Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0K028806.14ON70470429260.0
NCAS0F002206.14ON69550416130.0
SAKL0E01012g6.14ON54449715640.0
Suva_5.76.14ON66449215440.0
Smik_5.276.14ON60849315370.0
Skud_5.296.14ON60849115350.0
YEL060C (PRB1)6.14ON63549215370.0
Kwal_56.223876.14ON54349814870.0
KLTH0C11396g6.14ON55048014650.0
TDEL0G045506.14ON56447014600.0
TBLA0A073006.14ON57349014550.0
KLLA0D00979g6.14ON56147214230.0
CAGL0B03619g6.14ON46840013890.0
KAFR0L003606.14ON50242013810.0
ZYRO0C07942g6.14ON54849513770.0
Kpol_1032.56.14ON68046913730.0
KNAG0E009206.14ON53149413201e-175
ACR012C6.14ON54148013141e-174
Kpol_1045.756.14ON47749212891e-171
Ecym_30186.14ON57547412761e-168
TPHA0M002306.14ON58546812341e-161
Smik_15.1726.14ON47841911071e-144
Suva_15.1786.14ON47641711001e-143
Skud_15.1646.14ON48242310741e-139
YOR003W (YSP3)6.14ON47841910691e-138
CAGL0E02651g6.14ON48543010001e-128
KAFR0B065506.14ON4563479541e-121
NCAS0D026306.14ON4513508831e-111
NDAI0I022806.14ON4823438621e-107
KNAG0F02970singletonON4203228261e-103
CAGL0L13266gsingletonON5794426424e-74
ZYRO0D08822g6.313ON4903724743e-51
TDEL0A072806.313ON4363594695e-51
Kpol_1028.616.313ON5183224641e-49
Smik_3.1496.313ON4913184585e-49
Suva_3.846.313ON5273404562e-48
YCR045C (RRT12)6.313ON4913394445e-47
NCAS0D043906.313ON4923214437e-47
SAKL0A02002g6.313ON4793644392e-46
Skud_3.1246.313ON5403394361e-45
KLTH0A06094g6.313ON4963184271e-44
TBLA0F039706.313ON7343314342e-44
KAFR0J024506.313ON4783634181e-43
CAGL0L10802g6.313ON5173434201e-43
Kpol_1018.56.313ON4653184171e-43
KNAG0I024706.313ON4753614162e-43
TPHA0D037606.313ON6073644126e-42
NDAI0I005606.313ON4833344013e-41
AAR069W6.313ON7683204113e-41
Ecym_21056.313ON6103164031e-40
Kwal_23.61836.313ON4933233917e-40
KLLA0F06028g6.313ON5083213573e-35
Kwal_33.133721.78ON3772883132e-30
TBLA0A067006.313ON4972593094e-29
Kpol_2000.691.78ON3863202931e-27
KLTH0F02288g1.78ON3802922789e-26
ZYRO0F16764g1.78ON3862992654e-24
TPHA0B045201.78ON3883062221e-18
TDEL0C062301.78ON3643092166e-18
TBLA0A054101.78ON3822822016e-16
Kpol_228.16.236ON56042810.36
NDAI0A020407.328ON73764752.5
KAFR0A080402.6ON76664708.1
NCAS0F004905.85ON98766709.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0K02880
         (704 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...  1131   0.0  
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   625   0.0  
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   607   0.0  
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   599   0.0  
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   596   0.0  
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   595   0.0  
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   596   0.0  
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   577   0.0  
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   568   0.0  
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   566   0.0  
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   565   0.0  
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   552   0.0  
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   539   0.0  
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   536   0.0  
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   535   0.0  
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   533   0.0  
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   513   e-175
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   510   e-174
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   501   e-171
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   496   e-168
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   479   e-161
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   431   e-144
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   428   e-143
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   418   e-139
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   416   e-138
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   389   e-128
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   372   e-121
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     344   e-111
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   336   e-107
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              322   e-103
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   251   4e-74
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   187   3e-51
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   185   5e-51
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   183   1e-49
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   181   5e-49
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   180   2e-48
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   175   5e-47
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   175   7e-47
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   173   2e-46
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   172   1e-45
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   169   1e-44
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   171   2e-44
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   165   1e-43
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   166   1e-43
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   165   1e-43
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   164   2e-43
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   163   6e-42
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    159   3e-41
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   162   3e-41
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   159   1e-40
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   155   7e-40
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   142   3e-35
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   125   2e-30
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   123   4e-29
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   117   1e-27
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   111   9e-26
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   106   4e-24
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...    90   1e-18
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...    88   6e-18
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    82   6e-16
Kpol_228.1 s228 (611..2293) [1683 bp, 560 aa] {ON} (611..2293) [...    36   0.36 
NDAI0A02040 Chr1 (454109..456322) [2214 bp, 737 aa] {ON} Anc_7.3...    33   2.5  
KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa] ...    32   8.1  
NCAS0F00490 Chr6 (89926..92889) [2964 bp, 987 aa] {ON} Anc_5.85 ...    32   9.3  

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score = 1131 bits (2926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/704 (81%), Positives = 572/704 (81%)

Query: 1   MKKTIHKNEKRRNDREYPFEKQEEXXXXXXXXXXXXXXXXXXXXXXXXXXXYDAPHDGLD 60
           MKKTIHKNEKRRNDREYPFEKQEE                           YDAPHDGLD
Sbjct: 1   MKKTIHKNEKRRNDREYPFEKQEEHKKKHKKDKKKKHHKPPHHPPKPPHHPYDAPHDGLD 60

Query: 61  HKLPHHPYDAPHDGLDHKLPHHPYDAPHDGLDHKLPHHPYDAPHDGLDHKYXXXXXXXXX 120
           HKLPHHPYDAPHDGLDHKLPHHPYDAPHDGLDHKLPHHPYDAPHDGLDHKY         
Sbjct: 61  HKLPHHPYDAPHDGLDHKLPHHPYDAPHDGLDHKLPHHPYDAPHDGLDHKYPPSTSSSQG 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRPDDNKQVSNDKYSDIFHK 180
                                                    RPDDNKQVSNDKYSDIFHK
Sbjct: 121 SSPQATSHPPHDGPHDGPHHKPPHPPHDGPHDGPHDGPHHKRPDDNKQVSNDKYSDIFHK 180

Query: 181 YSKQIIESARKLKDNTPNAAGKXXXXXXXXXXXIKLAPLITPTFGDDIHTQGFKHPRILP 240
           YSKQIIESARKLKDNTPNAAGK           IKLAPLITPTFGDDIHTQGFKHPRILP
Sbjct: 181 YSKQIIESARKLKDNTPNAAGKDQDQDDQDDQDIKLAPLITPTFGDDIHTQGFKHPRILP 240

Query: 241 NKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPXXXXXXXXXXXXXXXXRXXXXXXX 300
           NKYIIVFKDSINIDEISYHKELISEIQQQSASRLPP                R       
Sbjct: 241 NKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPHHHFFHSTSEEEEESFRNGGIISS 300

Query: 301 XXXXXXXXXYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRISHRER 360
                    YSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRISHRER
Sbjct: 301 FNINNILSGYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRISHRER 360

Query: 361 LNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGNGHGTH 420
           LNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGNGHGTH
Sbjct: 361 LNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGNGHGTH 420

Query: 421 CAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAETHLNNEKNKKDYKGST 480
           CAGTIASTHYG            LRSNGSGSMSDVIKGVEFAAETHLNNEKNKKDYKGST
Sbjct: 421 CAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAETHLNNEKNKKDYKGST 480

Query: 481 ANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGASTLSDD 540
           ANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGASTLSDD
Sbjct: 481 ANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGASTLSDD 540

Query: 541 RAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSLQPDSK 600
           RAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSLQPDSK
Sbjct: 541 RAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSLQPDSK 600

Query: 601 SGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISDLWNGKVQE 660
           SGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISDLWNGKVQE
Sbjct: 601 SGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISDLWNGKVQE 660

Query: 661 QAHEEPAHEDKINFENLVDSDSMSGKTDLFFDQIRNVFEKMNII 704
           QAHEEPAHEDKINFENLVDSDSMSGKTDLFFDQIRNVFEKMNII
Sbjct: 661 QAHEEPAHEDKINFENLVDSDSMSGKTDLFFDQIRNVFEKMNII 704

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/504 (63%), Positives = 379/504 (75%), Gaps = 24/504 (4%)

Query: 165 DNKQVSNDKYSDI---FHKYSKQIIESARKLKDNTPNAAGKXXXXXXXXXXXIKLAPLIT 221
           D   ++N K++DI     KYS+QIIESARK+  +  ++              +K+APL+T
Sbjct: 31  DKLAINNKKFNDITDVVAKYSEQIIESARKIGKSVQDSVN------------LKMAPLVT 78

Query: 222 PT---FGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPXX 278
           PT              +  I+PN+YI+VFK SI  +E+ +HKELI++IQ +SA++LP   
Sbjct: 79  PTPYPVVSGASANSNANSNIIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDD 138

Query: 279 XXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXYSGYFTQEVIDLIRLNPLVKYVERDSIVQ 338
                         +                Y GYFT EV++LIR+NPLV+YVE+DS+VQ
Sbjct: 139 KFFSASAIEDESINQGGILTTFNISNLLNG-YVGYFTDEVLELIRMNPLVEYVEKDSLVQ 197

Query: 339 TTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKR 398
            TEF+ QNNAPWGL+RISHRERLNLGSFNKYLYDDDAGKGVTC+VIDTGIN  H DF KR
Sbjct: 198 ATEFDNQNNAPWGLARISHRERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKR 257

Query: 399 AIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKG 458
           A+WGKTIP ND+DIDGNGHGTHCAGTIASTHYG            LRSNGSGSMSDVIKG
Sbjct: 258 AVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKG 317

Query: 459 VEFAAETHLNNEKNKKD-YKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQD 517
           VEFAAE+H+   K KK  +KGSTANMSLGGGKSPTLDLAVNAAV+AGIHF+VAAGNENQD
Sbjct: 318 VEFAAESHIKAAKEKKKGFKGSTANMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQD 377

Query: 518 ACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSG 577
           ACN+SPASAE AITVGASTLSDDRAYFSNWG+CVD+FAPGLNILSTY+GD +D TATLSG
Sbjct: 378 ACNTSPASAERAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGD-DDATATLSG 436

Query: 578 TSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGT 637
           TSMASPHVAGLLTYFLSLQP S S FF+     ++TP Q+KKKLI YS+ D+L+DLP+GT
Sbjct: 437 TSMASPHVAGLLTYFLSLQPGSDSEFFDPT---ELTPAQMKKKLINYSSKDVLFDLPEGT 493

Query: 638 PNKLIYNGAGGDISDLWNGKVQEQ 661
           PNKLI+NGAGG++ DLWN K QE+
Sbjct: 494 PNKLIFNGAGGNLDDLWNKKSQEE 517

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 29/67 (43%), Gaps = 11/67 (16%)

Query: 54  APHDGLDHKLPHHPYDAPHDGLDHKLPHHPYDAP--HDGLDHKLPHHP--------YDAP 103
            PHD   H  P   +D P D   H  PH P+D    H   DH  PHHP        +D P
Sbjct: 578 GPHDPERHHRPED-HDGPKDHKKHDGPHGPHDPERHHRPEDHAGPHHPDDHGGHKKHDGP 636

Query: 104 HDGLDHK 110
           H   DHK
Sbjct: 637 HHPEDHK 643

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 32/67 (47%), Gaps = 10/67 (14%)

Query: 52  YDAPHDGLDHKLPHHPYDAP--HDGLDHKLPHHPYDAPHDG-LDHKLPHHPYD----APH 104
           +D P D   H  PH P+D    H   DH  PHHP D  H G   H  PHHP D      H
Sbjct: 591 HDGPKDHKKHDGPHGPHDPERHHRPEDHAGPHHPDD--HGGHKKHDGPHHPEDHKDHKKH 648

Query: 105 DG-LDHK 110
           DG  DHK
Sbjct: 649 DGEEDHK 655

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/497 (61%), Positives = 364/497 (73%), Gaps = 21/497 (4%)

Query: 214 IKLAPLITPTFGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASR 273
           +KLAPL++            +   I+P++YIIVFK     +EIS+HKE+ISE   +S ++
Sbjct: 63  VKLAPLVSSP----------QPANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAK 112

Query: 274 LPPXXXXXXXXXXXX-----XXXXRXXXXXXXXXXXXXXXXYSGYFTQEVIDLIRLNPLV 328
           L                                        Y GYFT EV+D IR+N  V
Sbjct: 113 LDSKDSFFAATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWV 172

Query: 329 KYVERDSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGI 388
           +++E+DS+V  +EF+TQN APWGLSRISHRERLNLGSFNKYLYDDDAGKGVT +VIDTGI
Sbjct: 173 EFIEKDSLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGI 232

Query: 389 NVNHVDFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNG 448
           NVNH DF  RA+WGKT+P ND+D DGNGHGTHCAGTIAS HYG            LRSNG
Sbjct: 233 NVNHKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNG 292

Query: 449 SGSMSDVIKGVEFAAETHLN-NEKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHF 507
           SG+MSDV+KGVEFAA++H   ++KNKK +KGSTANMSLGGGKSP LDLAVNAAV+AGIHF
Sbjct: 293 SGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHF 352

Query: 508 SVAAGNENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGD 567
           +VAAGNENQDACN+SPA+AENAITVGASTLSDDRAYFSNWG+CVD+FAPGLN+LSTY+G 
Sbjct: 353 AVAAGNENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGS 412

Query: 568 GNDNTATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTS 627
               TATLSGTSMASPHVAGLLTYFLSLQPDS S FF +     ITP QLKKKLIAYST 
Sbjct: 413 -ETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASG---ITPAQLKKKLIAYSTK 468

Query: 628 DILYDLPDGTPNKLIYNGAGGDISDLWNGKVQEQAHEEPAHEDKINFENLVDSDSMSGKT 687
           D+LY+LP+ TPN LIYNG G D+SD W GK +EQ  EE + +D  +F+     +S   KT
Sbjct: 469 DVLYELPEDTPNYLIYNGGGQDLSDFW-GKSEEQVKEEGSIQDFKDFKLSELIESFDTKT 527

Query: 688 DLFFDQIRNVFEKMNII 704
           DL F+++R+VF+K+NII
Sbjct: 528 DLLFEEVRSVFDKLNII 544

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/492 (61%), Positives = 361/492 (73%), Gaps = 17/492 (3%)

Query: 215 KLAPLI-TPTFGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASR 273
           KLAPL+ T  F  D  T      +I+PN+YIIVFK  +  +E ++H+E + + Q QS   
Sbjct: 188 KLAPLVSTEQFNPDAIT------KIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVEN 241

Query: 274 LPPXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXYSGYFTQEVIDLIRLNPLVKYVER 333
           L                                   Y GYFTQE++DLIR NPLV +VE+
Sbjct: 242 LAAEDAFFISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEK 301

Query: 334 DSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHV 393
           DS+V+ T+F+TQN+APWGL+R+SHRERLNLGSFNKYLYDDDAG+GVT +VIDTG+NVNH 
Sbjct: 302 DSVVEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHK 361

Query: 394 DFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMS 453
           DF KRAIWGKTIP ND+D+DGNGHGTHCAGTIAS HYG            LRSNGSG+MS
Sbjct: 362 DFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMS 421

Query: 454 DVIKGVEFAAETHLNN-EKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAG 512
           DV+KGVE+AA+ H    E+ KK +KGSTANMSLGGGKSP LDLAVNAAVEAGIHF+VAAG
Sbjct: 422 DVLKGVEYAAKAHQKQAEEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAG 481

Query: 513 NENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNT 572
           NENQDACN+SPASA+ AITVGASTLSDDRAYFSN+G+CVDVFAPGLNILSTY+G  ++ T
Sbjct: 482 NENQDACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIG-SDEAT 540

