Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0K004708.829ON38638618440.0
NCAS0C004708.829ON42638714460.0
YMR272C (SCS7)8.829ON38438712871e-177
Smik_13.4858.829ON38438712841e-177
Skud_13.4448.829ON38438712771e-176
TDEL0B006808.829ON38338712571e-173
CAGL0F03399g8.829ON38038612471e-171
SAKL0D01760g8.829ON38138412451e-171
Suva_13.4608.829ON38438712291e-168
KNAG0J003208.829ON37338612081e-165
KLLA0D01639g8.829ON38138411921e-163
Kpol_541.98.829ON37438611551e-157
Kwal_27.103328.829ON37838211491e-156
ZYRO0G13948g8.829ON38438311331e-154
KAFR0B038508.829ON37738511241e-153
TBLA0D031808.829ON40038111231e-152
TPHA0C047108.829ON37738111001e-149
Ecym_27128.829ON38138410911e-148
KLTH0C04114g8.829ON37838110891e-147
AAL183W8.829ON37738310681e-144
Kpol_1069.48.829ON2772567518e-98
TBLA0B013102.166ON123591344e-09
Kwal_47.18167na 1ON227731352e-08
Kpol_505.142.166ON123591282e-08
TDEL0F012102.166ON126581247e-08
NDAI0F027302.166ON121591239e-08
KNAG0I020402.166ON119591221e-07
NCAS0G025702.166ON121591193e-07
ZYRO0B09812g2.166ON1831121233e-07
KLTH0D09284g2.166ON123591142e-06
KLTH0A04026gna 1ON233681182e-06
Suva_14.2282.166ON120591122e-06
KLLA0B14795gna 2ON556531204e-06
Kwal_26.84612.166ON123591114e-06
KAFR0B045502.166ON1261091105e-06
KLLA0F27577gna 1ON172701135e-06
Skud_14.2212.166ON120591096e-06
SAKL0E10626g2.166ON123591062e-05
CAGL0L03828g2.166ON121591052e-05
SAKL0F08316gna 1ON178681082e-05
TPHA0F017902.166ON182591074e-05
TPHA0B018204.304ON5761291089e-05
Smik_14.2162.166ON120591001e-04
Kpol_1014.54.304ON596601081e-04
KLLA0F23672g2.166ON123591001e-04
NDAI0D047104.304ON616541062e-04
SAKL0F16610gsingletonON564511052e-04
ZYRO0C18524gsingletonON554651053e-04
YNL111C (CYB5)2.166ON12059973e-04
AFL223W2.166ON165591003e-04
ADL085Cna 1ON273681023e-04
KAFR0I005204.304ON586601034e-04
KLTH0C11858gsingletonON555481009e-04
TDEL0H02180na 1ON20361970.001
NCAS0A02770na 3ON609581000.001
Ecym_4346na 1ON20952950.002
YML054C (CYB2)4.304ON59152980.002
Smik_13.924.304ON59152970.002
Suva_13.1054.304ON59152970.002
TDEL0D00190singletonON55254970.002
Kwal_23.2823na 2ON56050960.002
KLTH0D06930g2.536ON20451920.004
Skud_13.924.304ON59152940.005
NDAI0D04700na 3ON62563930.007
NCAS0A027804.304ON60248930.008
KLTH0C11770gsingletonON61851930.008
ZYRO0B13728g4.304ON59852910.010
Ecym_54202.166ON14552860.011
CAGL0K10736g4.304ON59352890.021
KNAG0E038604.304ON60452880.025
CAGL0K03069g2.536ON19448840.039
ZYRO0B02090g2.536ON19451840.042
SAKL0G16852g4.304ON58047840.079
ZYRO0D16654gna 1ON19055760.39
TDEL0B034508.765ON130691780.49
TDEL0D011404.304ON58448770.49
NDAI0H013702.536ON22452740.74
Kpol_348.122.536ON21753740.78
Kwal_26.80462.536ON19854731.1
TPHA0G035502.536ON21854731.2
KLLA0D02640g4.304ON58951741.3
SAKL0A09570g2.536ON21150711.6
Kwal_14.21504.39ON169275722.3
Kwal_14.807singletonON57854712.6
KAFR0A047406.106ON48349712.8
Ecym_3180na 4ON621123703.6
ZYRO0B12144g4.238ON200557696.1
Smik_14.2722.255ON1166151688.2
TPHA0E015405.465ON21682669.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0K00470
         (386 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8....   714   0.0  
NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829      561   0.0  
YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON} ...   500   e-177
Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {...   499   e-177
Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {...   496   e-176
TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.8...   488   e-173
CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {...   484   e-171
SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} simila...   484   e-171
Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {...   478   e-168
KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.82...   469   e-165
KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {...   463   e-163
Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON} ...   449   e-157
Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272...   447   e-156
ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]...   441   e-154
KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {O...   437   e-153
TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {O...   437   e-152
TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa] ...   428   e-149
Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar...   424   e-148
KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly...   424   e-147
AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homo...   416   e-144
Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996...   293   8e-98
TBLA0B01310 Chr2 (276173..276544) [372 bp, 123 aa] {ON} Anc_2.16...    56   4e-09
Kwal_47.18167 s47 complement(716570..717253) [684 bp, 227 aa] {O...    57   2e-08
Kpol_505.14 s505 (37085..37456) [372 bp, 123 aa] {ON} (37085..37...    54   2e-08
TDEL0F01210 Chr6 complement(216322..216702) [381 bp, 126 aa] {ON...    52   7e-08
NDAI0F02730 Chr6 (669821..670186) [366 bp, 121 aa] {ON} Anc_2.166      52   9e-08
KNAG0I02040 Chr9 (397527..397886) [360 bp, 119 aa] {ON} Anc_2.16...    52   1e-07
NCAS0G02570 Chr7 complement(460218..460583) [366 bp, 121 aa] {ON...    50   3e-07
ZYRO0B09812g Chr2 (765874..766425) [552 bp, 183 aa] {ON} similar...    52   3e-07
KLTH0D09284g Chr4 (770560..770931) [372 bp, 123 aa] {ON} similar...    49   2e-06
KLTH0A04026g Chr1 complement(337200..337901) [702 bp, 233 aa] {O...    50   2e-06
Suva_14.228 Chr14 complement(413753..414115) [363 bp, 120 aa] {O...    48   2e-06
KLLA0B14795g Chr2 (1299429..1301099) [1671 bp, 556 aa] {ON} simi...    51   4e-06
Kwal_26.8461 s26 (794482..794853) [372 bp, 123 aa] {ON} YNL111C ...    47   4e-06
KAFR0B04550 Chr2 (946561..946941) [381 bp, 126 aa] {ON} Anc_2.16...    47   5e-06
KLLA0F27577g Chr6 (2556662..2557180) [519 bp, 172 aa] {ON} some ...    48   5e-06
Skud_14.221 Chr14 complement(407119..407481) [363 bp, 120 aa] {O...    47   6e-06
SAKL0E10626g Chr5 (885272..885643) [372 bp, 123 aa] {ON} similar...    45   2e-05
CAGL0L03828g Chr12 (442660..443025) [366 bp, 121 aa] {ON} simila...    45   2e-05
SAKL0F08316g Chr6 complement(634949..635485) [537 bp, 178 aa] {O...    46   2e-05
TPHA0F01790 Chr6 (412270..412818) [549 bp, 182 aa] {ON} Anc_2.16...    46   4e-05
TPHA0B01820 Chr2 complement(406416..408146) [1731 bp, 576 aa] {O...    46   9e-05
Smik_14.216 Chr14 complement(396585..396947) [363 bp, 120 aa] {O...    43   1e-04
Kpol_1014.5 s1014 complement(3107..4897) [1791 bp, 596 aa] {ON} ...    46   1e-04
KLLA0F23672g Chr6 (2212223..2212594) [372 bp, 123 aa] {ON} simil...    43   1e-04
NDAI0D04710 Chr4 (1106280..1108130) [1851 bp, 616 aa] {ON} Anc_4...    45   2e-04
SAKL0F16610g Chr6 (1373674..1375368) [1695 bp, 564 aa] {ON} simi...    45   2e-04
ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} simi...    45   3e-04
YNL111C Chr14 complement(416940..417302) [363 bp, 120 aa] {ON}  ...    42   3e-04
AFL223W Chr6 (19601..20098) [498 bp, 165 aa] {ON} Syntenic homol...    43   3e-04
ADL085C Chr4 complement(535293..536114) [822 bp, 273 aa] {ON} NO...    44   3e-04
KAFR0I00520 Chr9 complement(107239..108999) [1761 bp, 586 aa] {O...    44   4e-04
KLTH0C11858g Chr3 (979073..980740) [1668 bp, 555 aa] {ON} simila...    43   9e-04
TDEL0H02180 Chr8 (369539..370150) [612 bp, 203 aa] {ON}                42   0.001
NCAS0A02770 Chr1 (528814..530643) [1830 bp, 609 aa] {ON}               43   0.001
Ecym_4346 Chr4 (739106..739735) [630 bp, 209 aa] {ON} similar to...    41   0.002
YML054C Chr13 complement(165533..167308) [1776 bp, 591 aa] {ON} ...    42   0.002
Smik_13.92 Chr13 complement(163135..164910) [1776 bp, 591 aa] {O...    42   0.002
Suva_13.105 Chr13 complement(168279..170054) [1776 bp, 591 aa] {...    42   0.002
TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON}                 42   0.002
Kwal_23.2823 s23 (29032..30714) [1683 bp, 560 aa] {ON} YML054C (...    42   0.002
KLTH0D06930g Chr4 complement(604805..605419) [615 bp, 204 aa] {O...    40   0.004
Skud_13.92 Chr13 complement(163654..165429) [1776 bp, 591 aa] {O...    41   0.005
NDAI0D04700 Chr4 (1103670..1105547) [1878 bp, 625 aa] {ON}             40   0.007
NCAS0A02780 Chr1 (531072..532880) [1809 bp, 602 aa] {ON} Anc_4.304     40   0.008
KLTH0C11770g Chr3 (970979..972835) [1857 bp, 618 aa] {ON} simila...    40   0.008
ZYRO0B13728g Chr2 (1110636..1112432) [1797 bp, 598 aa] {ON} simi...    40   0.010
Ecym_5420 Chr5 (865505..865942) [438 bp, 145 aa] {ON} similar to...    38   0.011
CAGL0K10736g Chr11 (1046127..1047908) [1782 bp, 593 aa] {ON} hig...    39   0.021
KNAG0E03860 Chr5 (763388..765202) [1815 bp, 604 aa] {ON} Anc_4.3...    39   0.025
CAGL0K03069g Chr11 complement(285190..285774) [585 bp, 194 aa] {...    37   0.039
ZYRO0B02090g Chr2 complement(169589..170173) [585 bp, 194 aa] {O...    37   0.042
SAKL0G16852g Chr7 (1452894..1454636) [1743 bp, 580 aa] {ON} simi...    37   0.079
ZYRO0D16654g Chr4 complement(1380316..1380888) [573 bp, 190 aa] ...    34   0.39 
TDEL0B03450 Chr2 complement(613687..617607) [3921 bp, 1306 aa] {...    35   0.49 
TDEL0D01140 Chr4 complement(214858..216612) [1755 bp, 584 aa] {O...    34   0.49 
NDAI0H01370 Chr8 (336807..337481) [675 bp, 224 aa] {ON} Anc_2.536      33   0.74 
Kpol_348.12 s348 complement(21978..22631) [654 bp, 217 aa] {ON} ...    33   0.78 
Kwal_26.8046 s26 complement(621715..622311) [597 bp, 198 aa] {ON...    33   1.1  
TPHA0G03550 Chr7 complement(755688..756344) [657 bp, 218 aa] {ON...    33   1.2  
KLLA0D02640g Chr4 complement(225482..227251) [1770 bp, 589 aa] {...    33   1.3  
SAKL0A09570g Chr1 complement(838406..839041) [636 bp, 211 aa] {O...    32   1.6  
Kwal_14.2150 s14 (636185..641263) [5079 bp, 1692 aa] {ON} YLL021...    32   2.3  
Kwal_14.807 s14 complement(57218..58954) [1737 bp, 578 aa] {ON} ...    32   2.6  
KAFR0A04740 Chr1 (942850..944301) [1452 bp, 483 aa] {ON} Anc_6.1...    32   2.8  
Ecym_3180 Chr3 (344929..346794) [1866 bp, 621 aa] {ON} similar t...    32   3.6  
ZYRO0B12144g Chr2 complement(976039..982056) [6018 bp, 2005 aa] ...    31   6.1  
Smik_14.272 Chr14 (500166..503666) [3501 bp, 1166 aa] {ON} YNL05...    31   8.2  
TPHA0E01540 Chr5 (313509..314159) [651 bp, 216 aa] {ON} Anc_5.46...    30   9.0  

>NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8.829
          Length = 386

 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/386 (91%), Positives = 355/386 (91%)

Query: 1   MSINTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGK 60
           MSINTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGK
Sbjct: 1   MSINTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGK 60

Query: 61  DITDELKDKIDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGFD 120
           DITDELKDKIDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGFD
Sbjct: 61  DITDELKDKIDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGFD 120

Query: 121 STTFVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHY 180
           STTFVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHY
Sbjct: 121 STTFVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHY 180

Query: 181 GDKSAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTL 240
           GDKSAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTL
Sbjct: 181 GDKSAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTL 240

Query: 241 IEYCMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKV 300
           IEYCMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKV
Sbjct: 241 IEYCMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKV 300

Query: 301 VFKLLPXXXXXXXXXXXXXXXVCYDLCHYFLHHSKMPPPXXXXXXXXXXXXXXXXQLGYG 360
           VFKLLP               VCYDLCHYFLHHSKMPPP                QLGYG
Sbjct: 301 VFKLLPLYWAYAGFAGGLFGYVCYDLCHYFLHHSKMPPPLRKLKKYHLEHHYKNYQLGYG 360

Query: 361 VTSWYWDKIFGTYLSPDSPMSKMKYE 386
           VTSWYWDKIFGTYLSPDSPMSKMKYE
Sbjct: 361 VTSWYWDKIFGTYLSPDSPMSKMKYE 386

>NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829
          Length = 426

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/387 (72%), Positives = 311/387 (80%), Gaps = 8/387 (2%)

Query: 1   MSINTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGK 60
           MS N SKTLELFSKD+VA HNT +DCW+T  DRKIYDV+KFL D+P D +K +L + AGK
Sbjct: 47  MSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHP-DGDKSIL-KHAGK 104

Query: 61  DITDELKD-KIDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGF 119
           DIT+ LKD KID   +     L  DQYLIGY+ATD EE+ LLTNKDHKVEV+LNE+TN F
Sbjct: 105 DITELLKDEKIDQQTD-----LLDDQYLIGYMATDAEEEKLLTNKDHKVEVKLNESTNTF 159

Query: 120 DSTTFVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRH 179
           DSTTFVKDLPTEDKLSIATD +KDL+KH FLDL+KPLLKQILFGNFTKDFYLDQIHRPRH
Sbjct: 160 DSTTFVKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRH 219

Query: 180 YGDKSAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWT 239
           YG +SAPLFGN LEP TKT+WYLVPI WLPVVFYHIA+A  N+N +FAI+LF IG+YVWT
Sbjct: 220 YGQESAPLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWT 279

Query: 240 LIEYCMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYK 299
            IEYCMHRFLFHFDERLPEHN  Y+IHFLLHGCHHYLPMDKYRLVVPP LFIFLC PFYK
Sbjct: 280 FIEYCMHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYK 339

Query: 300 VVFKLLPXXXXXXXXXXXXXXXVCYDLCHYFLHHSKMPPPXXXXXXXXXXXXXXXXQLGY 359
           +VF LLP               +CYDLCHYFLHHSK+PP                 QLGY
Sbjct: 340 LVFALLPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRKLKKYHLEHHYKNYQLGY 399

Query: 360 GVTSWYWDKIFGTYLSPDSPMSKMKYE 386
           GVTSWYWDK FGTYLSPDSP+SKMKY+
Sbjct: 400 GVTSWYWDKKFGTYLSPDSPLSKMKYQ 426

>YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON}
           SCS7Sphingolipid alpha-hydroxylase, functions in the
           alpha-hydroxylation of sphingolipid-associated very long
           chain fatty acids, has both cytochrome b5-like and
           hydroxylase/desaturase domains, not essential for growth
          Length = 384

 Score =  500 bits (1287), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 241/387 (62%), Positives = 294/387 (75%), Gaps = 4/387 (1%)

Query: 1   MSINTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGK 60
           MS NTSKTLELFSK  V  HNT++DCW+T+Q+RKIYDVT+FL+++P     + +L++AGK
Sbjct: 1   MSTNTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHP--GGDESILDYAGK 58

Query: 61  DITDELKDK-IDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGF 119
           DIT+ +KD  +    + ++ IL+ D+YLIGYLATD E   LLTNK+HKVEVQL+     F
Sbjct: 59  DITEIMKDSDVHEHSDSAYEILE-DEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEF 117

Query: 120 DSTTFVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRH 179
           DSTTFVK+LP E+KLSIATD   D +KHKFLDL++PLL QIL  +F KDFY+DQIHRPRH
Sbjct: 118 DSTTFVKELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRH 177

Query: 180 YGDKSAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWT 239
           YG  SAPLFGN LEPLTKT+W++VP+ WLPVV YH+ VAL NMN +FA  LF +G++VWT
Sbjct: 178 YGKGSAPLFGNFLEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWT 237

Query: 240 LIEYCMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYK 299
           LIEY +HRFLFHFD+ LPE NI +  HFLLHGCHHYLPMDKYRLV+PPTLF+ LC PFYK
Sbjct: 238 LIEYGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYK 297

Query: 300 VVFKLLPXXXXXXXXXXXXXXXVCYDLCHYFLHHSKMPPPXXXXXXXXXXXXXXXXQLGY 359
           +VF LLP               VCYD CH+FLHHSK+PP                 QLG+
Sbjct: 298 LVFALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGF 357

Query: 360 GVTSWYWDKIFGTYLSPDSPMSKMKYE 386
           GVTSW+WD++FGTYL PD+P+SKMKYE
Sbjct: 358 GVTSWFWDEVFGTYLGPDAPLSKMKYE 384

>Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  499 bits (1284), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 243/387 (62%), Positives = 292/387 (75%), Gaps = 4/387 (1%)

Query: 1   MSINTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGK 60
           MS NTSKTLELFSK  V  HNT+ DCW+T+Q+RKIYDVTKFL+++P     + +L++AGK
Sbjct: 1   MSANTSKTLELFSKKTVEKHNTAKDCWVTYQNRKIYDVTKFLSEHP--GGDESILDYAGK 58

Query: 61  DITDELKDK-IDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGF 119
           DIT+ +KD  +    + ++ IL+ D+YLIGYLATD E   LLTNK+HKVEVQL+     F
Sbjct: 59  DITEVMKDTDVHEHSDSAYEILE-DEYLIGYLATDEEAARLLTNKNHKVEVQLSSDGTEF 117

Query: 120 DSTTFVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRH 179
           DSTTFVKDLP E+KLSIATD   D +KHKFLDL++PLL QIL  +F KDFY+DQIHRPRH
Sbjct: 118 DSTTFVKDLPAEEKLSIATDYGNDYKKHKFLDLNRPLLMQILCSDFKKDFYVDQIHRPRH 177

Query: 180 YGDKSAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWT 239
           YG  SAPLFGN LEPLTKT+W++VP  WLPVV YH+ VAL NMN +FA  LF +G++VWT
Sbjct: 178 YGKGSAPLFGNFLEPLTKTAWWVVPTAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWT 237

Query: 240 LIEYCMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYK 299
           LIEY +HRFLFHFD+ LPE NI +  HFLLHGCHHYLPMDKYRLV+PPTLF+ LC PFYK
Sbjct: 238 LIEYGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYK 297

Query: 300 VVFKLLPXXXXXXXXXXXXXXXVCYDLCHYFLHHSKMPPPXXXXXXXXXXXXXXXXQLGY 359
           +VF LLP               VCYD CH+FLHHSK+PP                 QLG+
Sbjct: 298 LVFALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGF 357

Query: 360 GVTSWYWDKIFGTYLSPDSPMSKMKYE 386
           GVTSW+WD++FGTYL PD+P+SKMKYE
Sbjct: 358 GVTSWFWDEVFGTYLGPDAPLSKMKYE 384

>Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  496 bits (1277), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 240/387 (62%), Positives = 292/387 (75%), Gaps = 4/387 (1%)

Query: 1   MSINTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGK 60
           MS NTSKTLELFS+  V  HNT+ DCW+T+Q+RKIYDVTKFL ++P     + +L++AGK
Sbjct: 1   MSTNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHP--GGDESILDYAGK 58

Query: 61  DITDELKDK-IDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGF 119
           D+T+ +KD  +    + ++ IL+ D+YLIGYLATD E   LLTNK HKVEVQL+     F
Sbjct: 59  DVTEIMKDSDVHEHSDSAYEILE-DEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEF 117

Query: 120 DSTTFVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRH 179
           DSTTFVK+LPTE+KLSIATD   D +KHKFLDL++PLL QIL  +F KDFY+DQIHRPRH
Sbjct: 118 DSTTFVKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRH 177

Query: 180 YGDKSAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWT 239
           YG  SAPLFGN LEPLTKT+W++VP+ WLPVV YH+ VAL NMN +FA  LF +G++VWT
Sbjct: 178 YGKGSAPLFGNFLEPLTKTAWWVVPLPWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWT 237

Query: 240 LIEYCMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYK 299
           LIEY +HRFLFHFD+ LPE N+ +  HFLLHGCHHYLPMDKYRLV+PPTLF+ LC PFYK
Sbjct: 238 LIEYGLHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYK 297

Query: 300 VVFKLLPXXXXXXXXXXXXXXXVCYDLCHYFLHHSKMPPPXXXXXXXXXXXXXXXXQLGY 359
           +VF LLP               VCYD CH+FLHHSK+PP                 QLG+
Sbjct: 298 LVFALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGF 357

Query: 360 GVTSWYWDKIFGTYLSPDSPMSKMKYE 386
           GVTSW+WD++FGTYL PD+P+SKMKYE
Sbjct: 358 GVTSWFWDEVFGTYLGPDAPLSKMKYE 384

>TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.829
           YMR272C
          Length = 383

 Score =  488 bits (1257), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 237/387 (61%), Positives = 288/387 (74%), Gaps = 5/387 (1%)

Query: 1   MSINTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGK 60
           MS + SKTLELFS+ +V+ HN ++DCW+T  +RKIYDVTKFL+++P       +L++AGK
Sbjct: 1   MSQDQSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHP--GGPQYILDYAGK 58

Query: 61  DITDELKDK-IDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGF 119
           DIT+ LKD  I      ++ IL+   YL+GY+AT+ EEK LLTN  HKVEV+L  AT  F
Sbjct: 59  DITEVLKDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKL--ATLDF 116

Query: 120 DSTTFVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRH 179
           DSTTFVKDLPTE+KLSIATD  +D ++H FLDL KPLL Q++FG FTKDFY+DQIHRPRH
Sbjct: 117 DSTTFVKDLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRH 176

Query: 180 YGDKSAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWT 239
           YG  SAPLFGN LEPL+KTSWY++P+ WLPVV YH+ VA  NMNPIF I  F +G +VWT
Sbjct: 177 YGKGSAPLFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWT 236

Query: 240 LIEYCMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYK 299
           LIEY +HRFLFHFD+ LPE N+ + +HFLLHG HHYLPMDKYRLV+PPTLF+ LC PFYK
Sbjct: 237 LIEYGLHRFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYK 296

