIFS+ F++ ++K L
Sbjct: 347 SSTRYLSEVLIVPVSCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRL 406

Query: 421 KESGSSRE----IKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPN 476
           KE   S E    +KTL  FS+LINQTVGDAMSDM+AV+AVL IL+ +P  WD EY DLPN
Sbjct: 407 KEGSLSAESKMALKTLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPN 466

Query: 477 KLAKVIVPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAE 536
            L KV+VPDRS F TT+ ER+LV PKGLQ  +++ + S    RSFVRASGTEDAVR+YAE
Sbjct: 467 TLMKVVVPDRSLFKTTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAE 526

Query: 537 AKTQEETEWLSKKVCQLVIES 557
           A T+E+ + LS K+ QLVI +
Sbjct: 527 AATKEQADDLSIKISQLVISA 547

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/551 (52%), Positives = 362/551 (65%), Gaps = 25/551 (4%)

Query: 12  LKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAIGVM 71
           LKS +   C T  +HY YGTAGFR  A  LDTVMFTTG+VA LRS+ L+       +GVM
Sbjct: 7   LKSLYEAHCST-GFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKT----VGVM 61

Query: 72  VTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDSIVTLEND 131
           +TASHNPPEDNGVKI++P G ML Q WE  AT  AN +A++ F EF   +   +  LE  
Sbjct: 62  ITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLAN-SASQGFSEFVASVERLMTKLEVG 120

Query: 132 LNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFLTNLTNTTG 191
            N     ++++  DSR+S P L+   +    ++ N K+ ++  +TTPQLHFLT+ +N   
Sbjct: 121 SN--DHGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNELP 178

Query: 192 TAEEIN---YYDHFNKYLSQLQSLYPPFNLPFDNLIIDAANGIGAPQVEKLLFTXXXXXX 248
              EI    YYD+F     ++  L    +LP+  L IDAANGIGAP V ++L        
Sbjct: 179 KGTEIGKSLYYDNFLSAWVEIAELCKIDSLPY-KLEIDAANGIGAPVVTEML-----SQH 232

Query: 249 XXXXXXXXXXXXXXXXXXLLNMNCGADYVKTNQKLPQGIPKDIDANSTLFCSYDGDADRI 308
                              LN  CGAD+VKTNQKLP GI    + N  + CS+DGDADRI
Sbjct: 233 KFFKGAFAVVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNR-ICCSFDGDADRI 291

Query: 309 VFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYANGSSTNYIS 368
           VFYY      +F+LLDGDK+ATLFAKFF  LL  A L   L+LGVVQTAYANGSST YI 
Sbjct: 292 VFYYCGK-NGDFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIE 350

Query: 369 SKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSEL-----TKLKES 423
             L + V+CT TGVKHLHHEA+ KYDIG+YFEANGHGTV+FS KF   +      KL+  
Sbjct: 351 QVLGISVTCTPTGVKHLHHEAV-KYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESD 409

Query: 424 GSSREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLAKVIV 483
            + + +K L LF++LINQTVGDA+SDMLAV+AVLSIL+ SP  WD+EY DLPNKL KV+V
Sbjct: 410 AAQKSLKVLHLFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLV 469

Query: 484 PDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAKTQEET 543
           PDR+ F T + ER+LV P G+Q  ++  VA+ S GRSFVRASGTEDAVRVYAEA T +ET
Sbjct: 470 PDRTVFKTKNAERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQET 529

Query: 544 EWLSKKVCQLV 554
           E LS++V +L+
Sbjct: 530 EALSQQVEKLL 540

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score =  523 bits (1346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/558 (49%), Positives = 361/558 (64%), Gaps = 28/558 (5%)

Query: 8   NKDQLKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSA 67
           +++ +++ F+ +C TK Y YTYGTAGFRD A  LDTVMF TG VA LRS  L  +     
Sbjct: 2   SREAVRAVFDAVCTTKGYTYTYGTAGFRDKAAVLDTVMFATGCVAVLRSWRLNGAQ---- 57

Query: 68  IGVMVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDSIVT 127
           +GVMVTASHNPPEDNGVK+++P G ML ++WEP AT+ AN+AAN +FD++++       +
Sbjct: 58  VGVMVTASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYW----TS 113

Query: 128 LENDLNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKI-INYNYVTT-PQLHFLTN 185
           L  + N      L +GHD+R+SSP L+ +++ +A  +    I I+  ++T  PQLH+LT+
Sbjct: 114 LVEEGNYTGGARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTS 173