Query: 573 ATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYD 632
           ATLSGTSMASPHVAGLLTYFLSLQP S S FF    D  +TP+QLKKKLI YST DIL+D
Sbjct: 541 ATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQD-SLTPQQLKKKLIHYSTKDILFD 599

Query: 633 LPDGTPNKLIYNGAGGDISDLWNGKVQEQAHEEPAHEDKINFENLVDSDSMSGKTDLFFD 692
           +PD TPN LIYNG G D+S  WN    +++H     + ++N +  + S     KTDL F+
Sbjct: 600 IPDDTPNALIYNGGGQDLSAFWND--TKKSHSSSGFKQELNLDEFIGS-----KTDLIFE 652

Query: 693 QIRNVFEKMNII 704
           Q+R+V +K+NII
Sbjct: 653 QVRDVLDKLNII 664

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/493 (61%), Positives = 363/493 (73%), Gaps = 20/493 (4%)

Query: 215 KLAPLI-TPTFGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASR 273
           KLAPL+ T  F  D  +      +I+PN+YI+VFK  +  +E+++HKE + + Q QS   
Sbjct: 133 KLAPLVSTAQFNPDAIS------KIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVEN 186

Query: 274 LPPXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXYSGYFTQEVIDLIRLNPLVKYVER 333
           L                                   Y GYFTQE+IDLIR NPLV +VER
Sbjct: 187 LSAEDAFFTSTRDTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVER 246

Query: 334 DSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHV 393
           DS+V+ TEF+TQN+APWGL+RISHRERLNLGSFNKYLYDDDAG+GVT +VIDTG+N+NH 
Sbjct: 247 DSVVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHK 306

Query: 394 DFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMS 453
           DF KRAIWGKTIP ND+D+DGNGHGTHCAGTIAS HYG            LRSNGSG+MS
Sbjct: 307 DFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMS 366

Query: 454 DVIKGVEFAAETHLNN-EKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAG 512
           DV+KGVE+AA+ H    ++ KK +KGSTANMSLGGGKSP LDLAVNAAVEAGIHF+VAAG
Sbjct: 367 DVVKGVEYAAKAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAG 426

Query: 513 NENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNT 572
           NENQDACN+SPASA+ AITVGASTLSDDRAYFSNWG+CVDVFAPGLNILSTY+G  ++ T
Sbjct: 427 NENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGS-DEAT 485

Query: 573 ATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYD 632
           ATLSGTSMASPHVAGLLTYFLSLQP S S FF    D  +TP+QLKKKLI YST DIL+D
Sbjct: 486 ATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQD-SLTPQQLKKKLIHYSTKDILFD 544

Query: 633 LPDGTPNKLIYNGAGGDISDLWNGKVQEQAHEEPA-HEDKINFENLVDSDSMSGKTDLFF 691
           +P+ TPN LIYNG G D+S  WN    +++H   + HE  +N +  + S     KTDL F
Sbjct: 545 IPEDTPNFLIYNGGGQDLSAFWND--TKKSHPSGSKHE--LNMDEFIGS-----KTDLLF 595

Query: 692 DQIRNVFEKMNII 704
           +Q+R+V +K+NII
Sbjct: 596 EQVRDVLDKLNII 608

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/491 (61%), Positives = 354/491 (72%), Gaps = 16/491 (3%)

Query: 215 KLAPLITPTFGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRL 274
           KLAPL++    D         P+I+PN+YIIVFK  +  +   +HKE + + Q QS   L
Sbjct: 133 KLAPLVSTAQFDPA-----AMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENL 187

Query: 275 PPXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXYSGYFTQEVIDLIRLNPLVKYVERD 334
                                              Y GYFTQE+IDLIR NPLV +VERD
Sbjct: 188 SAEDAFFISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERD 247

Query: 335 SIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVD 394
           S+V+ T+F+TQN+APWGL+RISHRERLNLGSFNKYLYDDDAG+GVT +VIDTG+NVNH D
Sbjct: 248 SVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKD 307

Query: 395 FGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSD 454
           F KRAIWGKTIP ND+D+DGNGHGTHCAGTIAS HYG            LRSNGSG+MSD
Sbjct: 308 FEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSD 367

Query: 455 VIKGVEFAAETHLNN-EKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGN 513
           V+KGVE+AA  H    ++ KK +KGSTANMSLGGGKSP LDLAVNAAVEAGIHF+VAAGN
Sbjct: 368 VVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGN 427

Query: 514 ENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTA 573
           ENQDACN+SPASA+ AITVGASTLSDDRAYFSNWG+CVD+FAPGLNILSTY+G  +D TA
Sbjct: 428 ENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGS-DDATA 486

Query: 574 TLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDL 633
           TLSGTSMASPHVAGLLTYFLSLQP S S FF    D  +TP+QLK KLI YST DIL+D+
Sbjct: 487 TLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQD-SLTPQQLKNKLIHYSTKDILFDV 545

Query: 634 PDGTPNKLIYNGAGGDISDLWNGKVQEQAHEEPAHEDKINFENLVDSDSMSGKTDLFFDQ 693
           P+ TPN LIYNG G D+S  WN   +  +      + ++N +  + S     KTDL F+Q
Sbjct: 546 PEDTPNALIYNGGGQDLSAFWNDTKKSHSSR---FKQELNMDEFIGS-----KTDLIFEQ 597

Query: 694 IRNVFEKMNII 704
           +R+V +K+NII
Sbjct: 598 VRDVLDKLNII 608

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/492 (61%), Positives = 357/492 (72%), Gaps = 18/492 (3%)

Query: 215 KLAPLI-TPTFGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASR 273
           +LAPL+ T  F  D  +      +I+PN+YIIVFK     +EI +HKE + + Q QS   
Sbjct: 160 RLAPLVSTAQFNPDAIS------KIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVEN 213

Query: 274 LPPXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXYSGYFTQEVIDLIRLNPLVKYVER 333
           L                                   Y GYFTQE++DLIR NPLV +VER
Sbjct: 214 LSAEDAFFISTKDTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVER 273

Query: 334 DSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHV 393
           DSIV+ TEF+TQN+APWGL+RISHRERLNLGSFNKYLYDDDAG+GVT +VIDTG+N+NH 
Sbjct: 274 DSIVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHK 333

Query: 394 DFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMS 453
           DF KRAIWGKTIP ND+D+DGNGHGTHCAGTIAS HYG            LRSNGSG+MS
Sbjct: 334 DFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMS 393

Query: 454 DVIKGVEFAAETHLNN-EKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAG 512
           DV+KGVE+AA+ H    ++ KK +KGSTANMSLGGGKSP LDLAVNAAVE GIHF+VAAG
Sbjct: 394 DVVKGVEYAAKAHQKEAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAG 453

Query: 513 NENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNT 572
           NENQDACN+SPASA+ AITVGASTLSDDRAYFSNWG+CVDVFAPGLNILSTY+G  +D T
Sbjct: 454 NENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIG-SDDAT 512

Query: 573 ATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYD 632
           ATLSGTSMASPHVAGLLTYFLSLQP S S FF    D  +TP+QLKKKLI YST DIL+D
Sbjct: 513 ATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQD-SLTPQQLKKKLIHYSTKDILFD 571

Query: 633 LPDGTPNKLIYNGAGGDISDLWNGKVQEQAHEEPAHEDKINFENLVDSDSMSGKTDLFFD 692
           +P+ TPN LIYNG G D+S  WN   +  +      + ++N +  + S     KTDL FD
Sbjct: 572 IPEDTPNVLIYNGGGQDLSAFWNDTKKSHS---SGFKQELNMDEFIGS-----KTDLIFD 623

Query: 693 QIRNVFEKMNII 704
           Q+R++ +K+NII
Sbjct: 624 QVRDILDKLNII 635

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/498 (59%), Positives = 357/498 (71%), Gaps = 26/498 (5%)

Query: 214 IKLAPLITPTFGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASR 273
           + L+PL+T     D           +P++YI+VFKD +  +E+ +H E++SE   QS  +
Sbjct: 65  VTLSPLVTARNMYDA----------IPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGK 114

Query: 274 LPPXXX---XXXXXXXXXXXXXRXXXXXXXXXXXXXXXXYSGYFTQEVIDLIRLNPLVKY 330
           L                     R                Y GYFTQE++D IR+NPLV +
Sbjct: 115 LDANDAFFEATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAF 174

Query: 331 VERDSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINV 390
           VE+DS+V   EF+TQN APWGLSRISHRE+LNLGSFNKYLYDD AGKGVT +VIDTGIN+
Sbjct: 175 VEQDSMVYANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINI 234

Query: 391 NHVDFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSG 450
           +H DF  RA WGKT+P+ND D DGNGHGTHCAGTIAS HYG            LRSNGSG
Sbjct: 235 DHKDFEGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSG 294

Query: 451 SMSDVIKGVEFAAETHLNN-EKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSV 509
           SMSDV+KGVEFAA++H +  +KNKK +KGSTANMSLGGGKSP LD+AVNAAV+AGIHF+V
Sbjct: 295 SMSDVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAV 354

Query: 510 AAGNENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGN 569
           AAGNENQDACNSSPA+AENAITVGASTL+DDRAYFSNWG+CVD+FAPGLN+LSTY+G   
Sbjct: 355 AAGNENQDACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGS-E 413

Query: 570 DNTATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDI 629
             TATLSGTSMASPHVAGLLTYFLSLQPDS S +F++   G ITP QLKKKLIAYST + 
Sbjct: 414 TATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAA--GGITPSQLKKKLIAYSTKNA 471

Query: 630 LYDLPDGTPNKLIYNGAGGDISDLWNGKVQEQ---AHEEPAHEDKINFENLVDSDSMSGK 686
           L DLP+ T N LIYNG G D+ D W   ++E+   A +  A E    FE+++  D++  K
Sbjct: 472 LGDLPEDTVNYLIYNGGGQDLDDFWVKDLEEKVADAKDNTASE----FESII--DALEEK 525

Query: 687 TDLFFDQIRNVFEKMNII 704
           TD  +++IR +FE +NII
Sbjct: 526 TDGLYEEIREIFEGLNII 543

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/480 (60%), Positives = 348/480 (72%), Gaps = 22/480 (4%)

Query: 239 LPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPXXXXXXXX-------------X 285
           +P++YI+VFK +++ +E+ +HK+++SE   QS ++L                        
Sbjct: 79  IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQ 138

Query: 286 XXXXXXXRXXXXXXXXXXXXXXXXYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQ 345
                  R                Y GYFT E++D IR+NPLV +VE+DS+V   EF TQ
Sbjct: 139 RSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQ 198

Query: 346 NNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTI 405
           N APWGLSRISHRE+LNLGSFNKYLYDDDAGKGVT +VIDTG+NV+H DF  RA WGKTI
Sbjct: 199 NGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTI 258

Query: 406 PSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAET 465
           P+ND D DGNGHGTHCAGTIAS HYG            LRSNGSGSMSDV+KGVEFAA++
Sbjct: 259 PTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKS 318

Query: 466 HLNNEK-NKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPA 524
           H +  K NKK +KGSTANMSLGGGKSP LD+AVNAAV+AGIHF+VAAGNENQDACNSSPA
Sbjct: 319 HQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA 378

Query: 525 SAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPH 584
           SAENA+TVGASTL+DDRAYFSNWG+CVD+FAPGLN+LSTY+G  +  TATLSGTSMASPH
Sbjct: 379 SAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGS-DTATATLSGTSMASPH 437

Query: 585 VAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYN 644
           VAGLLTYFLSLQPDS S +F++   G ITP QLKKKLIAYST ++L D+PD T N LI+N
Sbjct: 438 VAGLLTYFLSLQPDSDSEYFHAA--GGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFN 495

Query: 645 GAGGDISDLWNGKVQEQAHEEPAHEDKINFENLVDSDSMSGKTDLFFDQIRNVFEKMNII 704
           G G  + D W    +E   +E   ED I+ E     D++  KTD+ +++IR VF+ MNII
Sbjct: 496 GGGEGLDDFWG---KESVVDEV--EDTISSEIESFIDALEEKTDVLYEEIREVFDHMNII 550

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/470 (62%), Positives = 347/470 (73%), Gaps = 14/470 (2%)

Query: 236 PRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPXXXXXXXXXXXXXXXXRXX 295
           P   P++YI+V K S + +EI+ H E I++ Q QS   L                  +  
Sbjct: 108 PNAFPHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGELAQDDPFFSAQGVRTTGGIQDS 166

Query: 296 XXXXXXXXXXXXXXYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRI 355
                         Y GYFT  V++LIR +P+V +VE DS V  +EF+TQN APWGLSRI
Sbjct: 167 FDVAGLLNG-----YVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRI 221

Query: 356 SHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGN 415
           SHRERLNLGSFNKYL+DD+AGKGVT +VIDTGINV H DF  RA WGKTIP+ND+D+DGN
Sbjct: 222 SHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGN 281

Query: 416 GHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAETHLNNEKNKKD 475
           GHGTHCAGTIAS HYG            LRSNGSGSMSDVIKGVEFAA++H    K+KK 
Sbjct: 282 GHGTHCAGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGVEFAAQSHQKAVKDKKK 341

Query: 476 -YKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGA 534
            +KGSTANMSLGGGKSP LDLAVNAAV+AGIHF+VAAGNENQDACN+SPA+AE A+TVGA
Sbjct: 342 GFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGA 401

Query: 535 STLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLS 594
           STLSDDRAYFSN+G+CVD+FAPGLNILSTY+G  +D TATLSGTSMASPHVAGLLTYFLS
Sbjct: 402 STLSDDRAYFSNYGKCVDIFAPGLNILSTYIGS-DDATATLSGTSMASPHVAGLLTYFLS 460

Query: 595 LQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISDLW 654
           LQPDS S FF++ S G +TPEQLKKKLIAYST DILYDLP+ TPN LIYNG G  +   W
Sbjct: 461 LQPDSDSDFFDAGSQG-VTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFW 519

Query: 655 NGKVQEQAHEEPAHEDKINFENLVDSDSMSGKTDLFFDQIRNVFEKMNII 704
           +G  +++A+      D    + L  SD++  KTD  FDQ+R+V +++NII
Sbjct: 520 DGHDKQEANTRFQDTD---LQEL--SDNLGAKTDALFDQVRDVLDRLNII 564

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/490 (59%), Positives = 354/490 (72%), Gaps = 26/490 (5%)

Query: 217 APLITPTFGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPP 276
           +P I P +   +H Q      I+P++YII FK  +  +EI +H++ I+E+QQQS ++LP 
Sbjct: 108 SPAIAPLYSQSLHPQ-----NIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLP- 161

Query: 277 XXXXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXYSGYFTQEVIDLIRLNPLVKYVERDSI 336
                                            Y GYFT +VID IRLNPLV++VE+DS 
Sbjct: 162 ---HDHPYFNSVEGLDLQQPIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDST 218

Query: 337 VQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFG 396
           V   EF+TQN APWGL+RISHRERLNLGSFNKYL+DD AG+GVT +VIDTG+NV H DF 
Sbjct: 219 VNINEFDTQNGAPWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFE 278

Query: 397 KRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVI 456
            RA WGKTIP+ND+D+DGNGHGTHCAGTIAS HYG            LRSNGSGSMSDV+
Sbjct: 279 GRASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVL 338

Query: 457 KGVEFAAETHLNNEKNKKD-YKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNEN 515
           KGVE+A  +HL + KNKK  +KGSTANMSLGGGKSP+LDLAVNAAV+AGIHF+VAAGNEN
Sbjct: 339 KGVEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNEN 398

Query: 516 QDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATL 575
           QDACN+SPASA+ AITVGASTLSDDRAYFSNWG+CVDVFAPGLNILSTY+G  +D TATL
Sbjct: 399 QDACNTSPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGS-DDATATL 457

Query: 576 SGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPD 635
           SGTSMASPHVAGLL+YFLSLQP+  S F  S+  G ITP QLKK+LI+Y T DIL D+P+
Sbjct: 458 SGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGG-ITPAQLKKRLISYGTKDILLDIPE 516