Query: 300 VVFKLLPXXXXXXXXXXXXXXXVCYDLCHYFLHHSKMPPPXXXXXXXXXXXXXXXXQLGY 359
           +VF LLP               VCYDL HYFLHHSK+P                  QLG+
Sbjct: 297 LVFGLLPLYVAYAGFAGGLFGYVCYDLTHYFLHHSKLPSFMRKLKKYHLEHHYKNYQLGF 356

Query: 360 GVTSWYWDKIFGTYLSPDSPMSKMKYE 386
           GVTSW+WDK+FGTYLSP SP+S+MKY+
Sbjct: 357 GVTSWFWDKVFGTYLSPTSPISQMKYD 383

>CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {ON}
           highly similar to uniprot|Q03529 Saccharomyces
           cerevisiae YMR272c SCS7 required for hydroxylation of
           ceramide
          Length = 380

 Score =  484 bits (1247), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 239/386 (61%), Positives = 285/386 (73%), Gaps = 8/386 (2%)

Query: 1   MSINTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGK 60
           ++ ++SKTLELF +  +A HN+ DDCW++  +RKIYDV+K+L D+P +A+  +     GK
Sbjct: 3   VAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADA-VHKALDGK 61

Query: 61  DITDELKDKIDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGFD 120
             TD  + ++ ++K        TD YL+GYLAT  EEK LLTNK HKVEV+LN A N FD
Sbjct: 62  HGTDISQMELTTLK------FVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLN-ADNTFD 114

Query: 121 STTFVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHY 180
           STTFVKDLPTEDKLSI TD ++D +KHKFLDL+KPLLKQILFGNFTKDFYLDQIHRPRHY
Sbjct: 115 STTFVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHY 174

Query: 181 GDKSAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTL 240
           G  SAPLFGN LE  TKT+W++VP  W PVV Y I  AL NMN   A+ LF +GI+VWTL
Sbjct: 175 GKGSAPLFGNFLEAFTKTAWWVVPTVWGPVVLYFITTALMNMNNPLALFLFGLGIFVWTL 234

Query: 241 IEYCMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKV 300
           IEYC+HRFLFHFDE LPEH++F++IHFLLHGCHHYLPMD YRLVVPP LF+ LC P YK+
Sbjct: 235 IEYCLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKL 294

Query: 301 VFKLLPXXXXXXXXXXXXXXXVCYDLCHYFLHHSKMPPPXXXXXXXXXXXXXXXXQLGYG 360
           VF  LP               +CYDLCHYFLHHSKMPP                 QLG+G
Sbjct: 295 VFAALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRKLKKYHLEHHYKNYQLGFG 354

Query: 361 VTSWYWDKIFGTYLSPDSPMSKMKYE 386
           VTSW+WDK+FGTYL PD+P+SKMKYE
Sbjct: 355 VTSWFWDKVFGTYLGPDAPLSKMKYE 380

>SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} similar
           to uniprot|Q03529 Saccharomyces cerevisiae YMR272C SCS7
           Required for the hydroxylation of the very long chain
           fatty acid (VLCFA) located in the endoplasmic reticulum
           desaturase/hydroxylase enzyme
          Length = 381

 Score =  484 bits (1245), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 231/384 (60%), Positives = 287/384 (74%), Gaps = 3/384 (0%)

Query: 3   INTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDI 62
           ++ SKTL L SK +++ HNT +DCW++  +RK+Y+VT FL ++P       +L+ AG+DI
Sbjct: 1   MSESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHP--GGDQYILDHAGEDI 58

Query: 63  TDELKDKIDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGFDST 122
           T+ +KDK+    + S   +  D YL+GYLA + EEK LLTN+DH VEV+LNE+T  FDST
Sbjct: 59  TEIMKDKLVHEHSESAYEIMNDMYLVGYLANEEEEKKLLTNEDHTVEVKLNESTQ-FDST 117

Query: 123 TFVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHYGD 182
           TFVK+LPTEDKLSIATD   D +KHKFLDLDKPLL Q++FGNFTKDFYLDQ+HRPRHYG 
Sbjct: 118 TFVKELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGK 177

Query: 183 KSAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTLIE 242
            SAPLFGN LEPL+KT WY +PI WLPVVFYH+ VALTNMN  FA+ LF++G++VWTLIE
Sbjct: 178 GSAPLFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIE 237

Query: 243 YCMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKVVF 302
           YC+HRFLFH D+ LPE  + + +HFLLHG HHYLPMD+YRLV+PPTLF+ LC PFYK+VF
Sbjct: 238 YCLHRFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVF 297

Query: 303 KLLPXXXXXXXXXXXXXXXVCYDLCHYFLHHSKMPPPXXXXXXXXXXXXXXXXQLGYGVT 362
            LLP                CYDL HYFLHH+K+PP                 +LG+GVT
Sbjct: 298 SLLPYYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRKLKKYHLEHHYKNYELGFGVT 357

Query: 363 SWYWDKIFGTYLSPDSPMSKMKYE 386
           SW+WDK+FGTYL  D+P+SKMKYE
Sbjct: 358 SWFWDKVFGTYLGSDAPLSKMKYE 381

>Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  478 bits (1229), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 242/387 (62%), Positives = 294/387 (75%), Gaps = 4/387 (1%)

Query: 1   MSINTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGK 60
           MS NTSKTLELFSK  V  HNT+ DCW+T+Q+RKIYDVTKFL+++P    ++ +L++AGK
Sbjct: 1   MSTNTSKTLELFSKKTVEEHNTAKDCWVTYQNRKIYDVTKFLSEHP--GGEESILDYAGK 58

Query: 61  DITDELKDK-IDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGF 119
           DIT+ +KD  +      ++ IL+ D+YL+GYLATD E   LLTNK+HKVEVQL+     F
Sbjct: 59  DITEVMKDSDVHEHSESAYEILE-DEYLVGYLATDEEATRLLTNKNHKVEVQLSADGTEF 117

Query: 120 DSTTFVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRH 179
           DSTTFVKDLPTE+KLSIATD   D +KHKFLDL+KPLL QIL  +FT+DFY+DQIHRPRH
Sbjct: 118 DSTTFVKDLPTEEKLSIATDYGSDYKKHKFLDLNKPLLMQILRSDFTRDFYVDQIHRPRH 177

Query: 180 YGDKSAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWT 239
           YG  SAPLFGN LEPLTKT+W++VP+ W+PVV YH+ VAL NMNP+FA  LF +G++VWT
Sbjct: 178 YGKGSAPLFGNFLEPLTKTAWWVVPVAWVPVVVYHMGVALKNMNPLFACFLFGVGMFVWT 237

Query: 240 LIEYCMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYK 299
           LIEY +HRFLFHFD+ LPE NI +  HFLLHGCHHYLPMD YRLV+PP+LF+ LC PFYK
Sbjct: 238 LIEYSLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDGYRLVMPPSLFVILCAPFYK 297

Query: 300 VVFKLLPXXXXXXXXXXXXXXXVCYDLCHYFLHHSKMPPPXXXXXXXXXXXXXXXXQLGY 359
           +VF LLP               VCYD CHYF+HHSK+PP                 QLG+
Sbjct: 298 LVFALLPLYWAYAGFAGGLFGYVCYDECHYFIHHSKLPPFMRKLKKYHLEHHYKNYQLGF 357

Query: 360 GVTSWYWDKIFGTYLSPDSPMSKMKYE 386
           GVTSW+WD +FGTYL PD+P+SKMKYE
Sbjct: 358 GVTSWFWDDVFGTYLGPDAPLSKMKYE 384

>KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.829
           YMR272C
          Length = 373

 Score =  469 bits (1208), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 230/386 (59%), Positives = 283/386 (73%), Gaps = 13/386 (3%)

Query: 1   MSINTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGK 60
           MS N S+TLEL SKD VA+HN  +D W+  Q RK+ D++ ++ + P    ++LLL  AGK
Sbjct: 1   MSSN-SRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPE--KEELLLSLAGK 57

Query: 61  DITDELKDKIDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGFD 120
           DITD         ++  FP L  D +L+GYLATD EEK LL+NKDHKVEV+L E    FD
Sbjct: 58  DITD---------RSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKL-EGGETFD 107

Query: 121 STTFVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHY 180
           S+TFVKDLPTEDKLSIATDTK+D +KH FLDL+KPL+ Q+LFG+FTKDFY+DQIHRPRHY
Sbjct: 108 SSTFVKDLPTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHY 167

Query: 181 GDKSAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTL 240
           G  SAPLFGN LEP++KT+WY+VPI W PVV Y +  +L  ++PIFA++LFA+G +VWTL
Sbjct: 168 GKGSAPLFGNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTL 227

Query: 241 IEYCMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKV 300
           IEYCMHRFLFHFD+ LPE+N+ + IHFLLHG HHYLPMD YRLVVPP LF+ LC PFYK+
Sbjct: 228 IEYCMHRFLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKL 287

Query: 301 VFKLLPXXXXXXXXXXXXXXXVCYDLCHYFLHHSKMPPPXXXXXXXXXXXXXXXXQLGYG 360
           VFKLLP               +CYDL HYFLHHSKMP                  QLG+G
Sbjct: 288 VFKLLPHYVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFG 347

Query: 361 VTSWYWDKIFGTYLSPDSPMSKMKYE 386
           V++W+WDK+F TYL  D+P+S MKY+
Sbjct: 348 VSNWFWDKVFDTYLGKDAPISPMKYD 373

>KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {ON}
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 381

 Score =  463 bits (1192), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 223/384 (58%), Positives = 281/384 (73%), Gaps = 3/384 (0%)

Query: 3   INTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDI 62
           +++S+ L L+SK  +  HN  +DCW++   RKIY+VT+FL+++P  A  + +L++AG DI
Sbjct: 1   MSSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGA--EYILDYAGTDI 58

Query: 63  TDELKDKIDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGFDST 122
           TD +KD +    + S   +  + YL+GYLAT+ EEK LLTNKDH VEV L +  N FDST
Sbjct: 59  TDVMKDVLTHEHSESAYEIMDESYLVGYLATEEEEKKLLTNKDHVVEVNL-KGNNEFDST 117

Query: 123 TFVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHYGD 182
            FVK+LPTEDKLSIATD + D +KHKFLDL+KPLL Q+LFG FTKDFYLDQ+HRPRHYG 
Sbjct: 118 VFVKELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGK 177

Query: 183 KSAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTLIE 242
            SAPLFGN LEPL+KT W++VP+ WLPVV YHI  AL NMN  FAI LFA+G++VWTLIE
Sbjct: 178 GSAPLFGNFLEPLSKTPWWMVPVVWLPVVTYHIYTALMNMNQAFAIFLFAVGVFVWTLIE 237

Query: 243 YCMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKVVF 302
           Y +HRFLFH D+RLPE    + +HFLLHG HHYLPMD++RLV+PPTLF+ LC PFYK+VF
Sbjct: 238 YGLHRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVF 297

Query: 303 KLLPXXXXXXXXXXXXXXXVCYDLCHYFLHHSKMPPPXXXXXXXXXXXXXXXXQLGYGVT 362
            LLP               VCYDL HYFLHHS++PP                 +LG+GVT
Sbjct: 298 ALLPYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRKLKKYHLEHHYKNYELGFGVT 357

Query: 363 SWYWDKIFGTYLSPDSPMSKMKYE 386
           SW+WDK+FGTYL  ++P+S MKY+
Sbjct: 358 SWFWDKVFGTYLGENAPLSNMKYD 381

>Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON}
           complement(23399..24523) [1125 nt, 375 aa]
          Length = 374

 Score =  449 bits (1155), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 219/386 (56%), Positives = 275/386 (71%), Gaps = 12/386 (3%)

Query: 1   MSINTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGK 60
           MS   SKTLELF+K +   HNT  DCW++ ++R IYDV+ +L DN  DA+  +L E AGK
Sbjct: 1   MSAKDSKTLELFAKSRFEEHNTEADCWVSVKERLIYDVSSYLKDNA-DADSSIL-EHAGK 58