Query: 186 LTNTTGTAEEINYYDHFNKYLSQLQSLYPP--FNLPFDNLIIDAANGIGAPQVEKLLFTX 243
           L    G  +   Y DHF       Q L+P      PFD L ID ANG+GA Q+++     
Sbjct: 174 LQRD-GVTDAAAYNDHFQ---GCWQKLFPDGVVAWPFDRLFIDTANGVGAVQLQQFF--- 226

Query: 244 XXXXXXXXXXXXXXXXXXXXXXXLLNMNCGADYVKTNQKLPQGIPKDIDANSTL---FCS 300
                                   LN+ CGAD+VKTN +LP  +P     +  L   +CS
Sbjct: 227 --KGWAVDQNKFRLLNTDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLYCS 284

Query: 301 YDGDADRIVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYAN 360
           +DGDADRIVFY++      F+LLDGDKI+TLFAKF   L   A  +  L +GVVQTAYAN
Sbjct: 285 FDGDADRIVFYFVK--NKQFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYAN 342

Query: 361 GSSTNYISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSELTKL 420
           G+ST YI+S+L +P +CTKTGVKHLHH A T+YDIGIYFEANGHGTV+FSDKF+  +  +
Sbjct: 343 GNSTRYIASELGIPSACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGV 402

Query: 421 KESGSSREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLAK 480
             +  +    TL  FS+LINQTVGDA++DML V+AVL  LQ +P  W  EY DLPN L K
Sbjct: 403 ASTNDA--ASTLYHFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTK 460

Query: 481 VIVPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAKTQ 540
           V+VPDRS F TTDQER+LV P+GLQ  ++  V      RSFVRASGTE+AVR+Y EA+  
Sbjct: 461 VVVPDRSIFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDP 520

Query: 541 EETEWLSKKVCQLVIESV 558
           +E + LSK+V + V+ SV
Sbjct: 521 QEVQELSKQVTEAVLNSV 538

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score =  522 bits (1344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/552 (52%), Positives = 366/552 (66%), Gaps = 26/552 (4%)

Query: 12  LKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAIGVM 71
            +  + + C+ + + YTYGTAGFR +   LDTVMFTTGIVA LRS+ L    K   +GVM
Sbjct: 3   FRDLYEQYCK-QGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYL----KSKFVGVM 57

Query: 72  VTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDSIVTLEND 131
           +TASHNPPEDNGVK++EP G ML+Q WEP AT+ AN AA+ SF +    L   I  L  +
Sbjct: 58  ITASHNPPEDNGVKVVEPYGEMLVQNWEPIATKLAN-AASSSFTQLESTLQSIIAEL--N 114

Query: 132 LNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFLTNLTNTTG 191
           ++  Q   + +  DSR+S P L+  +    ++    KII++  +TTPQLHFL    NT+ 
Sbjct: 115 IDTTQLANITVARDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNTSS 174

Query: 192 TAEEIN---YYDHFNKYLSQLQSLYPPFNLPFDNLIIDAANGIGAPQVEKLLFTXXXXXX 248
              ++    YYDHF    +QL  LY    LPF +L ID ANGIGA +V++L+        
Sbjct: 175 QPSQVRDSTYYDHFVSIWNQLTQLYEVTELPF-HLTIDCANGIGADKVKQLI----SQAG 229

Query: 249 XXXXXXXXXXXXXXXXXXLLNMNCGADYVKTNQKLPQGI-PKDIDANSTLFCSYDGDADR 307
                             LLN +CGAD+VKTNQ  P    PK     S L+CS+DGDADR
Sbjct: 230 HMLENSLTAVNGETKTFQLLNESCGADFVKTNQTFPANCNPKP----SQLYCSFDGDADR 285

Query: 308 IVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYANGSSTNYI 367
           +VFYY+D   N F+LLDGDKIATL AK  ++LL    L+  LKLGVVQTAYANGSST YI
Sbjct: 286 VVFYYVDGKENKFHLLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYI 345

Query: 368 SSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSEL-TKLKESGSS 426
           + KLK+PVSCTKTGVKHLHHEA+++YDIGIYFEANGHGTVIFS +F   + ++L+E+  +
Sbjct: 346 TDKLKIPVSCTKTGVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGN 405

Query: 427 RE----IKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLAKVI 482
            +    + +L L S+LINQTVGDA+SDMLAVIA LSI  L P  WD  Y+DLPN+L KVI
Sbjct: 406 EQQYKSLLSLKLLSQLINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVI 465