Query: 636 GTPNKLIYNGAGGDISDLWNGKVQEQAHEEPAH-EDKINFENLVDSDSMSGKTDLFFDQI 694
            TPN L++NGAG D+SD WN         +PA  E    ++NL     + G  D+ +DQ 
Sbjct: 517 LTPNVLVFNGAGQDLSDFWN-------ISKPADLESNEVYKNL----DLVG--DVLYDQF 563

Query: 695 RNVFEKMNII 704
             +F+KMN++
Sbjct: 564 TGIFKKMNLL 573

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/472 (59%), Positives = 340/472 (72%), Gaps = 13/472 (2%)

Query: 239 LPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPP-----XXXXXXXXXXXXXXXXR 293
           +PN+YIIVFK   + DE+ +H+EL+S    ++   L                        
Sbjct: 97  IPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSL 156

Query: 294 XXXXXXXXXXXXXXXXYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLS 353
                           Y GYFT+EVID IR +PLV++VE DS+V +  FNTQN+APWGL+
Sbjct: 157 EGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLA 216

Query: 354 RISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDID 413
           RISHRE+LNLGSFNKYLYDDDAGKGVT +V+DTG+NVNH DF  RA+WGKTIP +D D+D
Sbjct: 217 RISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVD 276

Query: 414 GNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAETHLNN-EKN 472
           GNGHGTHCAGTI S HYG            LRSNGSG+MSDV+KGVE+ AE H    E+ 
Sbjct: 277 GNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQ 336

Query: 473 KKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITV 532
           KK +KGSTANMSLGGGKSP LDLAVNAAV+AG+HF+VAAGNENQDACN+SPA+AENAITV
Sbjct: 337 KKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITV 396

Query: 533 GASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYF 592
           GASTLSD+RAYFSNWG+CVD+F PGLNILSTY+G  +  TATLSGTSMA+PHV GLLTYF
Sbjct: 397 GASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGS-DTATATLSGTSMATPHVVGLLTYF 455

Query: 593 LSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISD 652
           LSLQPD+ S +F++   G ITP QLKKKLI +ST ++L DLP+ T N LIYNG G D+ D
Sbjct: 456 LSLQPDADSEYFHAA--GGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDD 513

Query: 653 LWNGKVQEQAHEEPAHEDKINFENLVDSDSMSGKTDLFFDQIRNVFEKMNII 704
           LW GK      +EP+   + + E+L+  +S+  KTD  FD +R + ++ NII
Sbjct: 514 LW-GK-DYSIGKEPSANPEFSLESLI--NSLDSKTDAIFDDVRQLLDQFNII 561

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/400 (67%), Positives = 316/400 (79%), Gaps = 10/400 (2%)

Query: 312 GYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLY 371
           GYF + V+ L+  + +V++VERDS+V  + F+TQNNAPWGL+RISHR+RLNLG+FNKYLY
Sbjct: 72  GYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISHRDRLNLGNFNKYLY 131

Query: 372 DDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYG 431
           D+  G+GVT +VIDTGINV HV+F  RA WGKTIP ND DIDGNGHGTHCAGTIAS HYG
Sbjct: 132 DNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGHGTHCAGTIASKHYG 191

Query: 432 XXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAETHLNNEKNKKDYKGSTANMSLGGGKSP 491
                       L+S+GSG+MSDVIKGVE+AA+ HL   KN K +KGSTANMSLGGGKSP
Sbjct: 192 IAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHLKESKNNKKFKGSTANMSLGGGKSP 251

Query: 492 TLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCV 551
            LD+AVNAAV AGIHF+VAAGNENQDACN+SPASAE AITVGASTLSDDRAYFSNWG+CV
Sbjct: 252 ALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTLSDDRAYFSNWGKCV 311

Query: 552 DVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGK 611
           D+FAPGLNILSTY+GD N  TA+LSGTSMASPHVAGLLTYFLSLQPDS S F+++   G 
Sbjct: 312 DIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPDSDSEFYDASKHG- 370

Query: 612 ITPEQLKKKLIAYSTSDILYDLPD-GTPNKLIYNGAGGDISDLWNG-KVQEQAHEEPAHE 669
           +TP QLKKKLIAYST ++L DLPD  +PN LIYNGAGGD+   WN     EQ+ E P  E
Sbjct: 371 VTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNSTSADEQSAEHP--E 428

Query: 670 DKINFENLVDSDS-MSG----KTDLFFDQIRNVFEKMNII 704
            +I  E  +DS + M G     TD  F Q+RN+ +KMNII
Sbjct: 429 QRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/420 (62%), Positives = 309/420 (73%), Gaps = 6/420 (1%)

Query: 238 ILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPXXXXXXXXXXXXXXXXRXXX- 296
           I+P++YIIVFKD ++ ++I +HKELI+ +  Q +S                    R    
Sbjct: 57  IIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPESMRQSLG 116

Query: 297 -XXXXXXXXXXXXXYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRI 355
                         Y  Y + E++  IRLNPL+ ++E D++V TT+FNTQNNAPWGL+RI
Sbjct: 117 GIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAPWGLARI 176

Query: 356 SHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGN 415
           SHRE LNL +FNKYLYDDDAGK V  +VIDTG++VNHV+F  RA WGKTIP NDQDIDGN
Sbjct: 177 SHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQDIDGN 236

Query: 416 GHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAETHLNNEKNKKD 475
           GHGTH AGTI S HYG            LRSNGSGSMSDV+KGVEFA  +HL   KN+K+
Sbjct: 237 GHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMKNEKN 296

Query: 476 YKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGAS 535
            KGS ANMSLGGGKSP LDLAVNAAV+AGIHF+VAAGNENQ+ACNSSPASAE A+TVGAS
Sbjct: 297 LKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQAVTVGAS 356

Query: 536 TLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSL 595
           T+SD+RAYFSNWG CVD+FAPGLNILSTY+G  +D TATLSGTSMASPHVAGLL Y+LSL
Sbjct: 357 TISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLLAYYLSL 416

Query: 596 QPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISDLWN 655
           QP+  S F    S   I+  QLKKKLI Y+T D+L DLP+GTPN LIYNG G D+SD WN
Sbjct: 417 QPEKSSEF----STRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLSDFWN 472

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/495 (56%), Positives = 344/495 (69%), Gaps = 26/495 (5%)

Query: 215 KLAPLITP--TFGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSAS 272
           + APL+ P  T G            +L N+YII+FK  +N  EI +H+ELI ++  Q  S
Sbjct: 75  RFAPLVVPEDTLG------------VLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVS 122

Query: 273 RLPPXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXYSGYFTQEVIDLIRLNPLVKYVE 332
           +LP                                  YSGYF  +V+D+IR++PL++ VE
Sbjct: 123 QLPEEHSFFEGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVE 182

Query: 333 RDSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNH 392
           +DS+V T + +T+N APWGL+RISHRERLNLGS+NKYLYD+  G GVT +VIDTG+NV+H
Sbjct: 183 QDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHH 242

Query: 393 VDFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSM 452
             FG RA WGKTIP+ D D DGNGHGTHCAGTI S+ YG            LRSNGSGSM
Sbjct: 243 NQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSM 302

Query: 453 SDVIKGVEFAAETHLNNEKNKK-DYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAA 511
           SDV+KGVE+AA+ H N  K KK  +KGSTANMSLGGGKSP+LD AVNAAV AG++F+VAA
Sbjct: 303 SDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQAVNAAVAAGLNFAVAA 362

Query: 512 GNENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDN 571
           GNE+QDACN+SPASA   ITVGASTLSDDRAYFSN+G+CVDVFAPGLNILSTY+G  + +
Sbjct: 363 GNEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGS-DSS 421

Query: 572 TATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILY 631
           TATLSGTSMASPHVAGLL YFLSLQP S S F    S   I+P+QLKKKL+A+ST D+L 
Sbjct: 422 TATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSS---ISPDQLKKKLLAFSTKDVLS 478

Query: 632 DLPDGTPNKLIYNGAGGDISDLWNGKVQEQAHEEPAHEDKINFE--NLVDSDSMSGKTDL 689
           D+P GTPN LIYNG GGD+S  W  K   +  +E    +K++ E  +LV  D +  KTD 
Sbjct: 479 DIPSGTPNLLIYNGGGGDLSGFWGSK---EVAQELEFNEKVDLELHDLV--DELGSKTDA 533

Query: 690 FFDQIRNVFEKMNII 704
            F QIR + ++++II
Sbjct: 534 VFGQIRGLMDRLDII 548

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/469 (58%), Positives = 341/469 (72%), Gaps = 21/469 (4%)

Query: 238 ILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPXXXXXXXXXXXXXXXXRXXXX 297
           ++PNKYIIVFK  +++ ++  HK+LI+  Q Q AS                         
Sbjct: 231 VIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYAS------------VSDETSSSILGGI 278

Query: 298 XXXXXXXXXXXXYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRISH 357
                       Y G+F ++++  IRL+P+V +VE+DSIV   E +TQNNAPWGL+RISH
Sbjct: 279 EEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISH 338

Query: 358 RERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGNGH 417
           R+ LNLGS+NKYLYDD AG+GVT +VIDTGIN+ H +FG RA+WGKTIP NDQD+DGNGH
Sbjct: 339 RDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVDGNGH 398

Query: 418 GTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAETHLNN-EKNKKDY 476
           GTHCAGTIAS +YG            LRS+GSG+MSDV+KGVE+AA +H     + KK +
Sbjct: 399 GTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTMSDVLKGVEYAAFSHQKALREKKKGF 458

Query: 477 KGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGAST 536
           KGSTANMSLGGGKS +LDLAV+AAV++GIHF+VAAGNENQDACNSSPA++ENAITVGAST
Sbjct: 459 KGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGAST 518

Query: 537 LSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSLQ 596
           LSDDRAYFSNWG+CVDVFAPGLNILSTY+G  ++ TATLSGTSMASPHVAGLL+YFLS+Q
Sbjct: 519 LSDDRAYFSNWGKCVDVFAPGLNILSTYIGS-DEATATLSGTSMASPHVAGLLSYFLSMQ 577

Query: 597 PDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISDLWNG 656
           PD+ S FF+S S+  I+P QLKKKLIAYST ++  DLP+ TPN L+YN AG +ISD W  
Sbjct: 578 PDADSEFFSSGSN-SISPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFWKP 635

Query: 657 KVQEQAHEEPAHEDK-INFENLVDSDSMSGKTDLFFDQIRNVFEKMNII 704
           K +  A  EP    K    E+LVDS       D + + I+ VFE+M++ 
Sbjct: 636 KSESSA--EPNERAKEFELEDLVDSAQWIA--DTWLNGIQQVFERMDLF 680

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  513 bits (1320), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 274/494 (55%), Positives = 331/494 (67%), Gaps = 43/494 (8%)

Query: 215 KLAPLITPTFGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRL 274
           +LAPL TP       +          NKYII+FK+ +  ++IS HK+L+ ++  +++   
Sbjct: 77  ELAPLYTPGSALSASSS-------RSNKYIILFKEGVTAEQISAHKQLLQQVLLETSD-- 127

Query: 275 PPXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXYSGYFTQ---EVIDLIRLNPLVKYV 331
                                               SGY  +    V++L+R +P V+ V
Sbjct: 128 ----------------VSAQGIVADVLDSFDLEGVLSGYVAELSPMVLELVRRSPFVQLV 171

Query: 332 ERDSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVN 391
           E+DS V T EF+TQNNAPWGL+RISHR+ L+LGSFNKYLYDD AG+GV  ++IDTGINV 
Sbjct: 172 EQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVK 231

Query: 392 HVDFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGS 451
           H +F  RA WGKTIP ND D DGNGHGTHCAGTIAS HYG            LRSNGSGS
Sbjct: 232 HKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGS 291

Query: 452 MSDVIKGVEFAAETHLNNEK-NKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVA 510
           MSDVI GVEFAA+ H +  K N K +KGSTANMSLGGGKSP+LD  V+AAV+ G+HFSVA
Sbjct: 292 MSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVA 351

Query: 511 AGNENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGND 570
           AGNENQDACN+SPA++E AITVGASTLSDDRAYFSNWG CVD+FAPGLNILSTY G  +D
Sbjct: 352 AGNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNILSTYTGS-DD 410

Query: 571 NTATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDIL 630
            TATLSGTSMASPHVAGLLTYFLSLQP+  S F  S    +ITPEQLKKKL+ YST  +L
Sbjct: 411 ATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTS---AQITPEQLKKKLLDYSTKGVL 467

Query: 631 YDLPDGTPNKLIYNGAGGDISDLWNGKVQEQAHEEPAHEDKINFENLVDSDSMSGKTDLF 690
           +DLP+ TPN LIYNG G D+SD W  K ++      AHE           D++   +D  
Sbjct: 468 FDLPEDTPNALIYNGGGADLSDFWGDKGKKSHKPLFAHE----------YDNVWASSDAM 517

Query: 691 FDQIRNVFEKMNII 704
           F+Q+R +F K+NI 
Sbjct: 518 FEQVRAMFGKLNIF 531

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  510 bits (1314), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 259/480 (53%), Positives = 327/480 (68%), Gaps = 19/480 (3%)

Query: 237 RILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPX-----XXXXXXXXXXXXXX 291
           R +P+KYI+VF++ ++ +E ++H EL+     +S +RL                      
Sbjct: 69  RAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAAT 128

Query: 292 XRXXXXXXXXXXXXXXXXYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWG 351
                             Y GYFT++++ L+R NP V +VE DS+V  ++F TQN APWG
Sbjct: 129 RAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWG 188

Query: 352 LSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQD 411
           L+R+SHRE+LN GSFNKYLYDD++G+GVT +VIDTGIN++HVDF  RA+WGKTIP+ND D
Sbjct: 189 LARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDAD 248

Query: 412 IDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAETHLN-NE 470
            DGNGHGTHCAGTIAS  YG            LRSNG+GSMSDV++GVE+A + H    E
Sbjct: 249 YDGNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSMSDVLRGVEYAVKAHRKAAE 308

Query: 471 KNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAI 530
           K  K +KGSTANMSLGGG+S  LDLAV+AAV+AGIHF+VAAGNENQDACN+SPA+++ AI
Sbjct: 309 KADKGFKGSTANMSLGGGRSQALDLAVDAAVDAGIHFAVAAGNENQDACNTSPAASQKAI 368

Query: 531 TVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLT 590
           TVGASTL+DDRAYFSNWGRCVD+FAPG+NILSTY+G  +   ATLSGTSMASPHVAGLLT
Sbjct: 369 TVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGS-DTAVATLSGTSMASPHVAGLLT 427

Query: 591 YFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDI 650
           YFLSLQPD  S F N ++   I+PE LKKK+I + T D L  LP  T N LIYNG G D+
Sbjct: 428 YFLSLQPDGDSEFRNKQT---ISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADL 484

Query: 651 SDLWNGKVQEQAHEEPAHEDKINFENLVDSD------SMSGKTDLFFDQIRNVFEKMNII 704
           SD W  K ++ +  +  + D    E  + SD       +   TD  F   R + ++MNII
Sbjct: 485 SDFWGNKPKKVSGPKFTYADD---EEAMGSDLDRLIHELESSTDAMFSGFRTILDRMNII 541

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  501 bits (1289), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 259/492 (52%), Positives = 323/492 (65%), Gaps = 37/492 (7%)

Query: 214 IKLAPLITPTFGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASR 273
           ++ A LITP            +  ++P  YI+VF + +  +EIS H E +S++Q QS + 
Sbjct: 22  VRPASLITP------------NSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTD 69

Query: 274 LP-PXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXYSGYFTQEVIDLIRLNPLVKYVE 332
           LP                                   Y+G FT EV++ +RL+PLVK++E
Sbjct: 70  LPYDHEFFTISTSSDVNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIE 129

