Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0K004408.837ON40440416660.0
NCAS0C004308.837ON36940210881e-147
KAFR0B039008.837ON37940910551e-142
Kpol_1068.118.837ON38141110421e-140
CAGL0M02937g8.837ON37340410271e-138
Smik_13.4898.837ON3724079991e-133
Skud_13.4488.837ON3644079911e-132
KLLA0D01859g8.837ON3714099811e-131
SAKL0D01540g8.837ON3654079751e-130
TDEL0B006008.837ON3694129681e-129
Kwal_27.102758.837ON3794159571e-127
YMR276W (DSK2)8.837ON3734079451e-125
TPHA0I002208.837ON3774099301e-123
KLTH0C03938g8.837ON3764169301e-123
Ecym_46088.837ON4064259161e-120
TBLA0D032308.837ON3754038711e-114
KNAG0J002908.837ON3674178061e-104
ZYRO0G14124g8.837ON3692627722e-99
ABL129W8.837ON3452437111e-90
Suva_13.4648.837ON3662477122e-90
TBLA0B032408.837ON2842491583e-11
SAKL0H15818g8.311ON77561084e-06
TDEL0G017504.16ON77561014e-05
Smik_9.215.701ON124561035e-05
NDAI0H002704.16ON77561005e-05
Skud_9.205.701ON125561035e-05
Smik_11.3575.701ON125561035e-05
Kpol_1036.628.311ON77561005e-05
KLTH0E01078g5.701ON128561035e-05
SAKL0E14894g5.701ON128561035e-05
KLLA0A00616g5.701ON128561035e-05
TDEL0B022005.701ON128561035e-05
Kpol_1043.695.701ON128561035e-05
TPHA0E002405.701ON128561035e-05
TPHA0D046005.701ON128561035e-05
TBLA0E021105.701ON128561035e-05
NDAI0E050305.701ON128561035e-05
NCAS0A032105.701ON128561035e-05
NCAS0G002405.701ON128561035e-05
CAGL0G02475g5.701ON128561035e-05
Kwal_YGOB_Anc_5.7015.701ON128561035e-05
ZYRO0G06622g5.701ON128561036e-05
KAFR0D022305.701ON128561036e-05
KAFR0H002205.701ON128561036e-05
Suva_11.3305.701ON128561036e-05
Skud_11.3335.701ON128561036e-05
YIL148W (RPL40A)5.701ON128561036e-05
YKR094C (RPL40B)5.701ON128561036e-05
Ecym_40195.701ON128561028e-05
AFR285C5.701ON128561028e-05
KNAG0L021205.701ON128561028e-05
TPHA0C008908.311ON7756971e-04
Suva_10.32singletonON6256961e-04
KLTH0G12540g8.311ON7756971e-04
NCAS0B035208.311ON7756971e-04
NDAI0J010708.311ON7756952e-04
CAGL0L01309g1.480ON392751043e-04
Kwal_55.206074.16ON231641014e-04
KAFR0E005301.480ON379611025e-04
Suva_9.405.701ON14456958e-04
KNAG0J028804.16ON15356940.001
Ecym_84084.16ON15356940.001
TPHA0K022504.16ON15356940.001
Suva_10.34singletonON15156940.001
TPHA0C023908.386ON15056930.002
KLLA0F17974g8.311ON7756890.002
KNAG0C065805.701ON14956930.002
KLTH0F08734g8.386ON15056930.002
TDEL0F043808.311ON7756890.002
KLLA0D18304g8.386ON15056930.002
ZYRO0C04026g8.386ON15256930.002
Ecym_41818.386ON15256930.002
Kwal_23.33118.386ON15056930.002
Ecym_35721.480ON44375970.002
KLTH0E05852g4.16ON40956970.002
NCAS0C029408.386ON15256930.002
ZYRO0D05962g8.311ON7763880.002
SAKL0H13926g8.386ON15456930.002
NDAI0G022808.386ON15256920.002
Kwal_27.101521.480ON38153970.002
KLTH0C03410g1.480ON39153970.002
NDAI0F003005.701ON18776940.002
YLR167W (RPS31)8.386ON15256920.002
KAFR0H020008.386ON15256920.002
TBLA0G006704.16ON22956940.003
NDAI0D049304.16ON22956940.003
KAFR0I014704.16ON22956940.003
AGL128W8.386ON15256920.003
TDEL0F051008.386ON15056920.003
CAGL0G08173g8.386ON15256910.003
Suva_10.33singletonON25456940.003
CAGL0B01589g8.311ON7756870.003
AFR358W1.480ON41375950.003
SAKL0H25784g4.16ON30556940.004
KNAG0A027308.386ON15056910.004
TPHA0O004401.480ON36967940.004
Suva_10.2668.386ON15256900.004
Skud_12.2348.386ON15256900.004
Smik_12.2298.386ON15256900.004
Skud_12.294.16ON38156940.004
YLL039C (UBI4)4.16ON38156940.004
ACL062C4.16ON38256940.004
KAFR0C030008.142ON39740940.004
Suva_10.304.16ON38156940.005
Kpol_1030.58.386ON15256900.005
Kpol_1024.168.386ON15256900.005
KLLA0E00749g4.16ON38156940.005
Smik_12.184.16ON46056940.005
NCAS0C058504.16ON38856940.005
ZYRO0G07854g4.16ON46056940.005
Kpol_1070.64.16ON53356940.005
NCAS0B045908.142ON44742940.005
CAGL0D05082g4.16ON53356940.005
TBLA0H031808.386ON15256890.005
KLLA0E22133g1.480ON38355880.022
NDAI0G003301.480ON42754880.026
Suva_5.321.480ON40954860.042
SAKL0D11814g1.480ON40075860.044
Skud_5.531.480ON39761850.057
Smik_5.561.480ON39754840.069
TDEL0C025901.480ON36867840.078
YEL037C (RAD23)1.480ON39854830.095
Kpol_370.61.480ON40476820.12
Smik_7.918.142ON39938800.21
KLTH0E02178g5.617ON593110800.24
YGL181W (GTS1)8.142ON39638800.24
TBLA0B021601.480ON40462800.26
TBLA0D022108.142ON56338790.33
TDEL0B046908.142ON44238790.34
ZYRO0F05192g1.480ON38453780.39
YDR139C (RUB1)8.311ON7759710.39
NCAS0G041201.480ON39253780.41
NDAI0B01850singletonON40344770.49
Suva_7.818.142ON40138770.56
SAKL0H24772g8.142ON41443760.76
CAGL0L06028g8.142ON50538731.6
TBLA0C012001.369ON50348713.1
Kpol_541.508.142ON51138704.1
TBLA0A086708.185ON44865695.0
Skud_7.908.142ON39638678.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0K00440
         (404 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {O...   646   0.0  
NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}...   423   e-147
KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.8...   410   e-142
Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {O...   405   e-140
CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highl...   400   e-138
Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276...   389   e-133
Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276...   386   e-132
KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} simila...   382   e-131
SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {...   380   e-130
TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {O...   377   e-129
Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {...   373   e-127
YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}  DSK2Nucle...   368   e-125
TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837...   362   e-123
KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {...   362   e-123
Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar...   357   e-120
TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {O...   340   e-114
KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON...   315   e-104
ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} simi...   301   2e-99
ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic ho...   278   1e-90
Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276...   278   2e-90
TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.83...    65   3e-11
SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 7...    46   4e-06
TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16 ...    44   4e-05
Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)     44   5e-05
NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON} A...    43   5e-05
Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)     44   5e-05
Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {O...    44   5e-05
Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [23...    43   5e-05
KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 a...    44   5e-05
SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212) ...    44   5e-05
KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {...    44   5e-05
TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa...    44   5e-05
Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {...    44   5e-05
TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {O...    44   5e-05
TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [...    44   5e-05
TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 ...    44   5e-05
NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [...    44   5e-05
NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa...    44   5e-05
NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {O...    44   5e-05
CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387...    44   5e-05
Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128...    44   5e-05
ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 a...    44   6e-05
KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa...    44   6e-05
KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {O...    44   6e-05
Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387...    44   6e-05
Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387...    44   6e-05
YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}  ...    44   6e-05
YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,...    44   6e-05
Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}...    44   8e-05
AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, ...    44   8e-05
KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387...    44   8e-05
TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]...    42   1e-04
Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON} Y...    42   1e-04
KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 7...    42   1e-04
NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234 ...    42   1e-04
NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa...    41   2e-04
CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa] ...    45   3e-04
Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {O...    44   4e-04
KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa] {O...    44   5e-04
Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)     41   8e-04
KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.1...    41   0.001
Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to...    41   0.001
TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.1...    41   0.001
Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON} ...    41   0.001
TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON...    40   0.002
KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 7...    39   0.002
KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [...    40   0.002
KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa] {O...    40   0.002
TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234 ...    39   0.002
KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON} simil...    40   0.002
ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar...    40   0.002
Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON} ...    40   0.002
Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON...    40   0.002
Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa] {O...    42   0.002
KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {...    42   0.002
NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON...    40   0.002
ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa...    39   0.002
SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa] ...    40   0.002
NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON...    40   0.002
Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa] {...    42   0.002
KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa] {...    42   0.002
NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701        41   0.002
YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusio...    40   0.002
KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON...    40   0.002
TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16...    41   0.003
NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON}              41   0.003
KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.70...    41   0.003
AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic hom...    40   0.003
TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.38...    40   0.003
CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly ...    40   0.003
Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON} ...    41   0.003
CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa...    38   0.003
AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic ...    41   0.003
SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highl...    41   0.004
KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON...    40   0.004
TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.48...    41   0.004
Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W...    39   0.004
Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W...    39   0.004
Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W...    39   0.004
Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,...    41   0.004
YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}  U...    41   0.004
ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON} S...    41   0.004
KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.1...    41   0.004
Suva_10.30 Chr10 complement(67747..67841,68061..68288,68558..690...    41   0.005
Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}...    39   0.005
Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON...    39   0.005
KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON...    41   0.005
Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..495...    41   0.005
NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON}             41   0.005
ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {...    41   0.005
Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON...    41   0.005
NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {O...    41   0.005
CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} simila...    41   0.005
TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.38...    39   0.005
KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]...    39   0.022
NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}...    39   0.026
Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON} Y...    38   0.042
SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} simila...    38   0.044
Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON} Y...    37   0.057
Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON} Y...    37   0.069
TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa] {O...    37   0.078
YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}  RA...    37   0.095
Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON} (10094..11...    36   0.12 
Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]...    35   0.21 
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    35   0.24 
YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protei...    35   0.24 
TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa] {O...    35   0.26 
TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.1...    35   0.33 
TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.1...    35   0.34 
ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} simila...    35   0.39 
YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp, ...    32   0.39 
NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON} Anc_1.4...    35   0.41 
NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {O...    34   0.49 
Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]...    34   0.56 
SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]...    34   0.76 
CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa] ...    33   1.6  
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    32   3.1  
Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {O...    32   4.1  
TBLA0A08670 Chr1 complement(2127049..2128395) [1347 bp, 448 aa] ...    31   5.0  
Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W (...    30   8.0  

>NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {ON}
           Anc_8.837 YMR276W
          Length = 404

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/404 (82%), Positives = 332/404 (82%)

Query: 1   MSTISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDF 60
           MSTISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDF
Sbjct: 1   MSTISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDF 60

Query: 61  YNIQDGHSVHLVRSGKKXXXXXXXXXXXXXXXXXXVPSNISAGQTGGFNPLADLTSARYA 120
           YNIQDGHSVHLVRSGKK                  VPSNISAGQTGGFNPLADLTSARYA
Sbjct: 61  YNIQDGHSVHLVRSGKKSTPTPATTNTTTNASNNTVPSNISAGQTGGFNPLADLTSARYA 120

Query: 121 GYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMIQSNPQ 180
           GYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMIQSNPQ
Sbjct: 121 GYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMIQSNPQ 180

Query: 181 LQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAASSFPAP 240
           LQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAASSFPAP
Sbjct: 181 LQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAASSFPAP 240

Query: 241 GGDDIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNPFASLFNPTANNDST 300
           GGDDII                                     QNPFASLFNPTANNDST
Sbjct: 241 GGDDIINNNNTNTNTNTNTNNDTNDTATSNNDNANNNASSANTQNPFASLFNPTANNDST 300

Query: 301 GLAPNPFLAMLXXXXXXXXXXXXXXXXXLPPFDPSMFASLFGGAGAPSTTPQQQDTRPPE 360
           GLAPNPFLAML                 LPPFDPSMFASLFGGAGAPSTTPQQQDTRPPE
Sbjct: 301 GLAPNPFLAMLNNAGAGSGTNNAGATGTLPPFDPSMFASLFGGAGAPSTTPQQQDTRPPE 360