Query: 483 VPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAKTQEE 542
           VPDRS F++T+ ER+L+ P+GLQ  ++  V      RSFVRASGTEDAVRVYAEA+T E 
Sbjct: 466 VPDRSVFVSTNAERQLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTES 525

Query: 543 TEWLSKKVCQLV 554
              L+ KV +LV
Sbjct: 526 AIELATKVGELV 537

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score =  514 bits (1324), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 272/542 (50%), Positives = 354/542 (65%), Gaps = 29/542 (5%)

Query: 27  YTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAIGVMVTASHNPPEDNGVKI 86
           Y YGTAGFR  A+ L  V+F TG++ACLRSL L  +     +GVM+TASHNPPEDNGVK+
Sbjct: 21  YAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAY----VGVMLTASHNPPEDNGVKL 76

Query: 87  IEPNGSMLLQEWEPKATQFANIAAN---ESFDEFYQLLIDSIVTLENDLNIKQPPTLILG 143
           ++P+G ML  EWE  AT  AN A+    E  D  + +L+D +      L++     +++ 
Sbjct: 77  VDPHGEMLAAEWEKHATALANCASQGQQELLDALH-MLVDRL-----GLDLALRARVVVA 130

Query: 144 HDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFLTNLTNTTGTAEEIN---YYD 200
            DSR S P L++ ++    ++ + ++++   +TTPQLHFLT   N  G+A  +    YY 
Sbjct: 131 RDSRASGPQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNERGSAAGVREDLYYA 190

Query: 201 HFNKYLSQLQSLYPPFNLPFDNLIIDAANGIGAPQVEKLLFTXXXXXXXXXXXXXXXXXX 260
           HF   L +L +L+    LPF  L++D ANG+GA +  +L                     
Sbjct: 191 HFVAALEELAALHGLETLPFP-LVVDTANGVGALKARELF-----RRSPLFKNRVSIIND 244

Query: 261 XXXXXXLLNMNCGADYVKTNQKLPQGIPKDIDANSTLFCSYDGDADRIVFYYIDPMTNNF 320
                 LLN  CGADYVKT Q LPQGI  D+    +LFCSYDGDADR++FYYID     F
Sbjct: 245 NWSQHELLNSGCGADYVKTKQCLPQGISADL-LRESLFCSYDGDADRVIFYYIDGQ-ERF 302

Query: 321 NLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYANGSSTNYISSKLKVPVSCTKT 380
           +LLDGDKI+TL AKF  + L  A +N  + LGVVQTAYANGSST Y+S  L+VPVSCT T
Sbjct: 303 HLLDGDKISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCTPT 362

Query: 381 GVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSELTKLKE----SGSSR-EIKTLLLF 435
           GVKHLH EA+ KYD+GIYFEANGHGTVIFS+ F   + +  E    S  +R  ++TL  F
Sbjct: 363 GVKHLHREAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLKTF 422

Query: 436 SELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLAKVIVPDRSKFITTDQE 495
           + LINQT+GDA++DMLAVIA+LSIL  SP  WDK+Y DLPN L KV+VPDRS F TT+ E
Sbjct: 423 ANLINQTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTNAE 482

Query: 496 RKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAKTQEETEWLSKKVCQLVI 555
           ++L  P GLQ L+++ V     GRSFVRASGTEDAVR+YAEA +Q++ + L+ KV  LV+
Sbjct: 483 QQLTSPAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTLVV 542

Query: 556 ES 557
           ES
Sbjct: 543 ES 544

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score =  507 bits (1306), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 280/551 (50%), Positives = 366/551 (66%), Gaps = 25/551 (4%)

Query: 12  LKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAIGVM 71
           L++ +   C++  + Y YGTAGFR  A  LDTVMFTTG++A LRS+ L+       +GVM
Sbjct: 7   LETLYETHCKS-GFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRT----VGVM 61

Query: 72  VTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDSIVTLEND 131
           +TASHNPPEDNGVKI++P G ML Q WE  AT  AN +A +SF  F   L + +  L   
Sbjct: 62  ITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLAN-SATQSFTAFLAYLQNLVSEL--G 118

Query: 132 LNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFLTNLTNTTG 191
           L+     +L +  DSR+S P L++ ++  + ++ N +I +Y  +TTPQLHFLT+  N   
Sbjct: 119 LDTDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNELP 178