Query: 61  DITDELKDKIDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGFD 120
           DIT   K +        F  + +D+YL+GYLAT+ EE  LLTNKDHKVEV L + T  +D
Sbjct: 59  DITKLTKTR-------EFKFI-SDEYLVGYLATEEEEVRLLTNKDHKVEVNLQDGT--YD 108

Query: 121 STTFVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHY 180
           ST FVK+LP E+K ++ATD  KD + H FLDL+KP+L Q+LFGNFT+DFY+DQ+HRPRHY
Sbjct: 109 STVFVKELPAEEKFTVATDLGKDFQDHHFLDLNKPMLWQVLFGNFTRDFYIDQVHRPRHY 168

Query: 181 GDKSAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTL 240
           G  SAPLFGN LEP++ T W+L+PI W PVV YH++VAL NMN IFA  LF +GI+VWTL
Sbjct: 169 GKGSAPLFGNFLEPISLTPWWLIPIIWGPVVVYHLSVALNNMNNIFAGFLFCLGIFVWTL 228

Query: 241 IEYCMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKV 300
           IEYC+HRFLFH D+ +P+HNIFY +HFLLHG HHYLPMD+YRLVVPP LF+ LC P YK+
Sbjct: 229 IEYCLHRFLFHLDDWVPQHNIFYTLHFLLHGVHHYLPMDQYRLVVPPALFLVLCTPIYKL 288

Query: 301 VFKLLPXXXXXXXXXXXXXXXVCYDLCHYFLHHSKMPPPXXXXXXXXXXXXXXXXQLGYG 360
           VF LLP               +CYDL HYF+HH K+P                  QLG+G
Sbjct: 289 VFGLLPLYWAYAGFAGGLLGYICYDLTHYFIHHVKLPKFMRKVKKHHLEHHYKNYQLGFG 348

Query: 361 VTSWYWDKIFGTYLSPDSPMSKMKYE 386
           V++++WDK+FGTYL PDSP S M+Y+
Sbjct: 349 VSNYFWDKVFGTYLGPDSPASIMRYK 374

>Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272C
           (SCS7) - desaturase/hydroxylase enzyme [contig 36] FULL
          Length = 378

 Score =  447 bits (1149), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 215/382 (56%), Positives = 277/382 (72%), Gaps = 7/382 (1%)

Query: 6   SKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDE 65
           +KTL L+S  +V  HN++DDCW+T Q+RKIYDVTKFL D+P     DL++E+AGKDIT+ 
Sbjct: 3   TKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGG--DLIVEYAGKDITEV 60

Query: 66  LKDK-IDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGFDSTTF 124
           +KD  + S    ++ +L  ++Y +GYLAT  EE+ LL N  HKVEV+L +    +DST F
Sbjct: 61  MKDGPLHSHSFVAYEVLD-EEYHVGYLATAEEEQKLLGNSKHKVEVKLEDE---YDSTVF 116

Query: 125 VKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHYGDKS 184
           V ++P E+KLSI TD  +D  +HKFLDL++PLL Q+L  +FTK+FYLDQ+HRPRHYG  S
Sbjct: 117 VPEVPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGS 176

Query: 185 APLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTLIEYC 244
           APLFGN LEPL+KTSWY++PI WLPVV YHI  A+ NMN +FA+ LF +GI+VWTLIEY 
Sbjct: 177 APLFGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYG 236

Query: 245 MHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKVVFKL 304
           MHRFLFH D  LP + + Y +HFLLHG HHYLPMD+YRLV+PPTLF+ LC PFYK+VF L
Sbjct: 237 MHRFLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFLLLCTPFYKLVFAL 296

Query: 305 LPXXXXXXXXXXXXXXXVCYDLCHYFLHHSKMPPPXXXXXXXXXXXXXXXXQLGYGVTSW 364
           LP               VCYDL HYFLHH+K+P                  +LG+GVTSW
Sbjct: 297 LPYYWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSW 356

Query: 365 YWDKIFGTYLSPDSPMSKMKYE 386
            WDK+FGTYL+ ++P+S+MK++
Sbjct: 357 VWDKVFGTYLAENAPLSQMKFD 378

>ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]
           {ON} similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 384

 Score =  441 bits (1133), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 211/383 (55%), Positives = 273/383 (71%), Gaps = 5/383 (1%)

Query: 6   SKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDE 65
           S TL+LFS+++++ HN   DCW++   RKIY+VT+FL+++P  A  + +L++AG+DIT+ 
Sbjct: 5   SPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGA--EYILKYAGRDITEV 62

Query: 66  LKDK-IDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNG-FDSTT 123
           LKD+ +      ++ IL  D YL+GYLAT  E   LLTNK H+VEV L +  N  FDSTT
Sbjct: 63  LKDRDVHEHSESAYEILD-DNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDSTT 121

Query: 124 FVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHYGDK 183
           FV +LP E+KL+IATD  +D +KHKFLDL++ LL Q++FGNF+KDFYLDQ+HRPRHYG  
Sbjct: 122 FVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGKG 181

Query: 184 SAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTLIEY 243
           SAPLFGN LEP++KT W+ +PI W+PVV +H  V  TNMN +F+  LF +GI+VWTLIEY
Sbjct: 182 SAPLFGNFLEPISKTPWWAIPIIWIPVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIEY 241

Query: 244 CMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKVVFK 303
           C+HRFLFH DE LP++N    +HFLLHG HHYLPMD+YRLV+PPTL I L  P YK VF 
Sbjct: 242 CLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVFG 301

Query: 304 LLPXXXXXXXXXXXXXXXVCYDLCHYFLHHSKMPPPXXXXXXXXXXXXXXXXQLGYGVTS 363
           LLP               VCYDL HYFLHH+K+P                  QLG+GVTS
Sbjct: 302 LLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRKLKKYHLEHHYKNYQLGFGVTS 361

Query: 364 WYWDKIFGTYLSPDSPMSKMKYE 386
           W+WD +FGTYL PD+P++ MKY+
Sbjct: 362 WFWDNVFGTYLGPDAPLAHMKYD 384

>KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {ON}
           Anc_8.829 YMR272C
          Length = 377

 Score =  437 bits (1124), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 221/385 (57%), Positives = 273/385 (70%), Gaps = 9/385 (2%)

Query: 3   INTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDI 62
           + T+KTLELFSK +VA H   +DCW+T   RKIYDVTKFL++N +     LLL++AG DI
Sbjct: 1   MTTAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRD--FDSLLLDYAGTDI 58

Query: 63  TDELKDKIDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGFDST 122
           TDEL   ++   +  +  L  D YL+GY+AT  EE+ LLTNKDHKVEV L +    FD  
Sbjct: 59  TDEL---VNGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQ---DFDLA 112

Query: 123 TFVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHYGD 182
           T V +LP E+KL+IAT+  +D +KHKFLDL+KPLL QIL G FT++FY+DQI+RPRHYG 
Sbjct: 113 TLVVELPPEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQ 172

Query: 183 KSAPLFGN-ILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTLI 241
           KSAPLFGN  LEP +KT+W++VP FWLPVVF+   VAL NMN   A+ LF +G++VWTL+
Sbjct: 173 KSAPLFGNAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLL 232

Query: 242 EYCMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKVV 301
           EYC+HRFLFHFD  LPE+NI + +HFLLHG HHYLPMD YRLVVPP LFI LC P YK V
Sbjct: 233 EYCLHRFLFHFDNYLPENNIAFALHFLLHGFHHYLPMDPYRLVVPPALFIILCAPIYKTV 292

Query: 302 FKLLPXXXXXXXXXXXXXXXVCYDLCHYFLHHSKMPPPXXXXXXXXXXXXXXXXQLGYGV 361
           F LLP               V YD+CHY LHHSK+PP                 +LGYG+
Sbjct: 293 FLLLPYYWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGI 352

Query: 362 TSWYWDKIFGTYLSPDSPMSKMKYE 386
           TSW+WDK+FGTYLS D+P S MK++
Sbjct: 353 TSWFWDKVFGTYLSKDAPASVMKFD 377

>TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {ON}
           Anc_8.829 YMR272C
          Length = 400

 Score =  437 bits (1123), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 208/381 (54%), Positives = 269/381 (70%), Gaps = 4/381 (1%)

Query: 8   TLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELK 67
           T ELFS + V  HNT  DCW+ +Q+RKIYDV+++L D P   +K  +++FAGKDIT   K
Sbjct: 22  TKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSK--IIDFAGKDITSSFK 79

Query: 68  DKIDSIKNPSFP--ILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGFDSTTFV 125
           ++     +P     +   D+YL+GYLA + E   LL+N  HKVEV+L E  + +DSTTFV
Sbjct: 80  NQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPSTYDSTTFV 139

Query: 126 KDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHYGDKSA 185
           K+LP+ED   IATD KKD  +H FLDL+KPL+ Q+    F + FY+DQIHRPRH+G+KSA
Sbjct: 140 KELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFGNKSA 199

Query: 186 PLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTLIEYCM 245
           PLFGN LEPLTKT+W+++P+ WLPVVFYH+ VA  NMN IFA  LF +G++VWTLIEY +
Sbjct: 200 PLFGNFLEPLTKTAWWVIPVVWLPVVFYHLKVAFHNMNNIFATFLFCVGVFVWTLIEYSL 259

Query: 246 HRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKVVFKLL 305
           HRFLFH D R+P+H +FYV+HF +HGCHHYLPMD YRLV+PPTLF+ LC PFYK+VF +L
Sbjct: 260 HRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLVFSVL 319

Query: 306 PXXXXXXXXXXXXXXXVCYDLCHYFLHHSKMPPPXXXXXXXXXXXXXXXXQLGYGVTSWY 365
           P               VCYD  HY+LHHS++P                  QL +GV++++
Sbjct: 320 PLYWAYAGFAGGLFGYVCYDEVHYWLHHSRVPKFMRLLKKLHLEHHYKNYQLAFGVSNYF 379

Query: 366 WDKIFGTYLSPDSPMSKMKYE 386
           WDK+FGTYL PDSP+S MKYE
Sbjct: 380 WDKVFGTYLYPDSPLSPMKYE 400

>TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa]
           {ON} Anc_8.829 YMR272C
          Length = 377

 Score =  428 bits (1100), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 209/381 (54%), Positives = 265/381 (69%), Gaps = 10/381 (2%)

Query: 4   NTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
           N SKTLELFS +K  +HNT DDCW++ +DR IYDV+KF+ +N +   +D +L+ AGKDI+
Sbjct: 5   NPSKTLELFSSEKFQSHNTEDDCWVSVKDRLIYDVSKFVQENKDVPVEDAVLKRAGKDIS 64

Query: 64  DELKDKIDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGFDSTT 123
           D L+ K       SF  +  D+YL+GYLA   EE  LLTNKDHKVEV L + T  +DST 
Sbjct: 65  DLLETK-------SFKFVD-DKYLVGYLANSTEEARLLTNKDHKVEVNLKDGT--YDSTV 114

Query: 124 FVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHYGDK 183
           FVK+LP+E+  +I+TD KKD   H FLDL+KPLL Q+L GNFT++FY+DQIHRPRHYG  
Sbjct: 115 FVKELPSEEHFTISTDYKKDFVDHHFLDLEKPLLMQMLTGNFTREFYIDQIHRPRHYGKG 174

Query: 184 SAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTLIEY 243
           SA LFGN LEP++ T W+L+PI W PVV YH  V   +M+P+ A+  + +GI+VWT IEY
Sbjct: 175 SAKLFGNWLEPISLTPWWLIPIIWGPVVVYHFYVGAQHMHPLSAVFFYFLGIFVWTFIEY 234

Query: 244 CMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKVVFK 303
           C+HRFLFH D+ +P+HN FY IHFLLHG HHYLPMD+YRLVVPP LF+ LC PFYK VF 
Sbjct: 235 CLHRFLFHLDDWVPQHNFFYTIHFLLHGVHHYLPMDQYRLVVPPALFVVLCTPFYKAVFA 294