Query: 361 ERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404
           ERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV
Sbjct: 361 ERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404

>NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  423 bits (1088), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 233/402 (57%), Positives = 266/402 (66%), Gaps = 34/402 (8%)

Query: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62
           +ISIH+KSGQNNWQVSID  ++I  LK+EIAKVSE+PATNQRLI+SGKILKDDQ V+FY 
Sbjct: 2   SISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYK 61

Query: 63  IQDGHSVHLVRSGKKXXXXXXXXXXXXXXXXXXVPSNISAGQTGGFNPLADLTSARYAGY 122
           I DG S+H+V+SG                    V  N++AG+TGGFNPL+DLTSARYAGY
Sbjct: 62  ILDGLSIHMVKSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFNPLSDLTSARYAGY 121

Query: 123 NLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMIQSNPQLQ 182
            LNLPSAD FGPDGG+N SG N DE L MLDNP+ QSQMNEMLSNPQM+DF+IQ+NPQLQ
Sbjct: 122 -LNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFIIQANPQLQ 180

Query: 183 AMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAASSFPAPGG 242
           AMGPQARQ+ Q+PMFRQMLTNPDMIRQSMQ+A  M  G    G  N   N +S FPAPGG
Sbjct: 181 AMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNG--NGQANTSSDFPAPGG 238

Query: 243 DDIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNPFASLFNPTANNDSTGL 302
           DD                                        NPFASLFNP         
Sbjct: 239 DD------------DNTVSENTPSTTNTASTNPSSTATTNAANPFASLFNP--------- 277

Query: 303 APNPFLAMLXXXXXXXXXXXXXXXXXLPPFDPSMFASLFGGAGAPSTTPQQQDTRPPEER 362
           A NPF A +                  P FDPS FAS+F      +   QQ+DTRPPEER
Sbjct: 278 AMNPFAAGMANTNAAGSGNP-------PAFDPSFFASMFQPP---AAQQQQEDTRPPEER 327

Query: 363 YETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404
           YE QLRQLNDMGFFDFDRN+AALRR+GG+VE+A+NALLNGDV
Sbjct: 328 YEHQLRQLNDMGFFDFDRNVAALRRSGGNVESALNALLNGDV 369

>KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.837
           YMR276W
          Length = 379

 Score =  410 bits (1055), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 230/409 (56%), Positives = 261/409 (63%), Gaps = 38/409 (9%)

Query: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62
           +I+IHIKSGQN W V+ + + SIATLK+EI+K+SEIPATNQRLIYSGKILKDDQ V+ Y 
Sbjct: 2   SITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYK 61

Query: 63  IQDGHSVHLVRSGKKXXXXXXXXXX-------XXXXXXXXVPSNISAGQTGGFNPLADLT 115
           I++GHS+HLV+SG                           VPSNI++GQTGGFNPL DLT
Sbjct: 62  IEEGHSIHLVKSGGNVARNSAATNTTPTATSNENTNSAPSVPSNIASGQTGGFNPLNDLT 121

Query: 116 SARYAGYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMI 175
           SARYAGY LN+PSAD FGPDGG+N SG + D+ L MLDNP+ QSQMNEMLSNPQMIDFMI
Sbjct: 122 SARYAGY-LNMPSADMFGPDGGLN-SGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFMI 179

Query: 176 QSNPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAAS 235
           QSNPQLQAMGPQARQM QSPMFRQML NPDMIRQSMQ A MM  G        AT N  S
Sbjct: 180 QSNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGG----NDPAATGNDPS 235

Query: 236 SFPAPGGDDIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNPFASLFNPTA 295
           +FPAPG                                           NPF +LFNP A
Sbjct: 236 AFPAPG-------EASASTNEQNTNASGESTTAGGATNNTNSTSAPAAANPFDALFNPAA 288

Query: 296 NNDSTGLAPNPFLAMLXXXXXXXXXXXXXXXXXLPPFDPSMFASLFGGAGAPSTTPQQQD 355
                    NPF AM                   P FDP++ AS+ G   +   TP QQD
Sbjct: 289 ---------NPFGAM--------SSNTNGSQPQQPAFDPALLASMLGMPQS-QQTPAQQD 330

Query: 356 TRPPEERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404
            RPPEERYE QLRQLNDMGFFDFDRN+AALRR+GGSV+ A++ALLNGDV
Sbjct: 331 NRPPEERYEAQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV 379

>Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {ON}
           complement(21199..22344) [1146 nt, 382 aa]
          Length = 381

 Score =  405 bits (1042), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 231/411 (56%), Positives = 265/411 (64%), Gaps = 42/411 (10%)

Query: 4   ISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNI 63
           I IHIKSGQN W+V++D + ++  LK+EIAKVSEIP  NQRLIYSGKILKDDQ ++FY I
Sbjct: 3   IKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKI 62

Query: 64  QDGHSVHLVRSGKKXXXXXXXXXXXXXXXXXX-------VPSNISAGQTGGFNPLADLTS 116
           QD HS+HLV+SG                           +PSNI+AGQ+GGFNPL+DLTS
Sbjct: 63  QDEHSIHLVKSGGASKTNTSASAAAASTSTATNSDSNAPLPSNIAAGQSGGFNPLSDLTS 122

Query: 117 ARYAGYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMIQ 176
           ARYAGY LNLPSAD FGPDGGMN S  N D+ L ML+NP+ QSQMNEMLSNPQMIDFMIQ
Sbjct: 123 ARYAGYGLNLPSADMFGPDGGMN-SMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDFMIQ 181

Query: 177 SNPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAASS 236
           SNPQLQAMGP+ARQMFQSP FRQMLTNP+MIRQSMQ+ANMMG G G  G+    + AASS
Sbjct: 182 SNPQLQAMGPEARQMFQSPFFRQMLTNPEMIRQSMQMANMMG-GNGQFGA----NAAASS 236

Query: 237 FPAPGGDDIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNPFASLFNPTAN 296
           FPAPG  D                                       QNPFASLFNP   
Sbjct: 237 FPAPGETDTT--------------AAAETNTETTSTPAATGAAAAGQQNPFASLFNP--- 279

Query: 297 NDSTGLAPNPF---LAMLXXXXXXXXXXXXXXXXXLPPFDPSMFASLFGGAGAPSTTPQQ 353
                 A NPF   +                     P FDPS+FAS+F          Q+
Sbjct: 280 ------AMNPFAAMMNNNAAAAAGAGATGAAGATGTPAFDPSLFASMFQPP---QQQQQE 330