Query: 333 RDSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNH 392
           RDS+V TTE  TQ NAPWGL+RISHR RLNL +FNKYLYDD  GKGV  +VIDTGIN+ +
Sbjct: 130 RDSMVHTTEATTQYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITN 189

Query: 393 VDFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSM 452
           VDFG RA WGKTIP+ + ++DGNGHGTH AGTIAS HYG            LRSNG+GSM
Sbjct: 190 VDFGGRAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSM 249

Query: 453 SDVIKGVEFAAETHLNNEKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAG 512
           SDV+KGVE+    H   +     +KGS ANMSLGGGKS +LDLAVNAAV AG+HF+VAAG
Sbjct: 250 SDVLKGVEYVVGAH-QRDVGTAGFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAG 308

Query: 513 NENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNT 572
           NENQDACN+SPA+AE AITVGASTLSD RAYFSNWG+CV +FAPGLNILSTY+G   D T
Sbjct: 309 NENQDACNTSPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGS-PDAT 367

Query: 573 ATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYD 632
           ATLSGTSMASPH+AGL+ YFLSLQP  KS F++      ITP+QLKKK++A+ T + L D
Sbjct: 368 ATLSGTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRD 427

Query: 633 LPDGTPNKLIYNGAGGDISDLWNGKVQEQAHEEPAHEDKINFENLVDSDSMSGKTDLFFD 692
           LP  TPN + YNGAG  + D WN           A++   N+++LV +           +
Sbjct: 428 LPANTPNVIAYNGAGKSLEDFWN-----------ANDYVKNYQSLVIT-----------E 465

Query: 693 QIRNVFEKMNII 704
           Q++ +  KMNI 
Sbjct: 466 QLQFILNKMNIF 477

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  496 bits (1276), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 249/474 (52%), Positives = 319/474 (67%), Gaps = 11/474 (2%)

Query: 237 RILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPXXXXXXXXXXX----XXXXX 292
           R +P++YI++FKD +   ++  H++L++    ++ ++L P                    
Sbjct: 107 RAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARS 166

Query: 293 RXXXXXXXXXXXXXXXXYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGL 352
                            Y GYFT  ++DLIR + LVK +E+DSIV  ++F TQ  APWGL
Sbjct: 167 VEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGL 226

Query: 353 SRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDI 412
           +R+SHRERLNLGSFNKYLYDD+AGKGVT +VIDTGIN++HV+F  RA WGKTIPSND D 
Sbjct: 227 ARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADY 286

Query: 413 DGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAETHLNNEKN 472
           DGNGHGTHCAGTIAS  YG            LR+NG+G+MSDV++GVE+    H      
Sbjct: 287 DGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEH-RKASG 345

Query: 473 KKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITV 532
             ++KGSTANMSLGGGKS  L+LAV+AAV AGIHF+VAAGNENQDACN+SPAS++  ITV
Sbjct: 346 DPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITV 405

Query: 533 GASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYF 592
            ASTLSDDRAYFSNWG CVD+FAPGLNILSTY+G  +   ATLSGTSMASPHVAGLL YF
Sbjct: 406 AASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGS-DTAVATLSGTSMASPHVAGLLAYF 464

Query: 593 LSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISD 652
           LSLQPDS S ++   S   I+PE LKKK++AY + ++L ++P  T N LI+NG GG +  
Sbjct: 465 LSLQPDSGSEYYTGSS---ISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDS 521

Query: 653 LWNGKVQ--EQAHEEPAHEDKINFENLVDSDSMSGKTDLFFDQIRNVFEKMNII 704
            WN K    EQ     +H    +FE+    D +   +   F +IRN  +++++I
Sbjct: 522 FWNSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  479 bits (1234), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 259/468 (55%), Positives = 325/468 (69%), Gaps = 26/468 (5%)

Query: 241 NKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPXXXXXXXXXXXXXXXXRXXXXXXX 300
           ++YIIVFK  +  +++  H +++S + ++ +    P                        
Sbjct: 134 DRYIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRPAAAPGASALRDGFDRVMDTFEVAG 193

Query: 301 XXXXXXXXXYSGYFTQ----EVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRIS 356
                    +SGY       +++D IRLNPLV YVE+DS+V + +  TQNNAPWGL+RIS
Sbjct: 194 A--------FSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARIS 244

Query: 357 HRERLNLGSFNKYLY-DDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGN 415
           HRE LNLG+FNKYLY  + AGKGVT +V+DTGI+V+H++FG+RA WGKTIP ND DIDGN
Sbjct: 245 HREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGN 304

Query: 416 GHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAETHLNN-EKNKK 474
           GHGTHCAGTI S HYG            LRS+GSG+MSDV+KGVE+ A  H  + E+++K
Sbjct: 305 GHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRK 364

Query: 475 D----YKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAI 530
           D    YKG+TANMSLGGGKSP LD AVNAAV+AG+HF+VAAGNENQDACNSSPA+AENAI
Sbjct: 365 DKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAI 424

Query: 531 TVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLT 590
           TVGASTLSDDRAYFSN+G+CVD+FAPGLNILSTY+G  ND TATLSGTSMASPHVAGLLT
Sbjct: 425 TVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGT-NDATATLSGTSMASPHVAGLLT 483

Query: 591 YFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDI 650
           Y LSLQPD  S F+   S+  +TP Q+KKK+I Y+T + L DLP  TPNKLIYNG G + 
Sbjct: 484 YLLSLQPDKGSEFYVPNSE--LTPLQMKKKIIDYATKNALADLPADTPNKLIYNG-GFNS 540

Query: 651 SDLWNGKVQEQAHEEPAHEDKINFENLVDSDSMSGKTDLFFDQIRNVF 698
           +D W      Q+H+     ++ +  + +DS   S      FD + N+F
Sbjct: 541 TDFWASAAAPQSHK--VKTNRYSLGSFLDSIQDSNNHWFNFDNM-NIF 585

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  431 bits (1107), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 206/419 (49%), Positives = 285/419 (68%), Gaps = 6/419 (1%)

Query: 237 RILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPXXXXXXXXXXXXXXXXRXXX 296
            ++P +YI+VF + I+I  I  H++++ E    S S+L                  +   
Sbjct: 65  ELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQLGG 124

Query: 297 XXXXXXXXXXXXXYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRIS 356
                        Y+GYFT E+++L+  +PL+K++E++S V+ +  + Q +APWGL RIS
Sbjct: 125 IDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRIS 184

Query: 357 HRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGNG 416
           HRE+   G   +YLY+D AG+GVT +V+DTGI+  H DF  RA+WG  IP ND+  D NG
Sbjct: 185 HREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLNG 244

Query: 417 HGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAETHLNNEKNK-KD 475
           HGTHCAG I S HYG            LRSNG G++SDVIKG+E+ A  H+ + + K K+
Sbjct: 245 HGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSKE 304

Query: 476 YKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGAS 535
           +KGSTAN+SLG  KS  +++AV+AAV++G+HF++AAGNEN+DAC SSPA A+ +ITVGAS
Sbjct: 305 FKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGAS 364

Query: 536 TLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSL 595
           T SDDRA+FSNWG CVDVFAPG+NI+STY+G  N  T +LSGTSMA+PHVAG+L+YFLSL
Sbjct: 365 TFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRN-ATLSLSGTSMAAPHVAGMLSYFLSL 423

Query: 596 QPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISDLW 654
           QP   S +F    D  ++P++LK+K++ +ST  +L D+ D TPN+LIYNG G  + DLW
Sbjct: 424 QPAPDSEYF----DNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  428 bits (1100), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 210/417 (50%), Positives = 283/417 (67%), Gaps = 8/417 (1%)

Query: 239 LPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPXXXXXXXXXXXXXXXXRXXXXX 298
           LP +YII F +  ++  I  HK +I E+Q +S S+L                  +     
Sbjct: 67  LPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDL--QFGGID 124

Query: 299 XXXXXXXXXXXYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRISHR 358
                      Y+GYFT+EVI  +  +P++K++E++S V+ T    Q  APWGL RISHR
Sbjct: 125 SFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHR 184

Query: 359 ERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGNGHG 418
           E+   G   +YLY+D AG+GVT +V+DTGI++NH DF  RA+WG  IP ND+  D NGHG
Sbjct: 185 EKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHG 244

Query: 419 THCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAETHLN-NEKNKKDYK 477
           THCAG I S H+G            LRSNG G++SDVIKG+E+  + H++ ++K    +K
Sbjct: 245 THCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSSKKGGPKFK 304

Query: 478 GSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGASTL 537
           GSTAN+SLG  KSP +++AVNAAVE+G+HF++AAGNE++DAC SSPA AE +ITVGAST 
Sbjct: 305 GSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 364

Query: 538 SDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSLQP 597
           SDDRA+FS+WG CVDVFAPG+NILSTY+G  N  + +LSGTSMA+PHVAG+L+YFLSLQP
Sbjct: 365 SDDRAFFSDWGTCVDVFAPGVNILSTYIGSRN-ASLSLSGTSMAAPHVAGILSYFLSLQP 423

Query: 598 DSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISDLW 654
            S S FF    D  ++P+QLK+K+I +ST  +L D+ + TPN+LIYNG G  + + W
Sbjct: 424 SSDSEFF----DSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  418 bits (1074), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 206/423 (48%), Positives = 278/423 (65%), Gaps = 6/423 (1%)

Query: 233 FKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPXXXXXXXXXXXXXXXX 292
            +  + LP +YIIVF + I    I  H ++I + Q+ S S++                  
Sbjct: 63  LRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNP 122

Query: 293 RXXXXXXXXXXXXXXXXYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGL 352
           +                Y+GYFT EVI+++  +PLVK++E +S V+ +  + Q +APWGL
Sbjct: 123 QFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGL 182

Query: 353 SRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDI 412
            RISHRER   G   +YLY+D AG GVT +V+DTGI+  H DF  RA WG  IP ND+  
Sbjct: 183 HRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEAS 242

Query: 413 DGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAETHLNNEKN 472
           D NGHGTHCAG I S H+G            LRSNG G++SDVIKG+E+ A+ H+ + K 
Sbjct: 243 DLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASSKK 302

Query: 473 K-KDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAIT 531
           +   +KGSTAN+SLG  KSP +++AVNAAV+ G+HF++AAGNE++DAC SSPA AE +IT
Sbjct: 303 RGSKFKGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSIT 362

Query: 532 VGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTY 591
           VGAST SDDRA+FSNWG CVDVFAPG+NI+STY+G  N  T +LSGTSMA+PHVAG+L+Y
Sbjct: 363 VGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRN-ATLSLSGTSMAAPHVAGILSY 421

Query: 592 FLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDIS 651
            LSLQP   S FF       ++P+QLK+K++ +ST  +L D+ + TPN+L+YNG G  + 
Sbjct: 422 LLSLQPAQDSEFFYD----TVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLD 477

Query: 652 DLW 654
           + W
Sbjct: 478 EFW 480

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  416 bits (1069), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 205/419 (48%), Positives = 278/419 (66%), Gaps = 6/419 (1%)

Query: 237 RILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPXXXXXXXXXXXXXXXXRXXX 296
             LP +Y+IVF + I++ +I  H +++ +    S  +L                  +   
Sbjct: 65  EFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISSSVSSKSQFGG 124

Query: 297 XXXXXXXXXXXXXYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRIS 356
                        Y+GYFT E+I +I  +P++K+VE+++ V+ +  + Q  APWGL R+S
Sbjct: 125 IDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAPWGLHRVS 184

Query: 357 HRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGNG 416
           HRE+   G   +YLY+D AGKGVT +V+DTGI+  H DF  RA WG  IP+ND+  D NG
Sbjct: 185 HREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASDLNG 244

Query: 417 HGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAETHLNNEKNK-KD 475
           HGTHCAG I S H+G            LRSNG G++SDVIKG+E+  + H+ + K K K+
Sbjct: 245 HGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNKE 304

Query: 476 YKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGAS 535
           +KGSTAN+SLG  KS  +++AVNAAV++G+HF++AAGNE++DAC SSPA AE +ITVGAS
Sbjct: 305 FKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITVGAS 364

Query: 536 TLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSL 595
           T SDDRA+FSNWG CVDVFAPG+NI+STY+G  N  T +LSGTSMASPHVAG+L+YFLSL
Sbjct: 365 TFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRN-ATLSLSGTSMASPHVAGILSYFLSL 423

Query: 596 QPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISDLW 654
           QP   S FFN       +P++LK+K++ +ST  +L D+ D TPNKLIYNG G  +   W
Sbjct: 424 QPAPDSEFFNDAP----SPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  389 bits (1000), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 214/430 (49%), Positives = 271/430 (63%), Gaps = 6/430 (1%)

Query: 225 GDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPXXXXXXXX 284
           G  I+    K+  I+PN+YI++FKD +   EI  H   +S I++ ++S +          
Sbjct: 60  GSKIYFDSAKNDMIIPNRYIVLFKDFVTDKEIQSH---LSAIEEINSSSIFLQDSDFGKA 116

Query: 285 XXXXXXXXRXXXXXXXXXXXXXXXXYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNT 344
                   R                Y GYFT+     I  +PLV+ VE DSIV+   +  
Sbjct: 117 TQYNDISTRGIGLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKM 176

Query: 345 QNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKT 404
           Q + PWGL RIS RE+L +     Y YDD  GK    FVIDTGI V+H DF  RA WGKT
Sbjct: 177 QEHVPWGLGRISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKT 236

Query: 405 IPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAE 464
           I  ND D D NGHGTHCAGTIAS HYG            LRS+GSGSMSDVI+GVE+  E
Sbjct: 237 IVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVE 296

Query: 465 THLNNEKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPA 524
            + + +K K + KG+  NMSLG  KS  L+ A++AA  AGI F+VAAGNE+ DACNSSPA
Sbjct: 297 AYNDLKKTKSNLKGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPA 356

Query: 525 SAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPH 584
           SA + ITVG STLSDD A+FSN+GRCVD+FAPG+NI+STY+G  N  T +LSGTSM+SPH
Sbjct: 357 SAWSPITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNA-TESLSGTSMSSPH 415

Query: 585 VAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYN 644
           VAG+L Y+LSLQPD KS F++  S   I+P+ LKKK++ Y+T+  L  LP  T N L+YN
Sbjct: 416 VAGVLAYYLSLQPDHKSQFYHEHS--AISPKILKKKVLNYATNGTLSYLPAETVNLLVYN 473

Query: 645 GAGGDISDLW 654
           G G ++S  W
Sbjct: 474 GGGKNLSKFW 483

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  372 bits (954), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 183/347 (52%), Positives = 235/347 (67%), Gaps = 11/347 (3%)

Query: 311 SGYFTQ---EVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFN 367
           SGY  +   E + L+R +P+V+ +E DS V   +   Q + PWGLSRIS R R+ +G   
Sbjct: 115 SGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPRVRIGQDQ 174

Query: 368 KYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIAS 427
            Y YDD     VT +V+DTGI ++H  F  RA WGKTI  ND D D +GHGTH AG IAS
Sbjct: 175 LYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTHVAGIIAS 234

Query: 428 THYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAETHLNNEKNKKDYKGSTANMSLGG 487
             +G            LRSNG G MSDV+KG+EF  + H    KNK   KGS  N+SLG 
Sbjct: 235 DKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDH---SKNKNYSKGSVVNLSLGA 291

Query: 488 GKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGASTLSDDRAYFSNW 547
            KSP L LA++AA+   IHF+VAAGNEN DAC +SPA A  AITVGAS  SD+RA+FSNW
Sbjct: 292 SKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSDERAFFSNW 351

Query: 548 GRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSK 607
           G CVDVFAPG+N++STY+G  N  T +LSGTS A+P+ AGL+ Y+LSLQPD  SG+F   
Sbjct: 352 GECVDVFAPGMNVMSTYIGSDN-ATLSLSGTSAAAPYTAGLIAYYLSLQPDKDSGYFT-- 408