Query: 304 LLPXXXXXXXXXXXXXXXVCYDLCHYFLHHSKMPPPXXXXXXXXXXXXXXXXQLGYGVTS 363
           LLP               + YDL HYF+HH K+P                  QLG+GV++
Sbjct: 295 LLPLYVAYVGFAGGLTGYIIYDLTHYFIHHVKLPRVFRKIKKHHLEHHYKNYQLGFGVSN 354

Query: 364 WYWDKIFGTYLSPDSPMSKMK 384
           ++WD +FGTYL PDSP S M+
Sbjct: 355 YFWDLVFGTYLGPDSPASIMR 375

>Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii AAL183W
          Length = 381

 Score =  424 bits (1091), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 208/384 (54%), Positives = 269/384 (70%), Gaps = 6/384 (1%)

Query: 4   NTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
           ++ KTL L+SK +   H   + CW++   RKIY+V+KFL++NP       +L+ AG+D+T
Sbjct: 3   SSCKTLPLYSKSEFEKHVKPNQCWVSIDQRKIYNVSKFLDENPE--GYQYVLDHAGQDVT 60

Query: 64  DELKD-KIDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGFDST 122
             LKD + D   + +  +L +D YLIGYLAT  EE+ LLTN +H VEV+   A      +
Sbjct: 61  QLLKDMQTDEPTDLAHQLL-SDAYLIGYLATSEEERKLLTNANHVVEVK--PANGNRVDS 117

Query: 123 TFVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHYGD 182
            FVK LPTE+KL+IATD K D EKH FLDLDKPL  Q+LFGNFTK+FY+DQ+HRPRHYG 
Sbjct: 118 GFVKKLPTEEKLAIATDFKTDYEKHHFLDLDKPLFMQVLFGNFTKEFYIDQVHRPRHYGK 177

Query: 183 KSAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTLIE 242
           +SAPLFGN LEPL+KTSW+++PI W P V Y+I  AL N++   A+ LF +G++VWTLIE
Sbjct: 178 ESAPLFGNFLEPLSKTSWWVIPIVWYPCVIYYIRTALLNISTPLALFLFGVGVFVWTLIE 237

Query: 243 YCMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKVVF 302
           Y +HRFLFHFD+R+PE NI + +HFLLHG HHYLPMDKYRLV+PP LF+ LC+PFYK+VF
Sbjct: 238 YGLHRFLFHFDDRMPESNIVFTLHFLLHGIHHYLPMDKYRLVMPPALFLALCYPFYKLVF 297

Query: 303 KLLPXXXXXXXXXXXXXXXVCYDLCHYFLHHSKMPPPXXXXXXXXXXXXXXXXQLGYGVT 362
            +LP               V YD+ HYFLHH K+PP                 +LG+GVT
Sbjct: 298 SILPYYCACAGFAGGLFGYVGYDVTHYFLHHRKLPPFMRKLKKYHLEHHYKNYELGFGVT 357

Query: 363 SWYWDKIFGTYLSPDSPMSKMKYE 386
           SWYWDK+F TYLSP +P+S+ KY+
Sbjct: 358 SWYWDKVFNTYLSPTAPLSRAKYD 381

>KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 378

 Score =  424 bits (1089), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 201/381 (52%), Positives = 269/381 (70%), Gaps = 5/381 (1%)

Query: 6   SKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDE 65
           +KTL L+S+ ++  HNT DDCW++   RKIY+VT FL+++P  A  +L+ E+AGKD+T+ 
Sbjct: 3   TKTLPLYSQSQLEQHNTRDDCWVSLHHRKIYNVTSFLDEHPGGA--ELIEEYAGKDVTEI 60

Query: 66  LKDKIDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGFDSTTFV 125
           +KD      +     +  ++Y +GYLAT  EEK LL N +H VEV+L E    +DST FV
Sbjct: 61  MKDGPTHEHSYVAYEVLDEEYHVGYLATPEEEKKLLGNPEHPVEVKLEE---DYDSTVFV 117

Query: 126 KDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHYGDKSA 185
            ++P E+KLSI TD  KD  +HKFLDL++PLL Q+L  +F+K+FYLDQ+HRPRHYG  SA
Sbjct: 118 PEVPPEEKLSIVTDYTKDYGRHKFLDLNRPLLMQMLTSDFSKEFYLDQVHRPRHYGRGSA 177

Query: 186 PLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTLIEYCM 245
           PLFGN LEPL+KT+WY++P+ W PVV YH+  AL NMN + A+ LF +G++VWTLIEY +
Sbjct: 178 PLFGNFLEPLSKTAWYVIPLVWFPVVVYHMYTALQNMNNVLAVFLFCLGVFVWTLIEYGL 237

Query: 246 HRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKVVFKLL 305
           HRFLFH D  LP + + Y +HFLLHG HHYLPMD+YRLV+PPTLF+ LC PFYK+VF LL
Sbjct: 238 HRFLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFVVLCTPFYKLVFALL 297

Query: 306 PXXXXXXXXXXXXXXXVCYDLCHYFLHHSKMPPPXXXXXXXXXXXXXXXXQLGYGVTSWY 365
           P               +CYDL HYFLHH+K+P                  +LG+GVTSW+
Sbjct: 298 PKYWACAGFAGGMFGYMCYDLTHYFLHHAKLPSYMRKLKKYHMEHHYKNYELGFGVTSWF 357

Query: 366 WDKIFGTYLSPDSPMSKMKYE 386
           WDK+FGTYL  ++P+S+MK++
Sbjct: 358 WDKVFGTYLGDNAPLSQMKFD 378

>AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR272C (SCS7)
          Length = 377

 Score =  416 bits (1068), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 205/383 (53%), Positives = 261/383 (68%), Gaps = 8/383 (2%)

Query: 5   TSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITD 64
            SKTL L+SK  +  H     CW++  +RKIYDV++FL+++P       +L++AGKDIT 
Sbjct: 2   VSKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHP--GGDQYILDYAGKDITA 59

Query: 65  ELKDK-IDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGFDSTT 123
            LKDK I      ++ IL  + YL+GYLAT+ EE  LLTN+ H +EV         D+TT
Sbjct: 60  VLKDKLIHEHTEAAYEILD-ESYLVGYLATEEEEIKLLTNEKHVMEV----TPENLDTTT 114

Query: 124 FVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHYGDK 183
           FVK+LP E+ LS+ATD   D  KH FLDL+KPLL Q+L GNFT+DFY+DQIHRPRHYG  
Sbjct: 115 FVKELPAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKG 174

Query: 184 SAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTLIEY 243
           SAPLFGN LEPL+KT W++VP+ W PVV Y++  AL NM    A+  FA G++VWTLIEY
Sbjct: 175 SAPLFGNFLEPLSKTVWWVVPMVWYPVVLYYLTRALQNMPAHLALTCFAAGVFVWTLIEY 234

Query: 244 CMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKVVFK 303
            +HRFLFHFD+ +PE NI + +HFLLHG HHYLPMDKYRLV+PP LF+ LC PFY++VF 
Sbjct: 235 SLHRFLFHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFS 294

Query: 304 LLPXXXXXXXXXXXXXXXVCYDLCHYFLHHSKMPPPXXXXXXXXXXXXXXXXQLGYGVTS 363
           + P               VCYD+ HYFLHH K+PP                 +LG+GVTS
Sbjct: 295 IFPEYCACGCFAGGLFGYVCYDVTHYFLHHHKLPPFMRKLKKYHLEHHYKNYELGFGVTS 354

Query: 364 WYWDKIFGTYLSPDSPMSKMKYE 386
           WYWDK+FGTYL+ +SP+S+ K E
Sbjct: 355 WYWDKVFGTYLASNSPVSRPKCE 377

>Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996)
           [834 nt, 278 aa]
          Length = 277

 Score =  293 bits (751), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 137/256 (53%), Positives = 177/256 (69%), Gaps = 1/256 (0%)

Query: 130 TEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHYGDKSAPLFG 189
           TE+KL + TD  KD  ++ FL LD+PL  Q+L  NFT+DFY+DQ+H+PRHYG +SAP+FG
Sbjct: 19  TEEKLKVTTDYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFG 78

Query: 190 NILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTLIEYCMHRFL 249
           N LEP TKT W++VP+ W PVV Y+  V+L  ++ I AI LF+IG++VWTLIEYCMHR+L
Sbjct: 79  NFLEPFTKTHWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYL 138

Query: 250 FHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKVVFKLLPXXX 309
           FH D+ +PE  +F+V+HFLLHG HHYLPMDKYRLV+PP LF  LC+PFY + F + P   
Sbjct: 139 FHLDDSVPETRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYW 198

Query: 310 XXXXXXXXXXXXVCYDLCHYFLHHSKMPPPXXXXXXXXXXXXXXXXQLGYGVTSWYWDKI 369
                       VCYD+ HYFLHH KMP                  QLG+GVTS +WD++
Sbjct: 199 AHAGFAGGLFGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRV 258

Query: 370 FGTYLSPDS-PMSKMK 384
           FGTYL P + P ++ K
Sbjct: 259 FGTYLDPKTIPYARSK 274

>TBLA0B01310 Chr2 (276173..276544) [372 bp, 123 aa] {ON} Anc_2.166
          YNL111C
          Length = 123

 Score = 56.2 bits (134), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 43/59 (72%), Gaps = 3/59 (5%)

Query: 10 ELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELKD 68
          +L+S +++AAHNT++  WI  +D K+YDVTKFL+ +P     +++LE AG+D T + +D
Sbjct: 3  KLYSYEEIAAHNTTESAWIIIKD-KVYDVTKFLDSHP--GGDEIILELAGQDATQDFED 58

>Kwal_47.18167 s47 complement(716570..717253) [684 bp, 227 aa]
          {ON} YNL111C (CYB5) - cytochrome b5 [contig 197] FULL
          Length = 227

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 43/73 (58%), Gaps = 6/73 (8%)

Query: 4  NTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
           TS  L   S D+VA H  +DDCWI+    K+YDV+ +L  +P  A   ++L+ AGKD T
Sbjct: 26 QTSSQLPFISSDEVATHTDADDCWISIHG-KVYDVSSYLPQHPGGAQ--VMLKLAGKDAT 82

Query: 64 ---DELKDKIDSI 73
             DE+   I+S+
Sbjct: 83 VPFDEVGHSIESL 95

>Kpol_505.14 s505 (37085..37456) [372 bp, 123 aa] {ON}
          (37085..37456) [372 nt, 124 aa]
          Length = 123

 Score = 53.9 bits (128), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 41/59 (69%), Gaps = 3/59 (5%)

Query: 10 ELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELKD 68
          ++++  ++A HNT++ CWI   D K+YD TKFL+++P     +++L+ AG+D T+  +D
Sbjct: 3  KVYTYQEIAEHNTTESCWIVI-DGKVYDTTKFLDEHP--GGDEIILDLAGQDATESFED 58

>TDEL0F01210 Chr6 complement(216322..216702) [381 bp, 126 aa] {ON}
          Anc_2.166 YNL111C
          Length = 126

 Score = 52.4 bits (124), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 41/58 (70%), Gaps = 3/58 (5%)

Query: 11 LFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELKD 68
          ++S  ++A HN+++D WI   D K+YDVTKF++++P     +++L+ AG+D ++  +D
Sbjct: 4  VYSYQQIAEHNSAEDIWIVV-DGKVYDVTKFMDEHP--GGDEIILDLAGQDASEPFRD 58

>NDAI0F02730 Chr6 (669821..670186) [366 bp, 121 aa] {ON} Anc_2.166
          Length = 121

 Score = 52.0 bits (123), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 41/59 (69%), Gaps = 3/59 (5%)

Query: 10 ELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELKD 68
          ++++ +++A HN+ DD WI  +  K+YDV+KFL+++P    ++++ E AG D T+  +D
Sbjct: 3  QIYTYEEIAKHNSPDDTWIVIEG-KVYDVSKFLDEHP--GGEEIIFELAGTDATENFED 58