Query: 354 QDTRPPEERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404
           QD RPPEERYE+QLRQLNDMGFFDFDRN+AALRR+GGSV+ A++ALL+ DV
Sbjct: 331 QDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLSNDV 381

>CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276w DSK2
          Length = 373

 Score =  400 bits (1027), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 223/404 (55%), Positives = 256/404 (63%), Gaps = 34/404 (8%)

Query: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62
           +I+IHIKSGQN W VSID + +I  LK+EIAKVSEIP+ NQRLIYSGKILKDDQ V+ YN
Sbjct: 2   SITIHIKSGQNKWDVSIDPSQTILNLKEEIAKVSEIPSGNQRLIYSGKILKDDQTVESYN 61

Query: 63  IQDGHSVHLVRSGKKXXXXX--XXXXXXXXXXXXXVPSNISAGQTGGFNPLADLTSARYA 120
           I+D H++H+V+SG                      VPSNI++GQTGGFNPLADLT ARYA
Sbjct: 62  IKDDHAIHMVKSGGNASTSNAPTNANESSNSSTTAVPSNIASGQTGGFNPLADLTGARYA 121

Query: 121 GYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMIQSNPQ 180
           GY  NLPSAD FGPDGG+N +  + DE L M++NPI QSQMNEMLSNP+M+DFMIQSNPQ
Sbjct: 122 GY-ANLPSADMFGPDGGINNA-PDQDEMLRMMENPIFQSQMNEMLSNPEMLDFMIQSNPQ 179

Query: 181 LQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAASSFPAP 240
           LQAMGPQARQM QSP FRQMLTNP MIRQSMQ A MM  G G     +ATD  AS+FPAP
Sbjct: 180 LQAMGPQARQMLQSPFFRQMLTNPAMIRQSMQFARMMN-GQGGMPGADATD--ASAFPAP 236

Query: 241 GGDDIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNPFASLFNPTANNDST 300
           GGDD                                        NPFA++     NN   
Sbjct: 237 GGDDTETTTGSTENTSTNNRTNSNANANPNAAANPFAALMDPASNPFAAMMG-NMNNQQG 295

Query: 301 GLAPNPFLAMLXXXXXXXXXXXXXXXXXLPPFDPSMFASLFGGAGAPSTTPQQQDTRPPE 360
           G                            P FDP++ ASL GG       P Q+D RPPE
Sbjct: 296 GAG-----------------------VQQPAFDPTLLASLLGGQ---LPAPAQEDNRPPE 329

Query: 361 ERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404
           ERYE QLRQLNDMGFFDFDRN+AALRR+GGSV+ A++ALLNGDV
Sbjct: 330 ERYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV 373

>Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276W
           (REAL)
          Length = 372

 Score =  389 bits (999), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 216/407 (53%), Positives = 256/407 (62%), Gaps = 41/407 (10%)

Query: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62
           +++IHIKSGQ+ W+VS+   ++++  K+ I+K + +P  NQRLIYSGKILKDDQ V+ Y+
Sbjct: 2   SLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYH 61

Query: 63  IQDGHSVHLVRSGKK----XXXXXXXXXXXXXXXXXXVPSNISAGQTGGFNPLADLTSAR 118
           IQDGHSVHLV+S  K                         N+S+GQ+ GFNPLADLTSAR
Sbjct: 62  IQDGHSVHLVKSQPKPQPGAAAGTNNATATGAAAGTVATPNMSSGQSAGFNPLADLTSAR 121

Query: 119 YAGYNLNLPSADAFGPDGG-MNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMIQS 177
           YAGY LN+PSAD FGPDGG +N    N DE L M++NPI QSQMNEMLSNPQM+DFMIQS
Sbjct: 122 YAGY-LNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180

Query: 178 NPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAASSF 237
           NPQLQAMGPQARQM QSPMFRQMLTNPDMIRQSMQ A MM    G    T +T  AAS+F
Sbjct: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAG----TGSTGGAASAF 236

Query: 238 PAPGGDDIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNPFASLFNPTANN 297
           PAPGGD                                         NPFASL NP    
Sbjct: 237 PAPGGD-----------APEESANTNTNTNTASSPNAGSNASSSTAANPFASLLNP---- 281

Query: 298 DSTGLAPNPFLAMLXXXXXXXXXXXXXXXXXLPPFDPSMFASLFGGAGAPSTTPQQQDTR 357
                A NPF +                   +P FDP++ AS+F    A +   Q +DTR
Sbjct: 282 -----ALNPFAS-----------AGNATGTGMPAFDPALLASMFQPQQASAQASQPEDTR 325

Query: 358 PPEERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404
           PPEERYE QLRQLNDMGFFDFDRN+AALRR+GGSV+ A+++LLNGDV
Sbjct: 326 PPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 372

>Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276W
           (REAL)
          Length = 364

 Score =  386 bits (991), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 214/407 (52%), Positives = 255/407 (62%), Gaps = 49/407 (12%)

Query: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62
           +++IHIKSGQ+ W+V++    ++   K+ I+K + IP  NQRLIYSGKILKDDQ VD Y+
Sbjct: 2   SLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYH 61

Query: 63  IQDGHSVHLVRSGKKXXXXXXXXXXXXXXXXXXVPS----NISAGQTGGFNPLADLTSAR 118
           IQDGHSVHLV+S  K                  V +    N+S+GQ+ GFNPLADLTSAR
Sbjct: 62  IQDGHSVHLVKSQPKPDAGGATGANNATATSAAVGTSATPNMSSGQSAGFNPLADLTSAR 121

Query: 119 YAGYNLNLPSADAFGPDGG-MNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMIQS 177
           YAGY LN+PSAD FGPDGG +N    N DE L M++NPI QSQMNEMLSNPQM+DFMIQS
Sbjct: 122 YAGY-LNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180

Query: 178 NPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAASSF 237
           NPQLQAMGPQARQM QSPMFRQMLTNP+M+RQSMQ A MM          NA ++AAS+F
Sbjct: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMM--------DPNADNSAASAF 232

Query: 238 PAPGGDDIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNPFASLFNPTANN 297
           PAPGGD                                         NPFASL NP    
Sbjct: 233 PAPGGD---------------ASEEGANTNAVPSSNAGTNGSANAAANPFASLLNP---- 273