Query: 608 SDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISDLW 654
             G++TP +LK+K++A+ + D+LY+LP+ TPN +IYNGAG ++S  W
Sbjct: 409 --GEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  344 bits (883), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 168/350 (48%), Positives = 231/350 (66%), Gaps = 6/350 (1%)

Query: 310 YSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKY 369
           Y+    +++I  +  +P+++ +E+DS V       Q ++PWGL+RIS RERL L     Y
Sbjct: 103 YTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQRERLKLLQDQFY 162

Query: 370 LYDDD-AGKGVTCFVIDTGINVNHVDFGKRAIWGKTI-PSNDQDIDGNGHGTHCAGTIAS 427
            YDD  A     C+++DTGIN NH +F  RA WG    P      D NGHGTHCAG I S
Sbjct: 163 HYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGS 222

Query: 428 THYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAETHLNNEK--NKKDYKGSTANMSL 485
             YG            L + G G MS VI+G+E+  + H  + K  ++  +KGS  N+SL
Sbjct: 223 HEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSL 282

Query: 486 GGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGASTLSDDRAYFS 545
           G GKSP L   + AAV+ G+HF+VAAGNE+ DAC++SPA + +A+TVGAS+ SDDR +FS
Sbjct: 283 GAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASSFSDDRVFFS 342

Query: 546 NWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFN 605
           NWG CVDVFAPG+NI+STY+G  N+ T +LSGTSM++P V GL+ YFLSLQPD+KS F+ 
Sbjct: 343 NWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYT 402

Query: 606 SKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISDLWN 655
             +    TP QLK K+I++ST  +L+++P+GTPN+++YNG G  + D WN
Sbjct: 403 GITSP--TPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFWN 450

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  336 bits (862), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 177/343 (51%), Positives = 230/343 (67%), Gaps = 13/343 (3%)

Query: 327 LVKYVERDSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDD-AGKGVTCFVID 385
           ++K +ERDS V   +F TQ ++ WGLSRIS R  L L     Y YDD+ +GKGV C+++D
Sbjct: 143 IIKIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILD 202

Query: 386 TGINVNHVDFGKRAIWGKTIPSNDQDI-DGNGHGTHCAGTIASTHYGXXXXXXXXXXXXL 444
           TGIN NH++F  RA WG ++P  +  + D NGHGTHCAG I S  YG            L
Sbjct: 203 TGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVL 262

Query: 445 RSNGSGSMSDVIKGVEFAAETHLNNEKN-------KKDYKGSTANMSLGGGKSPTLDLAV 497
              G GSMSDVI G+EF A +H N   N         ++KGS  N+SLG  KSP+LD+A+
Sbjct: 263 DFKGDGSMSDVILGLEFVANSHTNKTNNISSSSSVHSEFKGSVVNLSLGAPKSPSLDIAL 322

Query: 498 NAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPG 557
            +A + GIH +VAAGNE++DAC +SPA +   ITVGAS+ SDDRA+FSNWG CVDVFAPG
Sbjct: 323 ESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGASSFSDDRAFFSNWGPCVDVFAPG 382

Query: 558 LNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQL 617
           +NI STY+G  N+ T +LSG+SM+SP V+GL  Y+LSLQPD  S F     D  +TP+QL
Sbjct: 383 INIKSTYIGPNNNETLSLSGSSMSSPFVSGLTAYYLSLQPDVSSQF----HDSLMTPDQL 438

Query: 618 KKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISDLWNGKVQE 660
           K+K+I +ST+ +L +LP  T NKL+YNG G D+S  WN   +E
Sbjct: 439 KRKIIDFSTNGMLKELPLDTANKLVYNGGGKDLSGFWNATRKE 481

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  322 bits (826), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 157/322 (48%), Positives = 211/322 (65%), Gaps = 7/322 (2%)

Query: 326 PLVKYVERDSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDD-DAGKGVTCFVI 384
           P V+ VE +S V       Q + PWGL R+S R+R+ +G    Y YD   + K V  +++
Sbjct: 103 PFVEMVETNSKVYALNVTVQEDVPWGLMRLSQRDRVRIGDEQVYRYDTRGSAKDVNVYIL 162

Query: 385 DTGINVNHVDFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXL 444
           DTGI V+H +F  RA WGKTI  ND D D NGHGTHCAG +    YG            L
Sbjct: 163 DTGIQVDHEEFEGRARWGKTIAWNDPDRDDNGHGTHCAGIVGGATYGVAKEANLIAVKVL 222

Query: 445 RSNGSGSMSDVIKGVEFAAETHLNNEKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAG 504
            + G G MSDVI+G+EFA   HL   +N+ + +GS  N+SLG G+SP L   V AA+  G
Sbjct: 223 HATGDGEMSDVIRGIEFAVNEHLT--RNQDEVRGSIINLSLGAGESPALQRVVTAALNKG 280

Query: 505 IHFSVAAGNENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTY 564
           +HF+VAAGNE+ +AC SSPA+ +  +TVG ST SDDRA+FSNWG C+DVFAPG+N+ S+Y
Sbjct: 281 VHFAVAAGNEDDNACYSSPANIDGVVTVGGSTFSDDRAFFSNWGPCIDVFAPGVNVKSSY 340

Query: 565 VGDGNDNTATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAY 624
           VG   + T +LSGTS ++PHVAGL+ Y LSL+PD+KS F  + S+    P QLK+KL++ 
Sbjct: 341 VGAAKNKTLSLSGTSTSAPHVAGLMAYLLSLEPDTKSQFHTAWSN----PAQLKQKLVSL 396

Query: 625 STSDILYDLPDGTPNKLIYNGA 646
           +T   L+++PD T N +I+NG 
Sbjct: 397 ATEGKLFEVPDDTANLMIFNGV 418

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  251 bits (642), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 147/442 (33%), Positives = 228/442 (51%), Gaps = 14/442 (3%)

Query: 217 APLITPTFGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPP 276
           APL+ P  G++   Q      I+P +YI++FK+    +EI  H + ++++Q + +  L P
Sbjct: 52  APLVAP-LGENDEIQN----NIVPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAP 106

Query: 277 XXXXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXYSGYFTQEVIDLIRLNPLVKYVERDSI 336
                                            Y GYFT EV++ IR   +V YVE DSI
Sbjct: 107 NDPFFHHTRDKEFSTEELGGVLYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDSI 166

Query: 337 VQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFG 396
           +   +  T +N+ W L+RISHR +L L +FN+Y +D + G+ +  +++DTG+   H  + 
Sbjct: 167 LTIDDKETDSNSHWHLARISHRPKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYYI 226

Query: 397 KRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVI 456
           +R I G  I  N+ + D NGHGT  AG +     G            L   G G++S++I
Sbjct: 227 ERTIRGIVITPNEDERDMNGHGTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNII 286

Query: 457 KGVEFAAETHLNNEKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQ 516
           KG+ F    H      K    G+    S+ G KS +L+ A +  V +GIH  V AG +  
Sbjct: 287 KGLSFVNHHH-PQRIEKNGVLGAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGI 345

Query: 517 DACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVG---DGNDNTA 573
           +ACNSSPAS+   ITV   +++D+     NWG CVD++ PG  + +TY     +   N  
Sbjct: 346 NACNSSPASSSKPITVAGMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEI 405

Query: 574 TLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDL 633
           +++G+S A+  VAGLL YF SLQP        +     +TPE+LK++LI + T   L +L
Sbjct: 406 SVTGSSAAAAQVAGLLAYFASLQPG-----LGTPDVIPLTPEELKERLIDFGTKGKLTNL 460

Query: 634 PDGTPNKLIYNGAGGDISDLWN 655
              +PN + +NGAGG++   +N
Sbjct: 461 ERMSPNIIAFNGAGGNLDSFFN 482

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  187 bits (474), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 133/372 (35%), Positives = 182/372 (48%), Gaps = 63/372 (16%)

Query: 315 TQEVIDLIRLNPLV-------KYVERDSIVQTTE---------------FN-----TQNN 347
           +Q+V++ IR NPLV       ++   D ++   E               FN      Q  
Sbjct: 69  SQDVVEKIRNNPLVADLVPNIQFKAFDDVLGVQELQQNYHGDNLDDEDGFNPFKVKVQGE 128

Query: 348 APWGLSRISHRERLNLG---------SFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKR 398
           AP  L+R+S R  L            SFN Y Y    G+ +  ++IDTGI   H DF  R
Sbjct: 129 APRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGIYKEHKDFCGR 188

Query: 399 AIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKG 458
           AI+G+   + +   D NGHGTH AG + S+++G            L + G G+++ VI  
Sbjct: 189 AIFGRDF-TGEGPGDRNGHGTHVAGIVGSSNFGVAKKVNLIEVKALNNRGQGNLTTVISA 247

Query: 459 VEFAAETHLNNEKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDA 518
           VEFA      N       KG  AN+SLG  ++  ++ A+ AA EAG+   VAAGN N +A
Sbjct: 248 VEFAV-----NHCKSSGKKGCVANLSLGAVRNSVINQAIKAAHEAGLIIVVAAGNSNINA 302

Query: 519 CNSSPASAENAITVGA-STLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSG 577
           C +SPASA  AITVGA    +D  A FSNWG CVD+FA G+ + S      +   A  SG
Sbjct: 303 CWNSPASAPEAITVGAFDDRTDTIAKFSNWGPCVDIFASGVKVKSLSAFPPHKPIA-FSG 361

Query: 578 TSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYD----L 633
           TSMASP V GL+   L               D  + PE +K KL+  +T D+L       
Sbjct: 362 TSMASPSVTGLVAILL---------------DKGVEPENIKAKLVELATHDLLQRRTLFF 406

Query: 634 PDGTPNKLIYNG 645
             GTPN++ +NG
Sbjct: 407 KPGTPNRIAFNG 418

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  185 bits (469), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 128/359 (35%), Positives = 183/359 (50%), Gaps = 50/359 (13%)

Query: 316 QEVIDLIRLNPLV-------KYVERDS-IVQTTEFNT-----QNNAPWGLSRISHRERLN 362
           ++++D IR +PLV       ++V  D    +   FN+     Q  AP  LSR+S R +L 
Sbjct: 72  RDLVDRIRRSPLVAEVVPNIQFVAYDEHDFEGWNFNSRFIRRQRGAPRHLSRLSRRSQLP 131

Query: 363 L----------GSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDI 412
                      GSFN Y  +   G G+  ++IDTGI   H +FG RA++G+ + + +   
Sbjct: 132 YDFEEEDDNYEGSFNYYYDNKHRGDGINAYIIDTGIYKEHAEFGGRAVFGEDL-TGEGPG 190

Query: 413 DGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAETHLNNEKN 472
           DGNGHGTH AG + S+ YG            L + G G+++ VI  +EFA      N   
Sbjct: 191 DGNGHGTHVAGIVGSSKYGVAKDITLVEVKALTAKGQGNLTTVISAMEFAV-----NHCR 245

Query: 473 KKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITV 532
             + KG   N+SLG  ++  ++ AV AA EAGI   VAAGN N +AC +SPASA  AITV
Sbjct: 246 SSEGKGCVINLSLGAIRNSVINQAVKAAHEAGIVVVVAAGNSNINACLNSPASAPEAITV 305

Query: 533 GA-STLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTY 591
           GA    +D  A FSNWG CVD+FAPG+ + S      +      SGTSMASP + GL   
Sbjct: 306 GAFDDRTDSIAKFSNWGSCVDIFAPGVRVKS-LASAPHLKPILFSGTSMASPSITGLAAI 364

Query: 592 FLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYD----LPDGTPNKLIYNGA 646
            L               D  +  +++K  ++  +T+D+          GTPN++ +NG 
Sbjct: 365 LL---------------DEGVPYDKIKDYILKMATNDVFQRRTLVFKPGTPNRVAFNGV 408

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  183 bits (464), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 127/322 (39%), Positives = 165/322 (51%), Gaps = 41/322 (12%)

Query: 343 NTQNNAPWGLSRISHRERL--------NLGSFNKYLYDDD-AGKGVTCFVIDTGINVNHV 393
           N Q  AP  L RIS R +L            F  Y Y+D   G  +  +++DTGI   H 
Sbjct: 152 NVQYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHP 211

Query: 394 DFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMS 453
           DF  R I G  + + +   D NGHGTH AG + S  +G            L   GSG+++
Sbjct: 212 DFENRVIVGADM-TGEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLT 270

Query: 454 DVIKGVEFAAE-THLNNEKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAG 512
            V+ G++FA +   L  E   K      ANMSLG  ++  ++ A++ A +AG+   VAAG
Sbjct: 271 TVLSGIQFAVDHCRLMRETQGKQ---CVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAG 327

Query: 513 NENQDACNSSPASAENAITVGASTLSDDR----AYFSNWGRCVDVFAPGLNILS-TYVGD 567
           N N  AC +SPASA+NAITVGA    DDR    AYFSNWG CVD+FAPG+ I S +   +
Sbjct: 328 NSNVSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPE 384

Query: 568 GNDNTATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTS 627
            +    T SGTSMASP VAGL    L               D  + P  +K KL+  ST 
Sbjct: 385 SHHKHVTHSGTSMASPVVAGLAAILL---------------DKGVEPFDVKDKLLHLSTK 429

Query: 628 DILYDLPD----GTPNKLIYNG 645
           D+   L      GTPNK+ YNG
Sbjct: 430 DVFNKLTLFFKYGTPNKIAYNG 451

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  181 bits (458), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 123/318 (38%), Positives = 167/318 (52%), Gaps = 37/318 (11%)

Query: 345 QNNAPWGLSRISHRERLNL---------GSFNKYLYDDDAGKGVTCFVIDTGINVNHVDF 395
           Q++AP  L+RIS   +L             FN Y  DD  G+ V  +++DTGI  +H +F
Sbjct: 125 QSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGIFADHPEF 184

Query: 396 GKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDV 455
             R I G  + + +   D NGHGTH AG + S  YG            L  +GSG  S+V
Sbjct: 185 EDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGEASNV 243

Query: 456 IKGVEFAAE--THLNNEKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGN 513
           + G+EF  E  T ++  + KK      AN+SLG  +SP +++AV  A+E GI F  AAGN
Sbjct: 244 LSGLEFIVEHCTRVSRPQGKK----CVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGN 299

Query: 514 ENQDACNSSPASAENAITVGA-STLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNT 572
            N DA  +SPASAEN ITVGA     D  A FSNWG CV++FAPG+ I S    + ND T
Sbjct: 300 FNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNFND-T 358

Query: 573 ATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYD 632
             LSGTSM++P V G+    LS                 I PE + ++L   ST ++ + 
Sbjct: 359 LVLSGTSMSTPIVTGVAAVLLS---------------KGIEPEMIAQELEYLSTRNVFHR 403

Query: 633 ----LPDGTPNKLIYNGA 646
                   TPN+++YNG 
Sbjct: 404 RTLFFKPSTPNQILYNGV 421

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  180 bits (456), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 126/340 (37%), Positives = 175/340 (51%), Gaps = 40/340 (11%)

Query: 324 LNPLVKYVERDSIVQTTEFNTQNNAPWGLSRISHRERLNL---------GSFNKYLYDDD 374
            N   KY  +D I +      Q +AP  L+RIS   +L             FN Y  D+ 
Sbjct: 141 FNTTAKYAYQD-IDEAQNVTYQPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEY 199

Query: 375 AGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXX 434
            G+GV  +++DTGI+  H +F  R I G  + + +   D NGHGTH AG + S  +G   
Sbjct: 200 QGQGVNAYIMDTGIHAEHPEFEDRVIQGVDL-TKEGFGDENGHGTHVAGLVGSRTFGAAK 258

Query: 435 XXXXXXXXXLRSNGSGSMSDVIKGVEFAAE--THLNNEKNKKDYKGSTANMSLGGGKSPT 492
                    L  +GSG  S+V+ G+EF  E  T ++  + KK      AN+SLG  +SP 
Sbjct: 259 KVSLVEVKVLGKDGSGEASNVLSGLEFIVEHCTKVSRPQGKK----CVANLSLGSFRSPI 314