Query: 192 TAEEINYYDHFNKYLS---QLQSLYPPFNLPFDNLIIDAANGIGAPQVEKLLFTXXXXXX 248
               I+ + ++ ++LS    + +L    +LP+  L IDAANGIGAP+V+++L T      
Sbjct: 179 NDTAIDRFFYYKEFLSAWDDITALCGIQSLPY-KLEIDAANGIGAPRVKEMLSTHKFFDG 237

Query: 249 XXXXXXXXXXXXXXXXXXLLNMNCGADYVKTNQKLPQGIPKDIDANSTLFCSYDGDADRI 308
                              LN  CGADYVKTNQ+LP GI  + D    + CS+DGDADRI
Sbjct: 238 VFRVVNDDWETPAS-----LNHLCGADYVKTNQRLPYGIQANNDCQR-ICCSFDGDADRI 291

Query: 309 VFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYANGSSTNYIS 368
           VFY+ D     F LLDGDK+ATLFAKFF ++L+ A L   L LGVVQTAYANGSST+YI 
Sbjct: 292 VFYFCDS-EGQFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIE 350

Query: 369 SKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKF----HSELTKLKESG 424
             L +PV+CT TGVKHLHHEAI  YDIG+YFEANGHGTV+FS KF    +S L+   +S 
Sbjct: 351 RVLGIPVTCTPTGVKHLHHEAI-NYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSD 409

Query: 425 SS-REIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLAKVIV 483
           SS + ++ L  F+ LINQTVGDA+SDM+ V+AVLSIL+ +P  W++EY DLPNKL KV+V
Sbjct: 410 SSLQSLEVLSKFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLV 469

Query: 484 PDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAKTQEET 543
           PDR+ F TT+ ER+L+ P GLQP +   VA     RSFVRASGTEDAVRVYAEA T+EE 
Sbjct: 470 PDRTVFKTTNAERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEA 529

Query: 544 EWLSKKVCQLV 554
           + L+ +V Q+V
Sbjct: 530 DSLASRVSQVV 540

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 35/75 (46%), Gaps = 14/75 (18%)

Query: 35  RDNAKRLDTVMFTTGIVACLRSLTLQTSNK--------------HSAIGVMVTASHNPPE 80
           R ++K    +   T + A  +   L T N+               SA GVM+TASHNP +
Sbjct: 110 RYHSKEFADITVATFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSACGVMITASHNPKD 169

Query: 81  DNGVKIIEPNGSMLL 95
           DNG K+   NG  ++
Sbjct: 170 DNGYKVYYSNGCQII 184

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 63  NKHSAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95
           N  +++GVMVTASHNP  DNG K+   NG  ++
Sbjct: 161 NLKASVGVMVTASHNPKMDNGYKVYYSNGCQII 193

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 15/66 (22%)

Query: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSML---------------LQEWEPKATQFANIAA 110
           +++GVM+TASHNP  DNG K+   NG  +               L+ WEP       I A
Sbjct: 152 ASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLNIARSIDQNLEPWEPSWDWPTVIQA 211

Query: 111 NESFDE 116
            E  D 
Sbjct: 212 AEKEDR 217

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 23/31 (74%)

Query: 65  HSAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95
           +++IGVM+TASHNP  DNG K+   NG  ++
Sbjct: 151 NASIGVMITASHNPKMDNGYKVYYSNGCQII 181

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 22/30 (73%)

Query: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95
           +++GVMVTASHNP  DNG K+   NG  ++
Sbjct: 149 ASVGVMVTASHNPKMDNGYKVYYSNGCQII 178

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%)

Query: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95
           +++GVM+TASHNP  DNG K+   NG  ++
Sbjct: 157 ASVGVMITASHNPKMDNGYKVYYSNGCQII 186

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 22/30 (73%)

Query: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95
           ++IGVM+TASHNP  DNG K+   NG  ++
Sbjct: 155 ASIGVMITASHNPEMDNGYKVYYNNGCQII 184

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%)

Query: 286 GIPKDIDANSTLFCSYDGDADRIVFYYIDPMTNNFNLLDGDKIATLFAKF 335
           GI      N  L  + D DADR      +P+T+ F  L G++I  LFA F
Sbjct: 317 GIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYF 366

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%)

Query: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95
           +++GVM+TASHNP  DNG K+   NG  ++
Sbjct: 155 ASVGVMITASHNPKMDNGYKVYYSNGCQII 184