Query: 298 DSTGLAPNPFLAMLXXXXXXXXXXXXXXXXXLPPFDPSMFASLFGGAGAPSTTPQQQDTR 357
                A NPF                     +P FDP++ AS+F    A +   Q +D+R
Sbjct: 274 -----ALNPF-----------ANAGNTAPTGMPAFDPALLASMFQPQQASAQASQPEDSR 317

Query: 358 PPEERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404
           PPEERYE QLRQLNDMGFFDFDRN+AALRR+GGSV+ A+++LLNGDV
Sbjct: 318 PPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 364

>KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 371

 Score =  382 bits (981), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 215/409 (52%), Positives = 249/409 (60%), Gaps = 43/409 (10%)

Query: 1   MSTISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDF 60
           MS IS+H+KSGQNNW V I++ A+I   K+ I+ VS +PA NQRLIYSGKILKD + V+ 
Sbjct: 1   MSQISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVES 60

Query: 61  YNIQDGHSVHLVRSGKKXXXXXXXXXXXX----XXXXXXVPSNISAGQTGGFNPLADLTS 116
           Y IQDGHSVH+V+SG                         PSNISAGQTGGFNPLADLT 
Sbjct: 61  YKIQDGHSVHMVKSGGASAATTGSTTTGSAASPAATNSAAPSNISAGQTGGFNPLADLTG 120

Query: 117 ARYAGYNLNLPSADAFGPDGGMNQS-GTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMI 175
           ARYAG   NLPSAD FGPDGG+N S G NP+  L ML+NPI QSQMNEMLSNPQM+DF+I
Sbjct: 121 ARYAGL-ANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLI 179

Query: 176 QSNPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAAS 235
           Q NPQLQA+GP+AR M QSP FRQM+T+P MIRQSMQ+AN MGM P         D AAS
Sbjct: 180 QQNPQLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSMGMSP---------DGAAS 230

Query: 236 SFPAPGGDDIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNPFASLFNPTA 295
           +FPAPG                                           NPFA LF  T 
Sbjct: 231 AFPAPG------------SASGAGGANETSTNDADSAATGAAASSTGQANPFAGLFGATP 278

Query: 296 NNDSTGLAPNPFLAMLXXXXXXXXXXXXXXXXXLPPFDPSMFASLFGGAGAPSTTPQQQD 355
            N +   A NPF  +                   P F+  + AS+FGG    +      D
Sbjct: 279 GNAA---AANPFAGLFPGGQQ-------------PQFNQELLASMFGGNSNATGAAPAVD 322

Query: 356 TRPPEERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404
            RPPEERYE+QLRQLNDMGFFDFDRN+AALRR GGSV+ A++ALLNGDV
Sbjct: 323 NRPPEERYESQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDALLNGDV 371

>SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {ON}
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin- binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 365

 Score =  380 bits (975), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 218/407 (53%), Positives = 247/407 (60%), Gaps = 48/407 (11%)

Query: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62
           +I++HIKSGQN W VSI+ T ++  LK+ I+KVSEIP  NQRLIYSGKILKDDQ V+ Y 
Sbjct: 2   SITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYK 61

Query: 63  IQDGHSVHLVRSG----KKXXXXXXXXXXXXXXXXXXVPSNISAGQTGGFNPLADLTSAR 118
           I D H+VHLVRSG                        VPSNIS+GQTGGFNPLADLT AR
Sbjct: 62  IADDHAVHLVRSGGPKPAASKSESTSATDTGAAAAAAVPSNISSGQTGGFNPLADLTGAR 121

Query: 119 YAGYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMIQSN 178
           YAGY  NLPSAD FGPDGG+  +  N DE L+MLDNPIVQSQMNEMLSNPQM+DFMIQ N
Sbjct: 122 YAGY-ANLPSADMFGPDGGLTNA-PNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQQN 179

Query: 179 PQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAASSFP 238
           PQLQAMGP+AR++ QS  FRQM+TNPDMIRQSMQ A M              + A  +FP
Sbjct: 180 PQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARMF--------GMEGAEGAGGAFP 231

Query: 239 APGGDDIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNPFASLFNPTANND 298
           APG                                           NPFASLFN  A   
Sbjct: 232 APG-----------TATQTASTEGGPAGTTASPSTTGNGSANSEAANPFASLFNGQA--- 277

Query: 299 STGLAPNPFLAMLXXXXXXXXXXXXXXXXXLPPFDPSMFASLFGG-AGAPSTTPQQQDTR 357
                 NPF +M                   P FDPS+ +S  GG   AP    Q QD R
Sbjct: 278 ------NPFASMFPNGRA-------------PQFDPSLLSSFLGGNTAAPGQQQQPQDNR 318

Query: 358 PPEERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404
           PPEERYE QLRQLNDMGFFDFDRN+AALRR+GGSV+ A++ALLNGDV
Sbjct: 319 PPEERYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV 365

>TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  377 bits (968), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 212/412 (51%), Positives = 250/412 (60%), Gaps = 54/412 (13%)

Query: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62
           +I++ +K GQ+ W+VS++   ++A  KDEIAKVSEIPA NQRLIYSGKILKDDQNV+ Y 
Sbjct: 2   SITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYK 61

Query: 63  IQDGHSVHLVRSG------KKXXXXXXXXXXXXXXXXXXVPSNISAGQTGGFNPLADLTS 116
           IQDGH++HLV+SG                          VPSNI++GQTGGFNPL+DLTS
Sbjct: 62  IQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDLTS 121

Query: 117 ARYAGYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMIQ 176
           ARYAG+  NLPSAD FGPDGG+     N D+ L ML+NPI QSQMNEMLSNPQM+DFMIQ
Sbjct: 122 ARYAGFT-NLPSADMFGPDGGLTNM-PNQDDMLGMLENPIFQSQMNEMLSNPQMVDFMIQ 179

Query: 177 SNPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAASS 236
           SNPQLQAMGPQARQ+ QSP FRQMLTNP M+RQSMQ ++MM         +   D AA+S
Sbjct: 180 SNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMM-------NPSGGNDAAAAS 232

Query: 237 FPAPGGDDIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNPFASLFNPTAN 296
           FPAPG                                           NP AS+F     
Sbjct: 233 FPAPGD----STTEASSTEANTDANANTNANANTNAANPFAAMFNPGSNPLASMF----G 284