>KNAG0I02040 Chr9 (397527..397886) [360 bp, 119 aa] {ON} Anc_2.166
          YNL111C
          Length = 119

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 24/59 (40%), Positives = 40/59 (67%), Gaps = 3/59 (5%)

Query: 10 ELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELKD 68
          ++++ + VA H+TS+D WI   D ++Y+VTKFL+++P    +++LLE AG D T    D
Sbjct: 3  KIYTYEDVAQHSTSEDAWIVI-DNRVYEVTKFLDEHP--GGEEILLEMAGADATTNFLD 58

>NCAS0G02570 Chr7 complement(460218..460583) [366 bp, 121 aa] {ON}
          Anc_2.536 YMR073C
          Length = 121

 Score = 50.4 bits (119), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 3/59 (5%)

Query: 10 ELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELKD 68
          +++S  ++A HN  DD WI  +  K+YDV+KFL+++P     +++ E AG+D T+   D
Sbjct: 3  QVYSYQQIAEHNKPDDAWIIIEG-KVYDVSKFLDEHP--GGDEIIFELAGQDATEHFLD 58

>ZYRO0B09812g Chr2 (765874..766425) [552 bp, 183 aa] {ON} similar to
           uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
           Cytochrome b5 involved in the sterol and lipid
           biosynthesis pathways required for sterol C5-6 and fatty
           acid desaturation
          Length = 183

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 57/112 (50%), Gaps = 9/112 (8%)

Query: 10  ELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELKDK 69
           ++++ ++VA HNT +D W+   D K+YDVTKF+ D+P     +++L+ AG+D T+   D 
Sbjct: 59  KVYTFEQVAEHNTPEDAWLIV-DGKVYDVTKFVEDHP--GGDEIILDLAGQDGTEAFND- 114

Query: 70  IDSIKNPSFPILQTDQYLIGYL--ATDHEEKTLLTNKDHKVEVQLNEATNGF 119
              I +    +     +++G L  A+   +   + N      V      NGF
Sbjct: 115 ---IGHSEDAVNMLKDFIVGSLDPASRPAKSEKVANVAQTSGVTTGGEGNGF 163

>KLTH0D09284g Chr4 (770560..770931) [372 bp, 123 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
          Cytochrome b5 involved in the sterol and lipid
          biosynthesis pathways required for sterol C5-6 and
          fatty acid desaturation
          Length = 123

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 3/59 (5%)

Query: 10 ELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELKD 68
          +L+S  ++A HNT +D W+   D K+YD TKF++++P    +++LL+  G+D T    D
Sbjct: 3  KLYSYKEIAEHNTENDLWMII-DGKVYDCTKFMDEHP--GGEEVLLDLGGQDATGPFAD 58

>KLTH0A04026g Chr1 complement(337200..337901) [702 bp, 233 aa]
          {ON} weakly similar to uniprot|P40312 Saccharomyces
          cerevisiae YNL111C CYB5 Cytochrome b5, involved in the
          sterol and lipid biosynthesis pathways
          Length = 233

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 42/68 (61%), Gaps = 3/68 (4%)

Query: 11 LFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELKDKI 70
          + S++++A H +++DCW+      +YDV+++L  +P  A   ++L+ AGKD T +  D  
Sbjct: 33 VISREELATHTSAEDCWLAIHG-AVYDVSRYLTQHPGGAQ--VMLKLAGKDATAQFDDVG 89

Query: 71 DSIKNPSF 78
           S+++  F
Sbjct: 90 HSMESLMF 97

>Suva_14.228 Chr14 complement(413753..414115) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 38/59 (64%), Gaps = 3/59 (5%)

Query: 10 ELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELKD 68
          +++S  +VA HN  ++CWI   D K+YDV++F +++P     +++++  G+D TD   D
Sbjct: 3  KVYSYQEVAEHNGPENCWIIIDD-KVYDVSQFKDEHP--GGDEIIMDLGGQDATDSFVD 58

>KLLA0B14795g Chr2 (1299429..1301099) [1671 bp, 556 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 556

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 3/53 (5%)

Query: 13  SKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDE 65
           S  +V  HN  DDCWI   D ++YD+TKFL+ +P    +  L+EFAG+D T+ 
Sbjct: 82  SVKEVKMHNRIDDCWIVI-DNEVYDITKFLSQHPGGVAR--LMEFAGRDATER 131

>Kwal_26.8461 s26 (794482..794853) [372 bp, 123 aa] {ON} YNL111C
          (CYB5) - 1:1 [contig 61] FULL
          Length = 123

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 37/59 (62%), Gaps = 3/59 (5%)

Query: 10 ELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELKD 68
          +L+S  ++A HNT  D W+   D K+YD TKF++++P    +++L++  G+D T    D
Sbjct: 3  KLYSYKEIAEHNTEKDLWMII-DGKVYDCTKFMDEHP--GGEEVLVDLGGQDATGPFAD 58

>KAFR0B04550 Chr2 (946561..946941) [381 bp, 126 aa] {ON} Anc_2.166
           YNL111C
          Length = 126

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 59/109 (54%), Gaps = 10/109 (9%)

Query: 10  ELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELKDK 69
           ++++   VA H   DDCWI   D K+Y+V+KFL+++P     +++ E AG D T+   D 
Sbjct: 3   QVYTYADVAEHVLPDDCWIAI-DGKVYNVSKFLDEHP--GGDEIIYELAGSDATEYFLDI 59

Query: 70  IDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNG 118
             S  + +  IL+T    IG L  + E+   +  K H+V  +  ++ NG
Sbjct: 60  GHS--DDALKILKT--LCIGELDLNSEK---VQPKKHQVLHEDEKSRNG 101

>KLLA0F27577g Chr6 (2556662..2557180) [519 bp, 172 aa] {ON} some
          similarities with uniprot|P40312 Saccharomyces
          cerevisiae YNL111C CYB5 Cytochrome b5
          Length = 172

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 43/70 (61%), Gaps = 3/70 (4%)

Query: 11 LFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELKDKI 70
          L + D+VA H++  DCW      K+YD+T FL+ +P  A   +LL++AGKD T +  D  
Sbjct: 5  LITMDEVARHSSRSDCWTVIHG-KVYDITSFLHKHPGGAQ--VLLKYAGKDSTLQFDDIG 61

Query: 71 DSIKNPSFPI 80
           S+++ ++ +
Sbjct: 62 HSMESLAYDL 71

>Skud_14.221 Chr14 complement(407119..407481) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 46.6 bits (109), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 38/59 (64%), Gaps = 3/59 (5%)

Query: 10 ELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELKD 68
          +++S  +VA HN  ++CWI   D K+YDV++F +++P     +++++  G+D T+   D
Sbjct: 3  KVYSYQEVAEHNGPENCWIIIDD-KVYDVSQFKDEHP--GGDEIIMDLGGQDATESFVD 58

>SAKL0E10626g Chr5 (885272..885643) [372 bp, 123 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
          Cytochrome b5 involved in the sterol and lipid
          biosynthesis pathways required for sterol C5-6 and
          fatty acid desaturation
          Length = 123

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 37/59 (62%), Gaps = 3/59 (5%)

Query: 10 ELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELKD 68
          +LF+  ++A HNT  D W+   D K+YD TKF++++P    +++L++  G+D T    D
Sbjct: 3  KLFTYQEIAEHNTEGDLWMII-DGKVYDCTKFIDEHP--GGEEVLVDLGGQDATGPFAD 58

>CAGL0L03828g Chr12 (442660..443025) [366 bp, 121 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111c CYB5
          Length = 121

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 3/59 (5%)

Query: 10 ELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELKD 68
          ++++  +V+ HN   DCWI   D  +YDV+KFL+++P     +++ E  G D T +  D
Sbjct: 3  KVYTYKQVSEHNKEGDCWIII-DGSVYDVSKFLDEHP--GGDEIIFEHRGTDATGDFVD 58

>SAKL0F08316g Chr6 complement(634949..635485) [537 bp, 178 aa]
          {ON} some similarities with uniprot|P00175
          Saccharomyces cerevisiae YML054C CYB2 Cytochrome b2
          (L-lactate cytochrome-c oxidoreductase), component of
          the mitochondrial intermembrane space, required for
          lactate utilization; expression is repressed by glucose
          and anaerobic conditions
          Length = 178

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 41/68 (60%), Gaps = 6/68 (8%)

Query: 9  LELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT---DE 65
          + + S  +V  HN  DDCW+     K+Y++T FL+ +P  A+  ++L++ G+D T   DE
Sbjct: 1  MHVISPSEVVKHNRPDDCWMIIHG-KVYNLTSFLSQHPGGAH--VILQYGGRDATKQFDE 57

Query: 66 LKDKIDSI 73
          +   ++S+
Sbjct: 58 VGHSMESL 65

>TPHA0F01790 Chr6 (412270..412818) [549 bp, 182 aa] {ON} Anc_2.166
           YNL111C
          Length = 182

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 40/59 (67%), Gaps = 3/59 (5%)

Query: 10  ELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELKD 68
           ++++ +++A HNT++  WI  +  K+Y+VTKFL+++P     +++ + AG D T+  +D
Sbjct: 61  KIYTYEEIAEHNTTESSWIVIEG-KVYNVTKFLDEHP--GGDEIIFDLAGTDATENFED 116

>TPHA0B01820 Chr2 complement(406416..408146) [1731 bp, 576 aa] {ON}
           Anc_4.304 YML054C
          Length = 576

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 60/129 (46%), Gaps = 22/129 (17%)

Query: 7   KTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITD-- 64
           K  ++ + ++VA HN  DDCW+   D  +Y++T F++ +P    K++++  +GKD+T   
Sbjct: 68  KNSKVITPEEVARHNKRDDCWVVIND-SVYNLTDFIDSHP--GGKNVIVANSGKDVTKLF 124

Query: 65  -------------ELKDKIDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQ 111
                        + K ++ ++  P  P L  D Y  G  A +   K  L          
Sbjct: 125 EPIHAPNVLEKYLQPKMRLGTLSKPMPPELVCDVYAPGETAEELNSKIKL----RASLPA 180

Query: 112 LNEATNGFD 120
           LNE +N +D
Sbjct: 181 LNEISNIYD 189

>Smik_14.216 Chr14 complement(396585..396947) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 37/59 (62%), Gaps = 3/59 (5%)

Query: 10 ELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELKD 68
          +++S  +VA HN  ++ WI   D K+YDV+KF +++P     +++++  G+D T+   D
Sbjct: 3  KVYSYQEVAEHNGPENFWIIIDD-KVYDVSKFKDEHP--GGDEIIMDLGGQDATESFVD 58

>Kpol_1014.5 s1014 complement(3107..4897) [1791 bp, 596 aa] {ON}
           complement(3107..4897) [1791 nt, 597 aa]
          Length = 596

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 39/60 (65%), Gaps = 3/60 (5%)

Query: 5   TSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITD 64
           + K+L++ +  +V  HN+ DDCW+   D  +YD+T F+  +P    +D+++  AGKD+++
Sbjct: 84  SKKSLKIITPQEVIKHNSKDDCWVVIND-IVYDLTFFIKKHP--GGQDVIVGNAGKDVSN 140

>KLLA0F23672g Chr6 (2212223..2212594) [372 bp, 123 aa] {ON}
          similar to uniprot|P40312 Saccharomyces cerevisiae
          YNL111C CYB5 Cytochrome b5 involved in the sterol and
          lipid biosynthesis pathways required for sterol C5-6
          and fatty acid desaturation
          Length = 123

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 36/59 (61%), Gaps = 3/59 (5%)

Query: 10 ELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELKD 68
          +L +  +V+ H T DD W+   D K+YD TKF++++P     ++L++  G+D T   +D
Sbjct: 3  KLLTYKEVSEHKTVDDLWMII-DGKVYDCTKFVDEHP--GGDEILVDLGGQDATGPFED 58