Query: 493 LDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGA-STLSDDRAYFSNWGRCV 551
           +++AV  A+E GI F  AAGN N DA  +SPASAEN ITVGA     D  A FSNWG CV
Sbjct: 315 INMAVEGAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCV 374

Query: 552 DVFAPGLNILSTYVGDGNDN-TATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDG 610
           ++FAPG+ I S  +   NDN +  LSGTSM++P V G+    LS                
Sbjct: 375 NIFAPGVEIES--LSHLNDNESLVLSGTSMSTPIVTGVAAVLLS---------------K 417

Query: 611 KITPEQLKKKLIAYSTSDILYD----LPDGTPNKLIYNGA 646
            I PE + +++   ST ++ +         TPN+++YNG 
Sbjct: 418 GIEPELIAQEIEYLSTRNVFHRRTLFFKPSTPNQILYNGV 457

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  175 bits (444), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 125/339 (36%), Positives = 171/339 (50%), Gaps = 38/339 (11%)

Query: 324 LNPLVKYVERDSIVQTTEFNTQNNAPWGLSRISHRERLNL---------GSFNKYLYDDD 374
            N   KY   D + +      Q +AP  L+RIS   +L             FN Y   D 
Sbjct: 105 FNATAKYSYED-VEEEQNITYQPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDY 163

Query: 375 AGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXX 434
            G+ V  +++DTGI  +H +F  R I G  + + +   D NGHGTH AG + S  YG   
Sbjct: 164 QGQDVNAYIMDTGIFADHPEFEDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAK 222

Query: 435 XXXXXXXXXLRSNGSGSMSDVIKGVEFAAE--THLNNEKNKKDYKGSTANMSLGGGKSPT 492
                    L  +GSG  S+V+ G+EF  E  T ++  + KK      AN+SLG  +SP 
Sbjct: 223 RVNLVEVKVLGKDGSGEASNVLSGLEFIVEHCTKVSRPQGKK----CVANLSLGSFRSPI 278

Query: 493 LDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGA-STLSDDRAYFSNWGRCV 551
           +++AV  A+E GI F  AAGN N DA  +SPASAEN ITVGA     D  A FSNWG CV
Sbjct: 279 INMAVEGAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCV 338

Query: 552 DVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGK 611
           ++FAPG+ I S    + ND T  LSGTSM++P V G+    LS                 
Sbjct: 339 NIFAPGVEIESLSHLNYND-TLILSGTSMSTPIVTGVAAILLS---------------KG 382

Query: 612 ITPEQLKKKLIAYSTSDILYD----LPDGTPNKLIYNGA 646
           I PE + +++   ST ++ +         TPN+++YNG 
Sbjct: 383 IEPEMIAQEIEYLSTRNVFHRRTLFFKPSTPNQILYNGV 421

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  175 bits (443), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 120/321 (37%), Positives = 167/321 (52%), Gaps = 43/321 (13%)

Query: 344 TQNNAPWGLSRISHRERL---------NLGSFNKYLYDDDA-GKGVTCFVIDTGINVNHV 393
            Q  AP  L+R+S R++L          L S  KY YD  + G  V  ++ID+GI + H 
Sbjct: 128 VQYGAPRHLARLSRRKQLPYDFEDKEAYLDSL-KYFYDKRSQGASVNAYIIDSGIYLEHE 186

Query: 394 DFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMS 453
           +F  RAI G  + + +   D NGHGTH AG + S  YG            L   G GS++
Sbjct: 187 EFNGRAIPGIDL-TGEGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIKVLNRLGQGSLA 245

Query: 454 DVIKGVEFAAETHLNNEKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGN 513
            V+ G+EFA +      K  +      AN+SLG  ++  L+ A+ AA++AG+   VAAGN
Sbjct: 246 MVLGGIEFAVKHCQETSKKGR----CVANLSLGSMRTAILNKAIKAAIDAGLVVVVAAGN 301

Query: 514 ENQDACNSSPASAENAITVGASTLSDDR----AYFSNWGRCVDVFAPGLNILSTYVGDGN 569
            N +AC  SPASA  AITVGA    DDR    A FSNWG+C+D+FAPG+ I S  +    
Sbjct: 302 NNLNACWYSPASAPEAITVGA---FDDRIDAIAKFSNWGQCLDIFAPGVVIKSLSIFKDK 358

Query: 570 DNTATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDI 629
           ++  T SGTSMASP VAGL    L               D  ++ E++K  ++   T ++
Sbjct: 359 EDV-TYSGTSMASPTVAGLAALTL---------------DQGVSAEEVKDYILEMGTDNV 402

Query: 630 LYD----LPDGTPNKLIYNGA 646
            +        GTPNK+ +NG 
Sbjct: 403 FHRRSLLFKPGTPNKICFNGV 423

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  173 bits (439), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 128/364 (35%), Positives = 176/364 (48%), Gaps = 53/364 (14%)

Query: 310 YSGYFTQEVIDLIRLNPLVKYVERDSIVQ------------TTEFNTQNNAPWGLSRISH 357
           ++  F ++ ++ ++ NPLV  V  +S+              +  +  Q +AP  L+R+S 
Sbjct: 64  FTADFPKDFVEKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRRYKVQEDAPRHLARLSR 123

Query: 358 RERLNLGS-------FNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQ 410
           R  L           FN Y      G  V  ++IDTGI   H D G RA +G  +     
Sbjct: 124 RGPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGADMVGEGP 183

Query: 411 DIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAETHLNNE 470
             D NGHGTH AG + S  +G            L + G G+++ VI  +EF+   H    
Sbjct: 184 G-DYNGHGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVISSIEFSV-NHC--- 238

Query: 471 KNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAI 530
             KK      AN+SLG  ++  L+ AV AAVE+G+   VAAGN N +AC +SPASA +AI
Sbjct: 239 --KKSGMLCVANLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNSPASAISAI 296

Query: 531 TVGASTLSDDR----AYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVA 586
           TVGA    DDR    A FSNWG CVDVFA G+ ++S          A  SGTSMASP VA
Sbjct: 297 TVGA---FDDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPPFKPVA-YSGTSMASPSVA 352

Query: 587 GLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYD----LPDGTPNKLI 642
           GL    L               D  I P  +K+K+I  +T ++          GTPN++ 
Sbjct: 353 GLAAVLL---------------DSGIDPPDIKQKIIDLATENVFQKRTLVFKPGTPNRIA 397

Query: 643 YNGA 646
           +NG 
Sbjct: 398 FNGV 401

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  172 bits (436), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 124/339 (36%), Positives = 171/339 (50%), Gaps = 38/339 (11%)

Query: 324 LNPLVKYVERDSIVQTTEFNTQNNAPWGLSRISHRERLNL---------GSFNKYLYDDD 374
            N   KY+  D I +      Q++AP  L+RIS   +L             FN Y  DD 
Sbjct: 154 FNATAKYLYED-IDEAQNITYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDY 212

Query: 375 AGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXX 434
            G+ V  +++DTGI  +H +F  R I G  + + +   D NGHGTH AG + S  YG   
Sbjct: 213 LGQDVNAYIMDTGIFSDHPEFEDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAK 271

Query: 435 XXXXXXXXXLRSNGSGSMSDVIKGVEFAAE--THLNNEKNKKDYKGSTANMSLGGGKSPT 492
                    L  +GSG  S+V+ G+EF  E  T ++  + KK      AN+SLG  +SP 
Sbjct: 272 KVNLVEVKVLGKDGSGEASNVLSGLEFIVEHCTRVSRPQGKK----CVANLSLGSFRSPI 327

Query: 493 LDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGA-STLSDDRAYFSNWGRCV 551
           +++AV  A+E GI F  AAGN N DA  +SPASAEN ITVGA     D  A FSNWG CV
Sbjct: 328 INMAVEGAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCV 387

Query: 552 DVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGK 611
           ++FAPG+ I S    +  D T  LSGTSM++P V G+    LS                 
Sbjct: 388 NIFAPGVEIESLSHLNYED-TLILSGTSMSTPIVTGVAAVLLS---------------KG 431

Query: 612 ITPEQLKKKLIAYSTSDILYD----LPDGTPNKLIYNGA 646
           I P  + +++   ST ++ +         T N+++YNG 
Sbjct: 432 IEPALIAQEIEYLSTRNVFHRRTLFFKPSTANQILYNGV 470

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  169 bits (427), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 121/318 (38%), Positives = 161/318 (50%), Gaps = 43/318 (13%)

Query: 345 QNNAPWGLSRISHR-------ERLNLGSFN-KYLYDDD-AGKGVTCFVIDTGINVNHVDF 395
           Q  AP  L+RIS R       E +++ + N  Y YDD+ +G  V  +VIDTGI   H   
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 396 GKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDV 455
             RA +G  +       D NGHGTH AG I S  +G            L + G G+++ V
Sbjct: 195 EGRAKFGADLVGEGPG-DFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSV 253

Query: 456 IKGVEFAAETHLNNEKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNEN 515
           I  +EF           +K  +G  AN+SLG  ++  L+ AV AA+EAG+   VAAGN N
Sbjct: 254 ISAIEFTVN------HCRKSRRGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNSN 307

Query: 516 QDACNSSPASAENAITVGASTLSDDR----AYFSNWGRCVDVFAPGLNILSTYVGDGNDN 571
            +AC SSPAS+ +AITVGA    DDR    A FSNWG CVD+FAPG+ I S         
Sbjct: 308 ANACWSSPASSLSAITVGA---FDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFKP 364

Query: 572 TATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILY 631
            A  SGTSMASP V+G++   L               D  I P  +K +LI  +T  + +
Sbjct: 365 VA-FSGTSMASPIVSGMVANLL---------------DSGIHPFDIKTELIDLATDSVFH 408

Query: 632 D----LPDGTPNKLIYNG 645
                   GTPN++ + G
Sbjct: 409 KRTLLFKPGTPNRVAFTG 426

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  171 bits (434), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 126/331 (38%), Positives = 169/331 (51%), Gaps = 34/331 (10%)

Query: 340 TEFNTQNNAPWGLSRISHRERL-----NLGSFNK---YLYDD-DAGKGVTCFVIDTGINV 390
           ++F  Q  AP  L+RIS R++L     N   F +   Y YDD D G+GV  +VIDTGI  
Sbjct: 282 SKFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILK 341

Query: 391 NHVDFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSG 450
            H DF  R  +G  +       D NGHGTH AG I S  YG            +   GS 
Sbjct: 342 EHKDFEDRVEFGTDLTGEGAG-DLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTGST 400

Query: 451 SMSDVIKGVEFAAETHLNNEKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVA 510
            +S +I+ +E+     +N+  ++ D K    NMSLG      ++ AV +A+  G+ F VA
Sbjct: 401 QLSHIIEAIEYT----VNDCNSRVDKKACVVNMSLGSFYVKVINEAVESAIAEGVVFVVA 456

Query: 511 AGNENQDACNSSPASAENAITVGASTLSDDR----AYFSNWGRCVDVFAPGLNI--LSTY 564
           AGN N DAC SSP S++NAITVGA    DDR    A FSNWG CVD+FA G+ +  LS+ 
Sbjct: 457 AGNNNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVEVKSLSSQ 513

Query: 565 VGDGNDNTATLSGTSMASPHVAGLLTYFLS--LQP-DSKSGFFNSKSDGKITPEQLKKKL 621
           V          SGTSMASP V G ++  LS  ++P D +       + G  T   L  K 
Sbjct: 514 VP---YKYIKYSGTSMASPIVCGFVSILLSQGVKPNDVQEEMVKLSTKGDFTRRSLIFK- 569

Query: 622 IAYSTSDILY---DLPDGTPNKLIYNGAGGD 649
             ++++ IL+   D  D   N  + N  G D
Sbjct: 570 -PFTSNRILFNGMDPRDSYENDEMENDCGED 599

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  165 bits (418), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 127/363 (34%), Positives = 183/363 (50%), Gaps = 60/363 (16%)

Query: 316 QEVIDLIRLNPLV---------KYVERDSI--VQTTEFNT---QNNAPWGLSRISHRERL 361
           Q++++ ++ NPLV         K  E D +   QT E+ +   Q+ AP  L+RIS R++L
Sbjct: 76  QKIMEKLKQNPLVADIVPNILFKAFENDELNNEQTQEYVSHVVQSEAPRHLARISRRDKL 135

Query: 362 -----NLGS----FNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDI 412
                N+ S    FN Y   +  G  V  +++D+G++ N  DF  R  +G    + D + 
Sbjct: 136 PYDFTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLTDFEGRVEFGFDF-TGDGEG 194

Query: 413 DGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAETHLNNEKN 472
           D NGHGTH AG + S  YG            L   G G++  V+  +EFA      N+ +
Sbjct: 195 DSNGHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTLITVLSAIEFAV-----NDCH 249

Query: 473 KKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITV 532
           +   K   AN+SLG  K+  ++ A+ AA E G+   VAAGN N +AC +SPASAE AITV
Sbjct: 250 EHPEKRCVANLSLGSFKNAIINKAIQAATEDGVVMVVAAGNFNINACWTSPASAEEAITV 309

Query: 533 GASTLSDDR----AYFSNWGRCVDVFAPGLNI--LSTYVGDGNDNTATLSGTSMASPHVA 586
           GA    DDR    A FSNWG CVD++APG+ +  L+ +    N    + SGTSMASP V 
Sbjct: 310 GA---FDDRIDTIAKFSNWGPCVDIYAPGVAVESLANFPMVKN---ISYSGTSMASPIVC 363

Query: 587 GLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYD----LPDGTPNKLI 642
           G +   L               D  I  + +K  LI  +T D+           TPN+++
Sbjct: 364 GQVAILL---------------DKGIPNDDIKSTLIKMATDDVFQKRTLLFKPNTPNRVL 408

Query: 643 YNG 645
           +NG
Sbjct: 409 FNG 411

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  166 bits (420), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 116/343 (33%), Positives = 162/343 (47%), Gaps = 57/343 (16%)

Query: 344 TQNNAPWGLSRISHRERLNL---------GSFNKYLYDDDAGKGVTCFVIDTGINVNHVD 394
           TQ+ AP  L+R+S R +L             FN Y Y    G+ V  +V+D+G+ ++H D
Sbjct: 159 TQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSGVMIDHCD 218

Query: 395 FGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSD 454
           F  RA +G     +    D NGHGTH AG I S  YG            L S GSG++  
Sbjct: 219 FEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTLDT 278

Query: 455 VIKGVEFAAETHLN--------------------NEKNKKDYKGSTANMSLGGGKSPTLD 494
           V+ G+EF +  H N                    +  +  + K    N+SLG  +S  ++
Sbjct: 279 VMSGLEFVS-NHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKRCVINLSLGTFRSTIIN 337

Query: 495 LAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGASTLSDDR----AYFSNWGRC 550
            A+   ++ GI   VAAGN N +AC +SPAS  + ITVGA    DDR    A FSNWG C
Sbjct: 338 EAIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA---FDDRIDSIAKFSNWGNC 394

Query: 551 VDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDG 610
           VD+FAPG+ ++ +            +GTSMA+P V GL+   L               D 
Sbjct: 395 VDIFAPGV-LVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLL---------------DS 438

Query: 611 KITPEQLKKKLIAYSTSDIL----YDLPDGTPNKLIYNGAGGD 649
            I P Q+KK+L   +T +I          GTPN++ +NG   D
Sbjct: 439 GIKPTQIKKRLNELATDNIFPRRTLLFKPGTPNRIAFNGVKRD 481

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  165 bits (417), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 118/318 (37%), Positives = 162/318 (50%), Gaps = 42/318 (13%)

Query: 345 QNNAPWGLSRISHRERL-----NLGSF-NKYLYDDDA---GKGVTCFVIDTGINVNHVDF 395
           Q  AP  LSR+S R +L     N+  + N + Y  DA   G  V  ++IDTGI   H +F
Sbjct: 115 QREAPRHLSRLSRRGQLPYDINNIDRYDNAFDYYFDAKYQGSSVNAYIIDTGIYKEHPEF 174