Query: 297 NDSTGLAPN----PFLAMLXXXXXXXXXXXXXXXXXLPPFDPSMFASLFGGAGAPSTTPQ 352
           N   G A N    PF                         DPSM ASL GG  A      
Sbjct: 285 NQGVGAADNQQNQPF-------------------------DPSMLASLLGGGAAQQRA-- 317

Query: 353 QQDTRPPEERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404
           +QD RPPEERYE QLRQLNDMGFFDF++N+AALRR+GGSV+ A+++LLNGDV
Sbjct: 318 EQDNRPPEERYEQQLRQLNDMGFFDFEKNVAALRRSGGSVQGALDSLLNGDV 369

>Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {ON}
           YMR276W (DSK2) - ubiquitin-like protein [contig 37] FULL
          Length = 379

 Score =  373 bits (957), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 209/415 (50%), Positives = 258/415 (62%), Gaps = 50/415 (12%)

Query: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62
           +I++H+KSGQ+ W VS+D  +++A  K  IA+ S+I   NQRLIYSGKILKDDQ ++ Y 
Sbjct: 2   SITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYK 61

Query: 63  IQDGHSVHLVRSGKKXXXXXXXXXXXXXXXXXXVPSNISA------------GQTGGFNP 110
           I DGH+VHLV+SG K                   P+N ++            GQ GGFNP
Sbjct: 62  ILDGHAVHLVKSGTKSGSGAIGAPGSGST----APTNTASSGAAAAPASLSSGQAGGFNP 117

Query: 111 LADLTSARYAGYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQM 170
           L+DLTSARYAGY LNLPSAD+FGPDGGM  S  N D+ L ML+NP++QSQMNEMLSNPQM
Sbjct: 118 LSDLTSARYAGY-LNLPSADSFGPDGGMT-SAPNSDDMLRMLENPVMQSQMNEMLSNPQM 175

Query: 171 IDFMIQSNPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNAT 230
           IDF+IQ +PQLQ+MGPQARQM QSP FRQM+TNP+MIRQSMQ + ++G      G+ + +
Sbjct: 176 IDFLIQQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLG------GAGDPS 229

Query: 231 DNAASSFPAPGGDDIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNPFASL 290
              A++FPAPG  D                                        NPFASL
Sbjct: 230 AAGANAFPAPGTAD----------------SDASAQPASTNTSTADAAQSATNANPFASL 273

Query: 291 F-NPTANNDSTGLAPNPFLAMLXXXXXXXXXXXXXXXXXLPPFDPSMFASLFGGAGAPST 349
                A         NPFL+ML                 LP FDP+M ++L GGAG  + 
Sbjct: 274 LAGQAAAPGGASAPANPFLSML--------GQQAPGAGGLPAFDPAMLSALLGGAGN-NA 324

Query: 350 TPQQQDTRPPEERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404
           + Q QDTRPPEERYE QLRQLNDMGFF+FDRN+AALRR+GGSV+ A++ALLNGDV
Sbjct: 325 SQQPQDTRPPEERYEQQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 379

>YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}
           DSK2Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein, required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle, involved in proteolysis,
           interacts with the proteasome
          Length = 373

 Score =  368 bits (945), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 213/407 (52%), Positives = 250/407 (61%), Gaps = 40/407 (9%)

Query: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62
           +++IHIKSGQ+ W+V++   +++   K+ I K + IP  NQRLIYSGKILKDDQ V+ Y+
Sbjct: 2   SLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYH 61

Query: 63  IQDGHSVHLVRSGKKXXXXXXXXXXXXXXXXXXVPS----NISAGQTGGFNPLADLTSAR 118
           IQDGHSVHLV+S  K                    +    N+S+GQ+ GFNPLADLTSAR
Sbjct: 62  IQDGHSVHLVKSQPKPQTASAAGANNATATGAAAGTGATPNMSSGQSAGFNPLADLTSAR 121

Query: 119 YAGYNLNLPSADAFGPDGG-MNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMIQS 177
           YAGY LN+PSAD FGPDGG +N    N DE L M++NPI QSQMNEMLSNPQM+DFMIQS
Sbjct: 122 YAGY-LNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180

Query: 178 NPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAASSF 237
           NPQLQAMGPQARQM QSPMFRQMLTNPDMIRQSMQ A MM           +   AAS+F
Sbjct: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMM----DPNAGMGSAGGAASAF 236

Query: 238 PAPGGDDIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNPFASLFNPTANN 297
           PAPGGD                                         NPFASL NP    
Sbjct: 237 PAPGGD-------APEEGSNTNTTSSSNTGNNAGTNAGTNAGANTAANPFASLLNP---- 285

Query: 298 DSTGLAPNPFLAMLXXXXXXXXXXXXXXXXXLPPFDPSMFASLFGGAGAPSTTPQQQDTR 357
                A NPF                     +P FDP++ AS+F     P    Q +DTR
Sbjct: 286 -----ALNPF-----------ANAGNAASTGMPAFDPALLASMF---QPPVQASQAEDTR 326

Query: 358 PPEERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404
           PPEERYE QLRQLNDMGFFDFDRN+AALRR+GGSV+ A+++LLNGDV
Sbjct: 327 PPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 373

>TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837
           YMR276W
          Length = 377

 Score =  362 bits (930), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 211/409 (51%), Positives = 249/409 (60%), Gaps = 40/409 (9%)

Query: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62
           +IS+ IKSGQN W V+++ + +I   K+ I+K S+IPA NQRLIYSGKILKD + V+ Y 
Sbjct: 2   SISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYK 61

Query: 63  IQDGHSVHLVRSG-------KKXXXXXXXXXXXXXXXXXXVPSNISAGQTGGFNPLADLT 115
           IQDGHS+HLV+SG       K                   VP+NI++GQT GFNPLADLT
Sbjct: 62  IQDGHSIHLVKSGDASANAAKSSTAAAATANAAAGSAESAVPTNITSGQTNGFNPLADLT 121

Query: 116 SARYAGYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMI 175
           SARYAGYNL +PSAD FGPDGGM     N D+ LSML+NP+ QSQMNEMLSNPQM+++MI
Sbjct: 122 SARYAGYNLPMPSADMFGPDGGMTNM-PNQDDMLSMLENPVFQSQMNEMLSNPQMVEYMI 180

Query: 176 QSNPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAAS 235
            SNPQLQA+GPQAR+MFQSP FRQMLTNPDMIRQSM++A MMG      G     D   S
Sbjct: 181 NSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMGGEGVGIGGGLNGD---S 237

Query: 236 SFPAPGGDDIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNPFASLFNPTA 295
           SFPAPG                                           NPFA L NP A
Sbjct: 238 SFPAPGE---TSTESATAEDNAAARNPAATNPAAANPANPFAALFNPGMNPFAGLGNPAA 294

Query: 296 NNDSTGLAPNPFLAMLXXXXXXXXXXXXXXXXXLPPFDPSMFASLFGGAGAPSTTPQQQD 355
              STG    P                       P F+PSM AS+      P+    Q+D
Sbjct: 295 AG-STGAPGTP---------------------QYPGFNPSMLASMLQQPRQPA----QED 328

Query: 356 TRPPEERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404
           TRPPE RYE+QLRQLNDMGFF+FDRNIAALRR+GGSV+ A++ALLN DV
Sbjct: 329 TRPPEVRYESQLRQLNDMGFFEFDRNIAALRRSGGSVQGALDALLNNDV 377

>KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|P48510 Saccharomyces
           cerevisiae YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 376

 Score =  362 bits (930), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 211/416 (50%), Positives = 250/416 (60%), Gaps = 55/416 (13%)

Query: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62
           +I++HIKSGQN W V+ID +++IA  K  IA  SEI   NQRLIYSGKILKDDQ V+ Y 
Sbjct: 2   SITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYK 61

Query: 63  IQDGHSVHLVRSG--KKXXXXXXXXXXXXXXXXX------------XVPSNISAGQTGGF 108
           I D HSVHLV+SG  KK                               P+N+S GQ  GF
Sbjct: 62  ILDDHSVHLVKSGGSKKATSPGATAAASGDATATGATSTPAAQPQQSAPANLSTGQGNGF 121

Query: 109 NPLADLTSARYAGYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNP 168
           NPL+DLTSARYAG+ LNLPSAD+FGPDGGM  S  N D+ L ML+NP++QSQMNEMLSNP
Sbjct: 122 NPLSDLTSARYAGF-LNLPSADSFGPDGGMT-SAPNSDDVLRMLENPVMQSQMNEMLSNP 179

Query: 169 QMIDFMIQSNPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTN 228
           QMIDF+IQ +PQLQ+MGPQAR + QSP FRQM+TNPDMIRQSMQ ++M+          +
Sbjct: 180 QMIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSML--------GGD 231

Query: 229 ATDNAASSFPAPGGDDIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNPFA 288
           +     SSFPAPG                                           NPFA
Sbjct: 232 SAAGGGSSFPAPG-------------------TPAEADAPSQPAANPSAAPSAGTANPFA 272

Query: 289 SLFNPTANNDSTGLAPNPFLAMLXXXXXXXXXXXXXXXXXLPPFDPSMFASLFGGAGAPS 348
           SL    A       A NPFL+ML                  P  DP + +S+ GGAGA +
Sbjct: 273 SLLGGQAGASGASPAANPFLSMLGGGSAGTP----------PALDPMVLSSILGGAGAAN 322

Query: 349 TTPQQQDTRPPEERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404
             P  QDTRPPEERYE QLRQLNDMGFF+FDRN+AALRR+GGSV+ A++ALLNGDV
Sbjct: 323 QQP--QDTRPPEERYEHQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 376

>Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar to
           Ashbya gossypii ABL129W
          Length = 406

 Score =  357 bits (916), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 206/425 (48%), Positives = 242/425 (56%), Gaps = 43/425 (10%)

Query: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62
           +IS+H+KSGQN WQVS D ++SI TLK  IA+VS IPA NQRLIYSGKILKDDQ V+ Y 
Sbjct: 2   SISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYK 61

Query: 63  IQDGHSVHLVR---------------SGKKXXXXXXXXXXXXXXXXXXVPSNISAGQTGG 107
           I DGHS+HLVR               +                     VP+NI+AGQ GG
Sbjct: 62  IADGHSIHLVRSGGGKVSGSSGATGGASGSVEAVGSGGRNSTAGSGSTVPNNITAGQMGG 121

Query: 108 FNPLADLTSARYAGYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSN 167
           FNPLADLT ARYAGY  NLPS D FGPDGG+N S    +E L MLDNPI QSQ+NEML+N
Sbjct: 122 FNPLADLTGARYAGY-ANLPSTDMFGPDGGLN-SAIGQEEILGMLDNPIFQSQVNEMLAN 179

Query: 168 PQMIDFMIQSNPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGST 227
           PQMIDF+IQ +P LQAMGP AR+M QSP FRQM+TNPD+IRQ  +    M MG     ST
Sbjct: 180 PQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRF--QMDMGAANGQST 237

Query: 228 NATDNAASSFPAPGGDDIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNPF 287
           N        FPAPG  +                                        NPF
Sbjct: 238 N-------DFPAPGSAN---NSATTSGDNATLTSTGTGTNTNAAAANPLTSLFNAQSNPF 287

Query: 288 ASLF--------NPTANNDSTGLAPNPFLAMLXXXXXXXXXXXXXXXXXLPPFDPSMFAS 339
           A++F        NP  N  +T    NP  A                   LPP DP+M ++
Sbjct: 288 AAMFAPPANSGPNPGTNAGATNSTTNPAAAF------GADSQQPSRGFSLPPLDPAMLSA 341

Query: 340 LFGGAGAPSTTPQQQDTRPPEERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNAL 399
           L  G    +   Q +D RPPEERY+ QL QLN+MGF DFDRN+AALRR+GGSV+ A+NAL
Sbjct: 342 LLSGGFTATGRQQTEDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNAL 401

Query: 400 LNGDV 404
           LNGDV
Sbjct: 402 LNGDV 406

>TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {ON}
           Anc_8.837 YMR276W
          Length = 375

 Score =  340 bits (871), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/403 (49%), Positives = 242/403 (60%), Gaps = 37/403 (9%)

Query: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62
           TIS+HIKSGQN W V I+ +++I   KD+IA VSEIPA NQRLIYSGKILKDDQ ++ Y 
Sbjct: 2   TISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYK 61

Query: 63  IQDGHSVHLVRSGKKXXXXXXXXXXXXXXXXXXVPSN----ISAGQTGGFNPLADLTSAR 118
           IQDGHS+H+V+SG                      +N    +S G+  GFNPL+DLTSAR
Sbjct: 62  IQDGHSIHMVKSGAHATASSTTNSMTTTNTTAPQNNNGSSGMSTGRGSGFNPLSDLTSAR 121