>NDAI0D04710 Chr4 (1106280..1108130) [1851 bp, 616 aa] {ON}
           Anc_4.304
          Length = 616

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 34/54 (62%), Gaps = 3/54 (5%)

Query: 11  LFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITD 64
           L S D+VA H+T  DCW+   D K+YD+T F+  +P     D++   AGKD+T+
Sbjct: 95  LISPDEVAKHHTPADCWVVIHD-KVYDLTSFIPIHP--GGPDIIKSNAGKDVTN 145

>SAKL0F16610g Chr6 (1373674..1375368) [1695 bp, 564 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 564

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%), Gaps = 3/51 (5%)

Query: 15  DKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDE 65
           D+V  HN  DDCWI   +  +YD+T+F+  +P  A +  L+E AG+D T++
Sbjct: 91  DEVKLHNNIDDCWIVL-NGDVYDITEFIKIHPGGAAR--LMEVAGRDATEK 138

>ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 554

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 8/65 (12%)

Query: 16  KVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDEL-----KDKI 70
           +V  HN  +DCWI   + +IYDVT F+  +P  A +  LLE AG+D T +      ++ +
Sbjct: 80  EVMLHNNVNDCWIVL-NGEIYDVTSFIGKHPGGAAR--LLEVAGRDATAKFLQVHSQEVL 136

Query: 71  DSIKN 75
           D +KN
Sbjct: 137 DRMKN 141

>YNL111C Chr14 complement(416940..417302) [363 bp, 120 aa] {ON}
          CYB5Cytochrome b5, involved in the sterol and lipid
          biosynthesis pathways; acts as an electron donor to
          support sterol C5-6 desaturation
          Length = 120

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 37/59 (62%), Gaps = 3/59 (5%)

Query: 10 ELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELKD 68
          +++S  +VA HN  ++ WI   D K+YDV++F +++P     +++++  G+D T+   D
Sbjct: 3  KVYSYQEVAEHNGPENFWIIIDD-KVYDVSQFKDEHP--GGDEIIMDLGGQDATESFVD 58

>AFL223W Chr6 (19601..20098) [498 bp, 165 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL111C (CYB5)
          Length = 165

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 37/59 (62%), Gaps = 3/59 (5%)

Query: 10 ELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELKD 68
          +L++  ++A HN+ +D W+   + K+YD TKF  ++P     ++L++ AG+D T+   D
Sbjct: 42 KLYTYQEIAEHNSENDLWLII-NGKVYDCTKFAEEHP--GGDEVLIDLAGQDATEPFAD 97

>ADL085C Chr4 complement(535293..536114) [822 bp, 273 aa] {ON}
           NOHBY406; No homolog in Saccharomyces cerevisiae
          Length = 273

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 39/68 (57%), Gaps = 6/68 (8%)

Query: 9   LELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT---DE 65
           L   S ++V+ H + DDCW     R +YD+T  L ++P      +LL++AG+D T   D+
Sbjct: 90  LRKISIEEVSQHTSRDDCWFIIHGR-VYDITGLLENHP--GGTKILLKYAGRDATLPFDD 146

Query: 66  LKDKIDSI 73
           +   ++S+
Sbjct: 147 VGHSMESL 154

>KAFR0I00520 Chr9 complement(107239..108999) [1761 bp, 586 aa] {ON}
           Anc_4.304 YML054C
          Length = 586

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 3/60 (5%)

Query: 4   NTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
           N + T  L   ++VA H T DDCW+      +YD+T F+  +P     D+L   AGKD+T
Sbjct: 75  NEAITTRLILPEEVAKHKTPDDCWVVINGY-VYDITSFIMSHP--GGPDVLETNAGKDVT 131

>KLTH0C11858g Chr3 (979073..980740) [1668 bp, 555 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 555

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 16  KVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
           +V  HN  DDCWI   + ++YDVT FL  +P  A +  ++E AG D T
Sbjct: 80  EVMQHNKPDDCWIVL-NGEVYDVTSFLQMHPGGAAR--IMEVAGNDAT 124

>TDEL0H02180 Chr8 (369539..370150) [612 bp, 203 aa] {ON} 
          Length = 203

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 6/61 (9%)

Query: 16 KVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT---DELKDKIDS 72
          +V  HNT+ DCW+    R +YDVT  L+ +P      +LL++AG D T   D++   ++S
Sbjct: 29 EVREHNTAHDCWMAIHGR-VYDVTPILSKHPGGCQ--ILLKYAGMDATFPFDDVGHSMES 85

Query: 73 I 73
          +
Sbjct: 86 L 86

>NCAS0A02770 Chr1 (528814..530643) [1830 bp, 609 aa] {ON} 
          Length = 609

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 36/58 (62%), Gaps = 3/58 (5%)

Query: 6   SKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
           S T    S D+V  HN+ +DCWI   + ++YD+T F++ +P  +  D++   AGKD++
Sbjct: 89  SSTKSPISTDEVTKHNSENDCWIVI-NGQVYDLTSFMSIHPGGS--DIIKLNAGKDVS 143

>Ecym_4346 Chr4 (739106..739735) [630 bp, 209 aa] {ON} similar to
          Ashbya gossypii ADL085C
          Length = 209

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 12 FSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
           S  +V  H ++DDCW    + K+YD+T  L+ +P  A    LL++AG+D T
Sbjct: 6  ISLSEVRRHTSADDCWFIIHN-KVYDITNLLSTHPGGAKT--LLKYAGRDAT 54

>YML054C Chr13 complement(165533..167308) [1776 bp, 591 aa] {ON}
           CYB2Cytochrome b2 (L-lactate cytochrome-c
           oxidoreductase), component of the mitochondrial
           intermembrane space, required for lactate utilization;
           expression is repressed by glucose and anaerobic
           conditions
          Length = 591

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 12  FSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
            S  +VA HN  DDCW+      +YD+T+FL ++P    +D++   AGKD+T
Sbjct: 91  ISPAEVAKHNKPDDCWVVINGY-VYDLTRFLPNHP--GGQDVIKFNAGKDVT 139

>Smik_13.92 Chr13 complement(163135..164910) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 12  FSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
            S  +VA HN  DDCW+      +YD+T+FL ++P    +D++   AGKD+T
Sbjct: 91  ISPAEVAKHNKPDDCWVVINGY-VYDLTRFLPNHP--GGQDVIKFNAGKDVT 139

>Suva_13.105 Chr13 complement(168279..170054) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 33/52 (63%), Gaps = 3/52 (5%)

Query: 12  FSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
            S  +VA HN++DDCW+      +YD+T+F+ ++P     D++   AG+D+T
Sbjct: 91  ISPAEVAKHNSADDCWVVINGY-VYDLTRFVPNHP--GGPDVIKYNAGRDVT 139

>TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 12  FSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDE 65
            S  ++  HNT  DCWI   + ++YDVT FL  +P    +  L+E AG D T++
Sbjct: 75  ISASELRKHNTVHDCWIAL-NGEVYDVTAFLQMHPGGVAR--LMEVAGGDATEK 125

>Kwal_23.2823 s23 (29032..30714) [1683 bp, 560 aa] {ON} YML054C
           (CYB2) - Cytochrome b2 [L--lactate cytochrome-c
           oxidoreductase] [contig 246] FULL
          Length = 560

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 16  KVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDE 65
           +V  HN  +DCWI   D ++YDVT F+  +P    +  +LE AG D T++
Sbjct: 85  EVMLHNKLNDCWIVLND-EVYDVTSFIAAHPGGVQR--ILEVAGSDATEK 131

>KLTH0D06930g Chr4 complement(604805..605419) [615 bp, 204 aa] {ON}
           weakly similar to uniprot|Q04772 Saccharomyces
           cerevisiae YMR073C Hypothetical ORF
          Length = 204

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 13  SKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
           +K ++  HNT++DCW     R +Y V+ +L+ +P  A + LL   AGKD T
Sbjct: 130 TKAQLQKHNTAEDCWCVLNQR-VYCVSSYLDFHPGGA-EILLRTAAGKDAT 178

>Skud_13.92 Chr13 complement(163654..165429) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 12  FSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
            S  +VA HN +DDCW+      +YD+T+F+ ++P     D++   AG+D+T
Sbjct: 91  ISPAEVAKHNKADDCWVVINGY-VYDLTRFMPNHP--GGPDVIKFNAGRDVT 139

>NDAI0D04700 Chr4 (1103670..1105547) [1878 bp, 625 aa] {ON} 
          Length = 625

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 37/63 (58%), Gaps = 3/63 (4%)

Query: 1   MSINTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGK 60
           M ++  K+    + +++  HNT +DCW+   + ++YD+T F+  +P   N  ++   AGK
Sbjct: 94  MELDPVKSKTPITPNELMKHNTPEDCWVVINN-QVYDLTTFIQVHPGGPN--IIRSNAGK 150

Query: 61  DIT 63
           D+T
Sbjct: 151 DVT 153

>NCAS0A02780 Chr1 (531072..532880) [1809 bp, 602 aa] {ON} Anc_4.304
          Length = 602

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 30/48 (62%), Gaps = 3/48 (6%)

Query: 16  KVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
           +VA HNT  DCWI   +  +YD+T F+  +P  A  D++   AGKD+T
Sbjct: 93  EVARHNTPADCWIVI-NGVVYDLTSFIPVHPGGA--DIIKSNAGKDVT 137

>KLTH0C11770g Chr3 (970979..972835) [1857 bp, 618 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 618

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 13  SKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
           S  +V  HN  DDCW+   D  +YDVT F++ +P  +   ++   AGKD++
Sbjct: 120 SATEVIRHNKEDDCWVVI-DGYVYDVTAFIDQHPGGSA--VIRGNAGKDVS 167

>ZYRO0B13728g Chr2 (1110636..1112432) [1797 bp, 598 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 598

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 12  FSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
            S D+VA HN+ DDCW+   D  +YD+T+F   +P      ++   AGKD++
Sbjct: 84  ISPDEVAKHNSPDDCWVVI-DGYVYDLTEFAPVHPGGPT--VIKSNAGKDVS 132

>Ecym_5420 Chr5 (865505..865942) [438 bp, 145 aa] {ON} similar to
          Ashbya gossypii AFL223W
          Length = 145

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 12 FSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
          F+  ++A HN+  D W+   + K+YD +KF +++P     ++LL+  G+D T
Sbjct: 5  FTYQEIADHNSEQDLWLII-NGKVYDCSKFADEHP--GGDEVLLDLGGQDAT 53

>CAGL0K10736g Chr11 (1046127..1047908) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P00175 Saccharomyces cerevisiae
           YML054c CYB2 lactate dehydrogenase cytochrome b2
          Length = 593

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 12  FSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
            S  +V  HNT +DCW+   D  +YD+T F+  +P     D++   AGKD+T
Sbjct: 90  ISPSEVIKHNTPEDCWVVI-DGYVYDLTNFIALHP--GGPDIIKTNAGKDVT 138

>KNAG0E03860 Chr5 (763388..765202) [1815 bp, 604 aa] {ON} Anc_4.304
           YML054C
          Length = 604

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 12  FSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
            S  +VA HNT DDCW+  +   +Y++T+F+  +P      ++   AGKD+T
Sbjct: 92  ISPSEVAKHNTPDDCWVVIEGY-VYNLTEFIPTHP--GGPMVIKSNAGKDVT 140

>CAGL0K03069g Chr11 complement(285190..285774) [585 bp, 194 aa] {ON}
           weakly similar to uniprot|Q04772 Saccharomyces
           cerevisiae YMR073c
          Length = 194

 Score = 37.0 bits (84), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 33/48 (68%), Gaps = 2/48 (4%)

Query: 16  KVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
           ++A HNT++DCW T  + K+Y ++ +L+ +P  A K L+ + +G+D T
Sbjct: 123 ELARHNTAEDCW-TVINGKVYSISSYLSFHPGGA-KILIDKSSGQDST 168