Query: 396 GKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDV 455
             R  +   + + +   D NGHGTH AG + S  +G            L   G G +S +
Sbjct: 175 EGRVKFAIDL-TQEGPGDENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDKKGQGQLSTI 233

Query: 456 IKGVEFAAETHLNNEKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNEN 515
           +K +EF    H     +KK      AN+S G  ++  +D A+  A  AGI   VAAGN N
Sbjct: 234 LKALEFTIR-HCKESVDKK----CVANLSFGAIRTAIIDEAIKEAHNAGIVLVVAAGNSN 288

Query: 516 QDACNSSPASAENAITVGASTLSDDR----AYFSNWGRCVDVFAPGLNILSTYVGDGNDN 571
            DAC +SPAS+++ ITVGA    DDR    A FSNWG CVDVFAPG+ + S    +G+D 
Sbjct: 289 IDACWNSPASSKDVITVGA---FDDRTETIARFSNWGSCVDVFAPGVKVKSLSHINGSD- 344

Query: 572 TATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILY 631
              LSGTSMASP V+G+    L               D  + P+ +K K+I  ST +I +
Sbjct: 345 VLLLSGTSMASPSVSGIAAILL---------------DKGLNPKFVKSKIIESSTKNIFH 389

Query: 632 D----LPDGTPNKLIYNG 645
                +   TPN +++NG
Sbjct: 390 QGTIMIKPNTPNLIVFNG 407

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  164 bits (416), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 122/361 (33%), Positives = 176/361 (48%), Gaps = 54/361 (14%)

Query: 314 FTQEVIDLIRLNPLVKYVERDSIVQTTE------------FNTQNNAPWGLSRISHRERL 361
            + +V+D I+ +P VK V  + +V+  E               Q  AP  L+RIS R +L
Sbjct: 68  LSHDVLDKIKRHPFVKEVVPNIMVKAFEGDAVEDESWLPKMKRQRGAPRHLARISRRMQL 127

Query: 362 NLGSFNK--------YLYDDDA-GKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDI 412
                NK        Y YD  A G     +++DTG+  +H +F  R  +G T  + + + 
Sbjct: 128 PYDMNNKTRYRDSFNYYYDRWAQGATTRAYILDTGVMRDHKEFEDRVEFG-TDCTGEGEG 186

Query: 413 DGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAETHLNNEKN 472
           D NGHGTH AG + S  +G            L + G+G++  ++  +EFA +    +E +
Sbjct: 187 DLNGHGTHVAGLVGSKTFGVAKHVQLVDVKCLDALGAGTLVSILSALEFAVQDCQEHEDS 246

Query: 473 KKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITV 532
           +        NMSLG  KS  L+ A+N   + GI   VAAGN N +AC +SP+SA  AITV
Sbjct: 247 Q-----CVLNMSLGSVKSNILNQAINEVEKKGIVVVVAAGNFNMNACWTSPSSATGAITV 301

Query: 533 GASTLSDDR----AYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGL 588
           GA    DDR    A FSNWG CVD+FAPG+N+ ++ V     +    SGTSMASP V G+
Sbjct: 302 GA---FDDRFDTIAKFSNWGPCVDIFAPGVNV-ASLVNRDWPSFVKYSGTSMASPIVCGM 357

Query: 589 LTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYD----LPDGTPNKLIYN 644
           +   L               D  + PE ++  L   +T  +          GTPN ++YN
Sbjct: 358 VALLL---------------DDGVPPEDIRDYLQELATDGVFKKRTLVFKPGTPNSVLYN 402

Query: 645 G 645
           G
Sbjct: 403 G 403

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  163 bits (412), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 129/364 (35%), Positives = 179/364 (49%), Gaps = 48/364 (13%)

Query: 343 NTQNNAPWGLSRISHRERL--------NLGSFNKYLYDDD-AGKGVTCFVIDTGINVNHV 393
           + Q  AP  L ++S R +L            F  Y YD    G     ++IDTG+   H 
Sbjct: 148 DIQFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHK 207

Query: 394 DFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMS 453
           +FG R  +G       +  D NGHGTH AG I S  +G            L   G G+++
Sbjct: 208 EFGNRVHFGGDFIGEGKG-DYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNLT 266

Query: 454 DVIKGVEFAAETHLNNEKNKKDYKGSTA--NMSLGGGKSPTLDLAVNAAVEAGIHFSVAA 511
            V++G+EFA    +NN K K+   G     NMSLG  ++P ++ A+  A  +GI   VAA
Sbjct: 267 SVLEGIEFA----VNNCKLKQQPMGKNCVINMSLGTIRNPIINEAIKEAFLSGITPVVAA 322

Query: 512 GNENQDACNSSPASAENAITVGASTLSDDR----AYFSNWGRCVDVFAPGLNILSTYVGD 567
           GN N  AC +SPAS+  AITVGA    DDR    A FSNWG+CVD+FAPG+ I S     
Sbjct: 323 GNNNFSACWTSPASSNFAITVGA---MDDRTDTIAVFSNWGQCVDIFAPGVRIKSL-SNR 378

Query: 568 GNDNTATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTS 627
             +N    SGTSMASP VAGL+   +      + G+           +++K+KLI  S+ 
Sbjct: 379 MLENGVIHSGTSMASPIVAGLVAILM------EKGY---------KCDEIKQKLIDDSSK 423

Query: 628 DILYDLP----DGTPNKLIYNGAGGDISDLWNGKVQEQAHEEPAHEDKINFENLVDSDSM 683
            I   L      GTPN++IYNG    I ++ N   +     E   E K  ++ + D D  
Sbjct: 424 SIFSKLTLFFKYGTPNRVIYNG----IEEVINVNKENIRQREETDESK-EYDTIEDIDDS 478

Query: 684 SGKT 687
           + +T
Sbjct: 479 ANET 482

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  159 bits (401), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 123/334 (36%), Positives = 164/334 (49%), Gaps = 42/334 (12%)

Query: 344 TQNNAPWGLSRISHRERLNLGSFNKYLYDDDA---------GKGVTCFVIDTGINVNHVD 394
            QN AP  L+R+S R  L     +K  Y+D           G  V  ++ID+GI++N  +
Sbjct: 128 VQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDVNAYIIDSGIDINQEE 187

Query: 395 FGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSD 454
           F  RA  G  + + +   D NGHGTH AG + S  YG            L   GSGS+  
Sbjct: 188 FEGRATHGLDL-TGEGPGDRNGHGTHVAGLVGSKTYGVAKNVTLVEVKALDRQGSGSLIT 246

Query: 455 VIKGVEFAAETHLNNEKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNE 514
           VI  +EF    H    K+KK      AN+SLG    P L+ A+ A V++G+   VAAGN 
Sbjct: 247 VISALEFVV-NHCGKSKSKK----CVANLSLGAFMMPLLNEAIKATVDSGVVVVVAAGNG 301

Query: 515 NQDACNSSPASAENAITVGASTLSDDR----AYFSNWGRCVDVFAPGLNILSTYVGDGND 570
           N DAC  SPAS ++AITVGA    DDR    A FSNWG CVD+FAPG+ I S  + D N 
Sbjct: 302 NIDACWCSPASEKSAITVGA---FDDRIDTIAKFSNWGSCVDIFAPGVAISSLSIKD-NQ 357

Query: 571 NTATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDIL 630
            +   SGTSMASP VAG+++  L               D  +  E ++  L   +T D+ 
Sbjct: 358 KSVEFSGTSMASPQVAGIVSILL---------------DQGVENEDIRDYLFELATDDVF 402

Query: 631 YD----LPDGTPNKLIYNGAGGDISDLWNGKVQE 660
                     TPN++ +NG      D  +G   E
Sbjct: 403 QKRTLLFKPRTPNRITFNGISKKDEDFEDGIFPE 436

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  162 bits (411), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 114/320 (35%), Positives = 164/320 (51%), Gaps = 38/320 (11%)

Query: 341 EFNTQNNAPWGLSRISHRERLNLG-------SFNKYLYDDDAGKGVTCFVIDTGINVNHV 393
           ++  Q +AP  L+R   R  L          +FN Y  ++  G+GV  +V+D+GI  +H 
Sbjct: 424 QYAIQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSHP 483

Query: 394 DFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMS 453
           +F  RA +G    + +   D NGHGTH AG + S  +G            +  +G GS S
Sbjct: 484 EFDGRAHFGIDT-TKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGSTS 542

Query: 454 DVIKGVEFAAETHLNNEKNKKDYKGSTANMSLGG---GKSPTLDLAVNAAVEAGIHFSVA 510
           ++I GVEFA + H      ++  K   ANMSLGG   G S  LD AV AA+E G+ F VA
Sbjct: 543 NIIAGVEFAVK-HC-----QQSGKRCVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVA 595

Query: 511 AGNENQDACNSSPASAENAITVGA-STLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGN 569
           AGN  + AC  SPA  + AITVGA    SD  A FSN+G+CVD+FAPG+ + S      N
Sbjct: 596 AGNSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVASLSNSPSN 655

Query: 570 DNTATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDI 629
                L+GTSM++P  AG++   L               D  I P ++K  L++ ST  +
Sbjct: 656 -TMRVLNGTSMSAPITAGVVAVLL---------------DQGIEPHEVKDHLLSISTKGL 699

Query: 630 LYD---LPDGTPNKLIYNGA 646
            +    +   TP++ ++ G 
Sbjct: 700 FHKRRLVSSRTPDRALFTGV 719

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  159 bits (403), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 114/316 (36%), Positives = 163/316 (51%), Gaps = 38/316 (12%)

Query: 345 QNNAPWGLSRISHRERLNLGS-------FNKYLYDDDAGKGVTCFVIDTGINVNHVDFGK 397
           Q+ AP  L+R   R  L   +       FN Y   +  G+ V  +++D+GI+ +H +F  
Sbjct: 270 QSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFEG 329

Query: 398 RAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIK 457
           RA++G    +N+   D NGHGTH AG + S  YG            +  +G GS S++I 
Sbjct: 330 RAVFGIDT-TNEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNIIA 388

Query: 458 GVEFAAETHLNNEKNKKDYKGSTANMSLGG---GKSPTLDLAVNAAVEAGIHFSVAAGNE 514
           GVEFA + H      K       ANMSLGG   G S  LD AV AA+E G+ F VAAGN 
Sbjct: 389 GVEFAVK-HCQQSGKK-----CVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAAGNS 441

Query: 515 NQDACNSSPASAENAITVGA-STLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTA 573
            + AC  SPA  + AITVGA    SD  A FSN+G+CVD+FAPG+ + S+      +   
Sbjct: 442 KERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAV-SSLSNSPYNTVR 500

Query: 574 TLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYD- 632
            L+GTSM++P  AG++   L               D  +  E +K++LI  ST  + +  
Sbjct: 501 VLNGTSMSAPITAGVVAVLL---------------DQGVKHEDVKERLIDLSTKGVFHRR 545

Query: 633 --LPDGTPNKLIYNGA 646
             +   TP++ ++NG 
Sbjct: 546 RLVSSRTPDRTLFNGV 561

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  155 bits (391), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 124/323 (38%), Positives = 160/323 (49%), Gaps = 43/323 (13%)

Query: 341 EFNTQNNAPWGLSRISHRERLNLGSFN--------KYLYDDD-AGKGVTCFVIDTGINVN 391
           +F  Q NAP  L+RIS R  L     N         Y YDD   G  V  +VIDTGI   
Sbjct: 129 DFVAQKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGIFKE 188

Query: 392 HVDFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGS 451
           H  F  RA +G  +       D NGHGTH AG I S  YG            L + G G+
Sbjct: 189 HRQFQGRAKFGADLVGEGPG-DLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKGQGN 247

Query: 452 MSDVIKGVEFAAETHLNNEKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAA 511
           ++ VI  +EF           +K  +G  AN+SLG  ++  L+ AV AA+EAG+   VAA
Sbjct: 248 LTSVISAIEFTVN------HCRKSKRGCVANLSLGSFRNSVLNQAVEAALEAGVVVVVAA 301

Query: 512 GNENQDACNSSPASAENAITVGASTLSDDR----AYFSNWGRCVDVFAPGLNILSTYVGD 567
           GN N +AC SSPAS+ +AI+VGA    DDR    A FSNWG CVD+FAPG+ I S     
Sbjct: 302 GNSNANACWSSPASSLSAISVGA---FDDRTDTIARFSNWGNCVDLFAPGVKIASLSNIP 358

Query: 568 GNDNTATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTS 627
              + A  SGTSMASP V G++   L               D  I P  +K++LI  +T 
Sbjct: 359 PFKSVA-YSGTSMASPLVTGMVAVLL---------------DSGIHPFDIKEELINTATD 402

Query: 628 DILYD----LPDGTPNKLIYNGA 646
            + +        GTPN++ + G 
Sbjct: 403 SVFHKRALLFKPGTPNRVAFTGV 425

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  142 bits (357), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 114/321 (35%), Positives = 162/321 (50%), Gaps = 43/321 (13%)

Query: 341 EFNTQNNAPWGLSRISHRERL------NLGSFNKYLYDDD-AGKGVTCFVIDTGINVNHV 393
           +F +Q+ AP  L+RIS R +L      +  S  KY Y ++  G+GV  +V+D+G+N +H 
Sbjct: 150 DFISQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHDHP 209

Query: 394 DFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMS 453
           DF  RA+ G    + +   D  GHGTH AG I S  YG            L S G G+++
Sbjct: 210 DFEGRAMKGID-TTGEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGTVT 268

Query: 454 DVIKGVEFAAETHLNNEKNKKDYKGSTANMSLGG-GKSPTLDLAVNAAVEAGIHFSVAAG 512
           ++I+G+E+     +  ++          NMSLG  G    LD AV+A +E G+   VA G
Sbjct: 269 NIIEGLEYVVNQCIGKKRK------CVINMSLGAPGTHSILDKAVSAVIEEGVVVVVAGG 322

Query: 513 NENQDACNSSPASAENAITVGASTLSDDR----AYFSNWGRCVDVFAPGLNILSTYVGDG 568
           N   +AC  SPA    AITV A    DDR    A FSNWG C+D++APG+N+ S  + + 
Sbjct: 323 NSGLNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNVKS--LSNK 377

Query: 569 NDNTATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSD 628
              T  LSGTSMASP VAG    +L    D               P +++K L   +T  
Sbjct: 378 GRGTFVLSGTSMASPIVAGAAAIYLDQGAD---------------PAEVRKILSKTATRG 422

Query: 629 IL----YDLPDGTPNKLIYNG 645
           +       +   TPNK++Y G
Sbjct: 423 VFKKRAIAVRPRTPNKVLYTG 443

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  125 bits (313), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 92/288 (31%), Positives = 148/288 (51%), Gaps = 12/288 (4%)

Query: 312 GYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLY 371
           G F Q +++ +  +  +  +  D I+   E+  Q +AP  L+R+S +  L  GS   Y+Y
Sbjct: 60  GDFPQRLLENLYYDGRITAMSMDHILTPAEYIVQEHAPAHLARLSQKSTLR-GSDGTYIY 118

Query: 372 DDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQD-IDGNGHGTHCAGTIASTHY 430
             + G GV  +++DTGI+  H +   R      + SN     D +GHGT  AG I S  +
Sbjct: 119 HSNGGNGVDVYLLDTGIDDLHPELEGRVQKIADLTSNPVSHGDPHGHGTAVAGVIGSATF 178

Query: 431 GXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAETHLNNEKNKKDYKGSTANMSLGGGKS 490
           G              S G+ ++  VI+ +E A++     ++       S   +     K+
Sbjct: 179 GSAKKCNLFDVRVADSTGNATLIGVIRALEHASKLASVTQRP------SVVVIPFTMRKN 232