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 23/31 (74%)

Query: 65  HSAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95
           ++++GVM+TASHNP  DNG K+   NG  ++
Sbjct: 145 NASVGVMITASHNPKMDNGYKVYYTNGCQII 175

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%)

Query: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95
           +++GVM+TASHNP  DNG K+   NG  ++
Sbjct: 149 ASVGVMITASHNPKMDNGYKVYYSNGCQII 178

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 23/31 (74%)

Query: 65  HSAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95
           ++++GVM+TASHNP  DNG K+   NG  ++
Sbjct: 148 NASVGVMITASHNPKMDNGYKVYYSNGCQII 178

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%)

Query: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95
           +++GVM+TASHNP  DNG K+   NG  ++
Sbjct: 149 ASVGVMITASHNPKMDNGYKVYYSNGCQII 178

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score = 38.5 bits (88), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%)

Query: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95
           +++GVM+TASHNP  DNG K+   NG  ++
Sbjct: 145 ASVGVMITASHNPKLDNGYKVYYANGCQII 174

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 22/30 (73%)

Query: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95
           +++G+M+TASHNP  DNG K+   NG  ++
Sbjct: 152 ASVGIMITASHNPKMDNGYKVYYTNGCQII 181

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score = 37.7 bits (86), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%)

Query: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95
           ++ GVM+TASHNP  DNG K+   NG  ++
Sbjct: 157 TSCGVMITASHNPKMDNGYKVYYANGCQII 186

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score = 37.7 bits (86), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%)

Query: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95
           ++ GVM+TASHNP  DNG K+   NG  ++
Sbjct: 153 ASAGVMITASHNPKMDNGYKVYYSNGCQII 182

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score = 37.4 bits (85), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 69  GVMVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAAN-ESFDEFY 118
           G+M+TASHNP  DNG K+   NG  ++   + + +Q  +I AN E +D  +
Sbjct: 157 GIMITASHNPKMDNGYKVYYSNGCQIIPPHDQRISQ--SILANLEPWDRAW 205

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (66%)

Query: 63  NKHSAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95
           N  +++GVM+TASHNP  DNG K+   N   ++
Sbjct: 148 NLKASVGVMITASHNPKMDNGYKVYYDNACQII 180

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95
           ++ G+M+TASHNP  DNG K+   NG  ++
Sbjct: 153 ASAGIMITASHNPKMDNGYKVYYSNGCQII 182

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSML 94
           ++ G+M+TASHNP  DNG K+   NG  +
Sbjct: 161 ASCGIMITASHNPKMDNGYKVYYSNGCQI 189

>TBLA0C00905 Chr3 complement(181152..182633) [1482 bp, 493 aa] {ON}
          Length = 493

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 21/39 (53%)

Query: 203 NKYLSQLQSLYPPFNLPFDNLIIDAANGIGAPQVEKLLF 241
           NKY S  +SL    N+P D L+ D +N     + E+ ++
Sbjct: 436 NKYSSATESLESQLNIPMDGLVTDTSNTSPEAEEERKVY 474

>Smik_2.276 Chr2 (490292..497398) [7107 bp, 2368 aa] {ON} YBR136W
           (REAL)
          Length = 2368

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 53/129 (41%), Gaps = 15/129 (11%)

Query: 36  DNAKRLDTVMFTTGIVACLRS---------LTLQTSNKHSAIGVMVTASHNPPEDNGVKI 86
           +N  RL +   T G +ACL S          T    N        V  + NP E      
Sbjct: 450 NNVTRLTSWTVTLGRLACLESKKFAGCQTNFTKNMDNWFVCHLCDVDKTGNPFER----- 504

Query: 87  IEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDSIV-TLENDLNIKQPPTLILGHD 145
           I PN    + + E     ++N  ++ + DEF Q L+  I+ +L    +  QPP LI G  
Sbjct: 505 INPNRPEAVSKSEVFKILYSNFLSHSNVDEFSQSLLSGILFSLHRIFSHFQPPKLIDGDG 564

Query: 146 SRDSSPTLM 154
             + + TL+
Sbjct: 565 QINKAFTLV 573

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,959,032
Number of extensions: 2650930
Number of successful extensions: 8584
Number of sequences better than 10.0: 56
Number of HSP's gapped: 8699
Number of HSP's successfully gapped: 59
Length of query: 561
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 446
Effective length of database: 40,294,809
Effective search space: 17971484814
Effective search space used: 17971484814
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)