>ZYRO0B02090g Chr2 complement(169589..170173) [585 bp, 194 aa] {ON}
           similar to gnl|GLV|KLLA0E18535g Kluyveromyces lactis
           KLLA0E18535g and weakly similar to YMR073C
           uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 194

 Score = 37.0 bits (84), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 4/51 (7%)

Query: 14  KDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEF-AGKDIT 63
           K+ +  HNT DDCW   Q  K+Y +T + + +P     D+LL + AGKD T
Sbjct: 121 KELLRRHNTKDDCWCVIQG-KVYCLTNYFDFHPGGV--DILLRYCAGKDAT 168

>SAKL0G16852g Chr7 (1452894..1454636) [1743 bp, 580 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 580

 Score = 37.0 bits (84), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 3/47 (6%)

Query: 17  VAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
           VA HN   DCW+   D  +YD+T+F++ +P      ++   AGKD+T
Sbjct: 86  VAKHNDPKDCWVVI-DGYVYDLTEFIHSHPGGPT--IIENNAGKDVT 129

>ZYRO0D16654g Chr4 complement(1380316..1380888) [573 bp, 190 aa]
          {ON} conserved hypothetical protein
          Length = 190

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 9  LELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
          L   S D++  H T  DCW+    R +Y+V   L  +P      +LL + G+D T
Sbjct: 27 LPSLSWDEIRKHMTPPDCWMVIHGR-VYNVAPVLASHP--GGSQILLHYVGRDAT 78

>TDEL0B03450 Chr2 complement(613687..617607) [3921 bp, 1306 aa] {ON}
           Anc_8.765 YOR296W
          Length = 1306

 Score = 34.7 bits (78), Expect = 0.49,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 46/91 (50%), Gaps = 4/91 (4%)

Query: 52  DLLLEFAGKDITDELKDKIDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQ 111
           DLL+E A  DIT E++ K++  K+   P  +  +      + DH   + L +   K   +
Sbjct: 187 DLLIELAATDITPEIRAKLNQYKDSVKPSKKILKEYSPSTSRDHLPSSNLVDVTVKPTFR 246

Query: 112 LNEATNGFDSTTFVKDLPTEDKLSIATDTKK 142
           LNE T+   S+ F+K L  +D +S+  D  K
Sbjct: 247 LNEVTH---SSYFMK-LFQKDPVSMQQDIIK 273

>TDEL0D01140 Chr4 complement(214858..216612) [1755 bp, 584 aa] {ON}
           Anc_4.304 YML054C
          Length = 584

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 16  KVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
           +V  HN  DDCW+   D  +YD++ F+  +P      ++   AGKD++
Sbjct: 82  EVEKHNAPDDCWVVI-DGYVYDLSDFIPSHP--GGPAVIRANAGKDVS 126

>NDAI0H01370 Chr8 (336807..337481) [675 bp, 224 aa] {ON} Anc_2.536
          Length = 224

 Score = 33.1 bits (74), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 12  FSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
           F+   +  H + DDCW T  + K+Y +T +L+ +P  A+  LL E AGKD T
Sbjct: 147 FNHKILQKHVSEDDCW-TVHNGKVYCMTYYLHFHPGGADI-LLEEAAGKDCT 196

>Kpol_348.12 s348 complement(21978..22631) [654 bp, 217 aa] {ON}
           complement(21978..22631) [654 nt, 218 aa]
          Length = 217

 Score = 33.1 bits (74), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 11  LFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
           + +K  VA H   DDCW   +  K+Y ++ +   +P   +K L+ + +G+D T
Sbjct: 142 MITKKMVAKHKDIDDCWCIIRG-KVYSISNYFKFHPG-GDKILINQCSGRDCT 192

>Kwal_26.8046 s26 complement(621715..622311) [597 bp, 198 aa] {ON}
           YMR073C - Hypothetical ORF [contig 55] FULL
          Length = 198

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 4/54 (7%)

Query: 12  FSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLE-FAGKDITD 64
            +K ++A H   +DCW    ++K+Y ++ +L+ +P     D+L++  AGKD T 
Sbjct: 123 INKAQLAQHKAPEDCWCVI-NQKVYCISSYLDFHPGGV--DILMKGAAGKDCTS 173

>TPHA0G03550 Chr7 complement(755688..756344) [657 bp, 218 aa] {ON}
           Anc_2.536 YMR073C
          Length = 218

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 12  FSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDE 65
            S+  VA HNT DDCW   +  K+Y +T +   +P   +K L    +G D T++
Sbjct: 143 ISEKMVAEHNTVDDCWCIIKG-KVYCITNYFEYHPG-GDKILKNFCSGVDATEQ 194

>KLLA0D02640g Chr4 complement(225482..227251) [1770 bp, 589 aa] {ON}
           similar to uniprot|P00175 Saccharomyces cerevisiae
           YML054C CYB2 Cytochrome b2 (L-lactate cytochrome-c
           oxidoreductase) component of the mitochondrial
           intermembrane space required for lactate utilization
           expression is repressed by glucose and anaerobic
           conditions
          Length = 589

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 13  SKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
           S  +VA H++  DCW+  +   +Y++T F++ +P      ++   AGKD+T
Sbjct: 91  SPTEVAKHSSPKDCWVVIEGY-VYNLTDFISAHP--GGPAIIENNAGKDVT 138

>SAKL0A09570g Chr1 complement(838406..839041) [636 bp, 211 aa] {ON}
           similar to gnl|GLV|CAGL0K03069g Candida glabrata
           CAGL0K03069g and weakly similar to YMR073C
           uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 211

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 14  KDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
           KD++  H T DDCW   +  K+Y ++ + + +P    + LL + AG+D T
Sbjct: 138 KDELIKHKTVDDCWCVLKG-KVYCLSAYFDFHPGGV-EILLNKCAGRDAT 185

>Kwal_14.2150 s14 (636185..641263) [5079 bp, 1692 aa] {ON} YLL021W
            (SPA2) - spindle pole antigen [contig 228] FULL
          Length = 1692

 Score = 32.3 bits (72), Expect = 2.3,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 2/75 (2%)

Query: 4    NTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLL--LEFAGKD 61
            N+ ++L +  K  VAA N   +    +++   +DV  F  +NP++   +LL  LE    +
Sbjct: 1497 NSGRSLAVAGKPPVAAPNAKGETGNDYEEDLDFDVDNFDIENPDNTLSELLLYLEHQTIE 1556

Query: 62   ITDELKDKIDSIKNP 76
            +   ++  + SIK P
Sbjct: 1557 VISTIQSLLTSIKQP 1571

>Kwal_14.807 s14 complement(57218..58954) [1737 bp, 578 aa] {ON}
           YML054C (CYB2) - Cytochrome b2 [L--lactate cytochrome-c
           oxidoreductase] [contig 245] FULL
          Length = 578

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 10  ELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDIT 63
           E     +VA H+  DDCW+   +  +YD++ F+  +P      ++   AGKD++
Sbjct: 77  ESIRPQEVAKHSKPDDCWVVI-NGYVYDLSDFIAVHP--GGPAIIKANAGKDVS 127

>KAFR0A04740 Chr1 (942850..944301) [1452 bp, 483 aa] {ON} Anc_6.106
           YGL055W
          Length = 483

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 35  IYDVTKFLNDNPNDANKDLLLEFAGKDITDELKDKIDSIKNPSFPILQT 83
           ++DVT F+N++P    + L+ E  GKD T      + S  N ++ IL T
Sbjct: 407 VHDVTDFINEHP--GGEPLIKEALGKDATRVFSGGVYSHSNAAYNILAT 453

>Ecym_3180 Chr3 (344929..346794) [1866 bp, 621 aa] {ON} similar to
           Ashbya gossypii AAL078W
          Length = 621

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 52/123 (42%), Gaps = 26/123 (21%)

Query: 37  DVTKFLNDNPNDANKDLLLEFAGKDITDELKDKIDSIKNPSFPILQTDQYLIGYLATDHE 96
           D T  L DNP+ AN+D        ++  E   K DS    +  ++++D       +   +
Sbjct: 10  DFTNILRDNPHLANRD---NAEANELASEGTSKQDSNAEETLEVVESD-----LNSNPDQ 61

Query: 97  EKTLLTNKDHKVEVQLNEATNGFDSTTFVKDLPTED-------------KLSIATDTKKD 143
           +  +L+N +   +VQ     +G +  +FV DL   +             +  +A D+ KD
Sbjct: 62  DADVLSNWEQHSDVQ-----SGINDDSFVSDLGIPEFDYGSLLKANPHLQSKVAVDSTKD 116

Query: 144 LEK 146
           + K
Sbjct: 117 IPK 119

>ZYRO0B12144g Chr2 complement(976039..982056) [6018 bp, 2005 aa] {ON}
            similar to uniprot|P25386 Saccharomyces cerevisiae
            YDL058W USO1 involved intracellular protein transport
            coiled-coil protein necessary for protein transport from
            ER to Golgi Integrin analogue gene
          Length = 2005

 Score = 31.2 bits (69), Expect = 6.1,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 101  LTNKDHKVEVQLNEATNGF--DSTTFVKDLP-TEDKLSIATDTKKDLEKHKFLDLDK 154
            L  K+ K+  +LN+ TN F  DS    +++   E++  I TD + +L+K+  +DL+K
Sbjct: 1374 LEGKETKLSSELNQLTNKFKEDSKKNQENIQHLEEEKKIITDQRAELQKNSKMDLEK 1430

>Smik_14.272 Chr14 (500166..503666) [3501 bp, 1166 aa] {ON} YNL054W
            (REAL)
          Length = 1166

 Score = 30.8 bits (68), Expect = 8.2,   Method: Composition-based stats.
 Identities = 36/151 (23%), Positives = 66/151 (43%), Gaps = 8/151 (5%)

Query: 2    SINTSKT-LELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGK 60
            SI+ S+  L++F+K      + + DC +  Q+R+I  +T     NP+   +    + +G 
Sbjct: 983  SISVSQVDLDIFAKSSFLKCDPNGDCTVVEQERRILQMTT----NPSLVEESAKSDVSGG 1038

Query: 61   DITDELKDKIDSIKNPSFPILQTDQYLIGYLATDHEEKTL-LTNKDHKVEVQLNEATNGF 119
            +I   L   ++S++ P     Q   +   Y  +    K L   +++ K E   ++  N  
Sbjct: 1039 NIETVLLGTVNSLETPL--KFQGGAFNRNYDVSVSSVKLLNPGSREAKHENDDDDDDNNG 1096

Query: 120  DSTTFVKDLPTEDKLSIATDTKKDLEKHKFL 150
               + V D   E K S+  D + D  K K L
Sbjct: 1097 SDESNVNDKQHESKTSVTKDKENDTSKWKLL 1127

>TPHA0E01540 Chr5 (313509..314159) [651 bp, 216 aa] {ON} Anc_5.465
           YOR131C
          Length = 216

 Score = 30.0 bits (66), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 35/82 (42%), Gaps = 11/82 (13%)

Query: 118 GFDSTTFVKDLPTEDKLSIATDTKKDLEKHKFLDLDK-----PLLKQILFGNFTKDFYLD 172
             D   F+K LPTE+  ++A+     +E    L++       PLLK +   N +K+    
Sbjct: 47  SVDILDFIKWLPTEEARAVASSNIASVENKAMLEMVPQPGLIPLLKYLHQNNISKNICTR 106

Query: 173 QIHRPRHYGDKSAPLFGNILEP 194
            +  P HY         N +EP
Sbjct: 107 NLIGPVHY------FISNFIEP 122

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.143    0.457 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,991,819
Number of extensions: 2017659
Number of successful extensions: 8042
Number of sequences better than 10.0: 137
Number of HSP's gapped: 8203
Number of HSP's successfully gapped: 137
Length of query: 386
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 275
Effective length of database: 40,753,473
Effective search space: 11207205075
Effective search space used: 11207205075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 67 (30.4 bits)