Query: 491 PTLDLAVNAAV-EAGIHFSVAAGNENQDACNSSPASAENAITVGA--STLSDDRAYFSNW 547
             L+ A+ A + +  +   VA GN NQ+AC+SSPASA  A+T+G+   T  D  A F+N+
Sbjct: 233 VILNSAIEAVIRDQSLPVVVAGGNFNQNACDSSPASAYGALTIGSIDVTKGDSLAPFTNY 292

Query: 548 GRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSL 595
           G C+D FA G+NI S   GD   NT   SGTS+++   +G++ Y++SL
Sbjct: 293 GDCIDTFAAGVNITSLTTGDYESNT-QYSGTSISAGIASGVVAYYMSL 339

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  123 bits (309), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 89/259 (34%), Positives = 126/259 (48%), Gaps = 13/259 (5%)

Query: 341 EFNTQNNAPWGLSRISHRERLNLGS---FNKYLYDDDAGKGVTCFVIDTGINVNHVDFGK 397
           +++TQ NAP  LSR S   +L   S   +N Y   D  G  VT +V+D+GI ++H +F  
Sbjct: 141 KYSTQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEG 200

Query: 398 RAIWGKTIPSNDQDI-DGNGHGTHCAGTIASTHYGXXXXXXXXXXXXLRSNGSGSMSDVI 456
           R +  +     D  + D  GHGT  AG I S  YG            L + G G++  ++
Sbjct: 201 RIL--EAYDFTDSGVGDNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSIL 258

Query: 457 KGVEFAAETHLNNEKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQ 516
           +G++F  + H     N         N SLG      L+ A      AGI    AAGN   
Sbjct: 259 QGLQFITK-HCEENTNGN----CIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNAV 313

Query: 517 DACNSSPASAENAITVGASTLSDDR-AYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATL 575
           +AC  +PA ++   TVG+    DD  A FSNWGRCVD+ APG+ +  T +      +   
Sbjct: 314 NACWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYV-RTLLYTNQKGSRES 372

Query: 576 SGTSMASPHVAGLLTYFLS 594
           SGTS+++P V GL    LS
Sbjct: 373 SGTSVSTPIVTGLAAILLS 391

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  117 bits (293), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 98/320 (30%), Positives = 158/320 (49%), Gaps = 28/320 (8%)

Query: 310 YSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRISH---RERLNLGSF 366
           +SG F  EV+  +  +P V  +  D ++   E+  QN+AP  L+R+S+     R++  + 
Sbjct: 64  FSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNGVSNSRVSAKNE 123

Query: 367 NKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDI---DGNGHGTHCAG 423
           N +++   AG GV  +++D+GI+  H  F  R I  K I   D  I   D +GHGT  AG
Sbjct: 124 NAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNRHI-SKLIDLTDNPIPVGDPHGHGTAIAG 182

Query: 424 TIASTHYGXXXXXXXXXXXXLRSNGSG-SMSDVIKGVEFAAETHLNNEKNKKDYKGSTAN 482
            + S  +G            + +  +G  +S ++K +EF  E H     ++   + S A 
Sbjct: 183 LVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEF-IENH-----SRATMRPSVAV 236

Query: 483 MSLGGGKSPTLDLAVNAAVEA---GIHFSVAAGNENQDACNSSPASAENAITVGASTLSD 539
           +     K+  L    N+A+E+    I   V AGN++  ACN SPASA N+ ++ +    D
Sbjct: 237 LPFSMSKNAIL----NSAIESMPNSIAIVVPAGNQHHMACNFSPASARNSQSILSVGSLD 292

Query: 540 DR-----AYFSNWGRCVDVFAPGLNILSTYVGDGNDN--TATLSGTSMASPHVAGLLTYF 592
            R     A FSN+G CVDVF  G+ + + +    +D    + +SGTSM+    AG + Y+
Sbjct: 293 YRSSIEIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCAIAAGTVGYY 352

Query: 593 LSLQPDSKSGFFNSKSDGKI 612
           +SL   S       KS  +I
Sbjct: 353 MSLGLSSVEAIEKIKSAKEI 372

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  111 bits (278), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 89/292 (30%), Positives = 150/292 (51%), Gaps = 17/292 (5%)

Query: 312 GYFTQEVI-DLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFN--- 367
           G F Q+++ D  R   +V  +  D  +   E+  Q +AP  L+R+S +  L  G+ +   
Sbjct: 60  GEFPQQLLEDFYRSGQIVA-MSMDRPLGVAEYMVQQHAPNHLARLSQKSSLRGGNGSDNG 118

Query: 368 KYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDI-DGNGHGTHCAGTIA 426
            Y+Y  +AG GV  +++DTGI+  H  F  R        S+     D +GHGT  AG I 
Sbjct: 119 AYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRVQKAADFSSDPVATGDPHGHGTAVAGVIG 178

Query: 427 STHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAETHLNNEKNKKDYKGSTANMSLG 486
           S+ +G              S G  S+  V++ +E A++     ++       S   + L 
Sbjct: 179 SSVFGVAKKCNLFDVRVANSTGHASLIGVLRALEHASKLAAVTKRP------SLITIPLE 232

Query: 487 GGKSPTLDLAVNAAV-EAGIHFSVAAGNENQDACNSSPASAENAITVGASTLS--DDRAY 543
             ++  L+ AV A V +  I   VAAGNEN+ AC+ SPA A  A+T+G+  ++  D  A 
Sbjct: 233 MPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSVSPAGAYGALTIGSIDVARNDALAP 292

Query: 544 FSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSL 595
           F+N+  CVD+F  G+++ +  +G  + +   LSGTS+++   +GL+ Y++S+
Sbjct: 293 FTNFAECVDLFTAGVDVAT--LGLDHSSEHHLSGTSISAGVASGLVAYYMSI 342

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score =  106 bits (265), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 87/299 (29%), Positives = 139/299 (46%), Gaps = 21/299 (7%)

Query: 310 YSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKY 369
           ++G F+  ++  +  +P V  + RD  ++  E   QNNAP  L  +S    L   S   +
Sbjct: 57  FTGDFSGPILQKLYNDPNVLAISRDGSLKLQEIVLQNNAPSHLVGLSSISPL---SHQPF 113

Query: 370 LYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGK---TIPSNDQDIDGNGHGTHCAGTIA 426
           +Y  + G GV  +++DTGI++ H +  K  I      T     Q  D  GHGT  AG IA
Sbjct: 114 IYRSNGGNGVDVYLLDTGIDIKHPNLSKLNILRMADLTQSPVPQGTDPQGHGTAMAGIIA 173

Query: 427 STHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAETHLNNEKNKKDYKGSTANMSLG 486
           S  +G              SNG   +S +++ +    + H+   K           + + 
Sbjct: 174 SETFGVLKKCNLVDVRVADSNGDVKLSTILQALTL-TQRHIEGTKRPSVV---VIPLEVE 229

Query: 487 GGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASA----ENAITVGASTLSDDRA 542
            G +P L  A+ A+ +  +   + AGN  QDA N SPA+     +N I VG+  ++++  
Sbjct: 230 DGNNPILTEAI-ASFDQSVPIIIPAGNNAQDALNFSPANVNPKPKNIIVVGSVDVNNNPT 288

Query: 543 YFSNWGRCVDVFAPGLNILSTYVGD------GNDNTATLSGTSMASPHVAGLLTYFLSL 595
            F+N+G  VDVF  G  I +    D       N  T  +SGTS +S   AG++ Y++SL
Sbjct: 289 KFTNYGSNVDVFTVGEQITTLQSTDLDSQGLSNSLTRQVSGTSASSAITAGVIGYYMSL 347

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 79/306 (25%), Positives = 144/306 (47%), Gaps = 33/306 (10%)

Query: 310 YSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRISHRERLNLGSF--- 366
           +SG  ++E +  +  +     +  +  ++   +  Q +AP  L R++ ++ +    +   
Sbjct: 62  FSGDLSKEQVSSVFEDNAAAAISTEKYLELQGYLKQTDAPKHLGRLT-KDSIKSSQYHYA 120

Query: 367 -NKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAI------WGKTIPSNDQDIDGNGHGT 419
            N+Y++ D +G GV  +++DTGI++ H  + +  I          IPS     D NGHGT
Sbjct: 121 NNQYIFSDTSGNGVDIYIVDTGIDIQHPIYLQNNIHKLIDLTTSPIPSG----DFNGHGT 176

Query: 420 HCAGTIASTHYGXXXXXXXXXXXXLRSNGS-GSMSDVIKGVEFAAETHLNNEKNKKDYKG 478
             AG I S  +G            + +N    +MS V+  +    E H      +K  + 
Sbjct: 177 AMAGIINSDPFGVLKSANLVDVRVVDANTKHATMSRVLSALSL-IEKH-----EQKTMRP 230

Query: 479 STANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAE---NAITVGAS 535
           S   +     K+  L+ A+   +   I   + AGN++Q+AC  SP   +   N + VG+ 
Sbjct: 231 SIIVLPFQTEKNTILESAIE-NISKKIPVIIPAGNKHQNACKLSPMGIKKLSNVLVVGSL 289

Query: 536 TLSDDRAY-----FSNWGRCVDVFAPGLNI--LSTYVGDGNDNTATLSGTSMASPHVAGL 588
             S+++ Y     FSN+G CVD++  G++I  L T    G +    ++GTS +   VAG+
Sbjct: 290 EYSEEQNYLDIAKFSNYGSCVDIYTSGVDISTLKTSSNGGKELIHNVTGTSYSCGIVAGV 349

Query: 589 LTYFLS 594
           + Y++S
Sbjct: 350 VGYYMS 355

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score = 87.8 bits (216), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 87/309 (28%), Positives = 142/309 (45%), Gaps = 25/309 (8%)

Query: 311 SGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYL 370
           +G F+ E ++ +  +  V  + RD  ++  E+  Q  +P  LS++S       GSF    
Sbjct: 57  AGEFSVEDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQLSSG-----GSFT--- 108

Query: 371 YDDDAGKGVTCFVIDTGINVNH-----VDFGKRAIWGKT-IPSNDQDIDGNGHGTHCAGT 424
           +D  +G  V  +V DTGI+  H     V+  K A +  + +P   +  D +GHGT  AG 
Sbjct: 109 FDPVSGNLVDVYVFDTGIDFKHPGLQNVNPHKLADFTSSPVP---RGADPHGHGTMMAGL 165

Query: 425 IASTHYGXXXXXXXXXXXXLRSNGSGSMSDVIKGVEFAAETHLNNEKNKKDYKGSTANMS 484
           IAS  +G               +G   +S ++KG+  A+  H    K    +      M+
Sbjct: 166 IASETFGVLKSCSLVDVRVADKDGEVKLSTLMKGIS-ASVAHARFTKRPSVF---VLPMT 221

Query: 485 LGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGASTLSDDRAYF 544
           +G  K+  LD  + A +   I   + AGN+  DAC+ SP +  N + +G+    +  A F
Sbjct: 222 IGK-KNHILDNFLQA-IPKDIAIVLPAGNQQTDACDLSPPNDHNILVIGSLDRDNRLADF 279

Query: 545 SNWGRCVDVFAPGLNILSTYVGDGNDNTATLS--GTSMASPHVAGLLTYFLSLQPDSKSG 602
           SN+G CVDV+  G +IL+    D  +     S  GTS +    AG++ Y +S+   S   
Sbjct: 280 SNYGNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGIVGYHMSMGLTSMQA 339

Query: 603 FFNSKSDGK 611
               +S  K
Sbjct: 340 IQTIRSSSK 348

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 82.0 bits (201), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 78/282 (27%), Positives = 125/282 (44%), Gaps = 28/282 (9%)

Query: 328 VKYVERDSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTG 387
           +  +  D  ++  E   Q +AP  L+++   E  +    N+++YD  AG GV  ++ DTG
Sbjct: 80  IAAISIDRQLEPQEMIVQKDAPRHLTKLLETEAGD----NEFVYDSTAGNGVDIYIFDTG 135

Query: 388 INVNHVDFGKRAI----WGKTIPSNDQDIDGNGHGTHCAGTIASTHYGXXXXXXXXXXXX 443
           I  N        I         P  DQ+I    HGT  +G I S  +G            
Sbjct: 136 IARNSPGLSASRIHDMPGMPGPPIRDQEIL--EHGTAMSGLIGSPAFGVLKKCNLIDVNV 193

Query: 444 LRSNGSGSMSDVIKGVEFAAETHLNNEKNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEA 503
              NG   MS V+KG+      +L  +  K   + S  N S    K+  L+ A +     
Sbjct: 194 GDENGKVFMSKVLKGL------NLVQQHVKHTNRPSVINFSYCTLKNAILNSAFD-NFPR 246

Query: 504 GIHFSVAAGNENQDACNSSPASAE---NAITVGASTLSDD---RAYFSNWGRCVDVFAPG 557
            +  +VAAGN  Q  C+ SP   +   + +  G+  ++DD    + FSN+G CV  +APG
Sbjct: 247 DVPIAVAAGNYKQPGCSFSPVGCQRNKSLLAFGSLLMNDDGITLSDFSNYGSCVGSYAPG 306

Query: 558 LNILSTYVGD-----GNDNTATLSGTSMASPHVAGLLTYFLS 594
             +L+  + D       D    +SGTS +S   AG++ Y+++
Sbjct: 307 EGLLTFGIPDTSRPNSRDTVIIISGTSGSSALGAGVIGYYMA 348

>Kpol_228.1 s228 (611..2293) [1683 bp, 560 aa] {ON} (611..2293)
           [1683 nt, 561 aa]
          Length = 560

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 26/42 (61%)

Query: 214 IKLAPLITPTFGDDIHTQGFKHPRILPNKYIIVFKDSINIDE 255
           +K+APLI P+ GDD         +I P + I +F+++I++ E
Sbjct: 347 LKIAPLIEPSLGDDNEEDSVTLTKITPEESINIFQETIDLLE 388

>NDAI0A02040 Chr1 (454109..456322) [2214 bp, 737 aa] {ON} Anc_7.328
           YDL149W
          Length = 737

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 5/64 (7%)

Query: 335 SIVQTT---EFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVN 391
           SI++TT   + NT NN    L + ++ E  NL  F + +YD   G G TC V++  +N+ 
Sbjct: 30  SILKTTPENKINTLNNKERALWKWANVE--NLDVFLQDVYDYYLGNGFTCIVLEKALNII 87

Query: 392 HVDF 395
            + F
Sbjct: 88  TLIF 91

>KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa]
           {ON} Anc_2.6 YNL238W
          Length = 766

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 6/64 (9%)

Query: 371 YDDDAGKGVTCFVIDTGINVNHVD----FGKRAIWGKTIPSN--DQDIDGNGHGTHCAGT 424
           Y +  GKGV   V+D G++  + D    F K   W     +N     +  + HGT CAG 
Sbjct: 152 YQNITGKGVVAAVVDDGLDYENPDIKDNFCKEGSWDFNANTNLPKPTLADDYHGTRCAGE 211

Query: 425 IAST 428
           IA+ 
Sbjct: 212 IAAV 215

>NCAS0F00490 Chr6 (89926..92889) [2964 bp, 987 aa] {ON} Anc_5.85
           YGR240C
          Length = 987

 Score = 31.6 bits (70), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 34/66 (51%), Gaps = 10/66 (15%)

Query: 446 SNGSGSMSDVIKGVEFAA----ETHLNNEKNKKDYKGSTANMSLGGGKSPTLDLAVNAAV 501
           +N S S SDV +    +A    +  L+ +K KK      A M+  GG SP ++ AV A V
Sbjct: 174 ANVSESSSDVSRDASLSAINMLKQTLSGQKKKK-----IAVMT-SGGDSPGMNAAVRAVV 227

Query: 502 EAGIHF 507
             GIHF
Sbjct: 228 RTGIHF 233

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.134    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,003,413
Number of extensions: 2983880
Number of successful extensions: 6540
Number of sequences better than 10.0: 75
Number of HSP's gapped: 6407
Number of HSP's successfully gapped: 95
Length of query: 704
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 587
Effective length of database: 40,065,477
Effective search space: 23518434999
Effective search space used: 23518434999
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)