Query: 119 YAGYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMIQSN 178
           YAGY  NLPSAD FGPDGG   S +  D+ L ML+NP+ QSQMNEMLSNP+++DF+I SN
Sbjct: 122 YAGYT-NLPSADMFGPDGGSFASQSQ-DDMLHMLENPVFQSQMNEMLSNPEIVDFLINSN 179

Query: 179 PQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAASSFP 238
           PQLQ++GPQAR MFQSPMFRQMLTNPDMIRQSM++A MM  G G          +ASSFP
Sbjct: 180 PQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNGGEGTA--------SASSFP 231

Query: 239 APGGDDIIXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXQNPFASLFNPTANN 297
           APG                                            NPFA+LF+P+   
Sbjct: 232 APGDSTTTTQPTSTNIDSDTNATNNTNNATNTPTDVPGTTNSGTAAANPFAALFDPSM-- 289

Query: 298 DSTGLAPNPFLAMLXXXXXXXXXXXXXXXXXLPPFDPSMFASLFGGAGAPSTTPQQQDTR 357
                  NP+ A+                     F+P+ FA     A   +  P  +D R
Sbjct: 290 -------NPYAALGGGNGNANNM-----------FNPAAFAQALQAAAPHTQEP--EDNR 329

Query: 358 PPEERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALL 400
           PPEERYE QLRQLNDMGFFDFD+N+AALRR+GGSV+ AVNALL
Sbjct: 330 PPEERYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNALL 372

>KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON}
           Anc_8.837 YMR276W
          Length = 367

 Score =  315 bits (806), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 198/417 (47%), Positives = 235/417 (56%), Gaps = 68/417 (16%)

Query: 4   ISIHIKSGQNNWQVSIDTT---ASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDF 60
           I++ +K GQN W V++ +     ++A  K+ +A V+ +P  NQRLIYSGKILKD Q ++ 
Sbjct: 3   ITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEE 62

Query: 61  YNIQDGHSVHLVRSGKKXXXXXXXXXXXXXXXXXXVPSNISA------GQTGGFNPLADL 114
           Y I DGH+VHLV+SG                      +  +A      GQ  GFNPLADL
Sbjct: 63  YKITDGHTVHLVKSGGAKSAGSSSSSSEATTAAGTAGTAPAAGASMAAGQQPGFNPLADL 122

Query: 115 TSARYAGYNLNLPSADAFGPDGGMNQSGTNP-----DEFLSMLDNPIVQSQMNEMLSNPQ 169
           TSARYAGYNL +PSAD FGPDGG+   G        +E LSML+NPI QSQMNEM SNPQ
Sbjct: 123 TSARYAGYNLPMPSADMFGPDGGLTSGGGPGGPQSQEEILSMLENPIFQSQMNEMFSNPQ 182

Query: 170 MIDFMIQSNPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNA 229
           M+DF+IQSNPQLQAMGPQAR+M QSPMFRQMLTNPDM+RQSMQ + MM           A
Sbjct: 183 MVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVRQSMQFSQMM-----QGSGAGA 237

Query: 230 TDNAASSFPAPGGDDIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNPFAS 289
                ++FPAPGGDD                                        NPF+S
Sbjct: 238 GGADPNAFPAPGGDDT---------------------GAPTNTSTNASAAGPAGANPFSS 276

Query: 290 LFNPTANNDSTGLAPNPFLAMLXXXXXXXXXXXXXXXXXLPPFDPSMFASLFG--GAGAP 347
           LF         G AP P                       P FD + F       GA AP
Sbjct: 277 LF---------GGAPAP---------------AAQPFQSAPGFDAAAFMQAMSRNGATAP 312

Query: 348 STTPQQQDTRPPEERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404
           +  P  QDTRPPEERYE QLRQLNDMGF DFDRN+AALRR GGS++ A++ALLNGDV
Sbjct: 313 AAAP--QDTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367

>ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 369

 Score =  301 bits (772), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 158/262 (60%), Positives = 188/262 (71%), Gaps = 27/262 (10%)

Query: 1   MSTISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDF 60
           MSTI++ IKSGQN W+V++D  ++++T K+EI+KVSEIPA++QRLIYSGKILKDDQ + F
Sbjct: 1   MSTITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQF 60

Query: 61  YNIQDGHSVHLVRSGKKXXXXXXX------------------XXXXXXXXXXXVPSNISA 102
           YN+QDGHSVHLV+S K                                      PSN+SA
Sbjct: 61  YNLQDGHSVHLVKSSKAPGNASGGSSSTAAATAGSGASAVPPSGNASTTPTTGAPSNLSA 120

Query: 103 GQTGGFNPLADLTSARYAGYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMN 162
           GQ+GGFNPLADLTSARYAG+  +LPSAD FGPDGG      N ++ L+MLDNPI QSQMN
Sbjct: 121 GQSGGFNPLADLTSARYAGFT-SLPSADMFGPDGGATNM-PNQEDLLNMLDNPIFQSQMN 178

Query: 163 EMLSNPQMIDFMIQSNPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPG 222
           EMLSNPQM+DFMIQSNPQLQAMGPQARQMFQSP FRQMLTNP MIRQSMQ A MM  G G
Sbjct: 179 EMLSNPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGG 238

Query: 223 ARGSTNATDNAASSFPAPGGDD 244
                   ++AA++FPAPG ++
Sbjct: 239 -------ENDAANAFPAPGNEN 253

 Score =  108 bits (269), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 51/72 (70%), Positives = 60/72 (83%), Gaps = 3/72 (4%)

Query: 333 DPSMFASLFGGAGAPSTTPQQQDTRPPEERYETQLRQLNDMGFFDFDRNIAALRRTGGSV 392
           DP + AS+ G   APS   Q QD RPPEERYETQLRQLN+MGFFDFDRN+AALRR+GGSV
Sbjct: 301 DPQLLASMLG---APSQQQQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSV 357

Query: 393 EAAVNALLNGDV 404
           + A+++LLNGDV
Sbjct: 358 QGALDSLLNGDV 369

>ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR276W (DSK2)
          Length = 345

 Score =  278 bits (711), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 147/243 (60%), Positives = 170/243 (69%), Gaps = 15/243 (6%)

Query: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62
           TI I +KSGQN W+VS++ + S+  LK EIAKVSEIPA NQRLIYSGKILKDDQ V+ Y 
Sbjct: 2   TIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYK 61

Query: 63  IQDGHSVHLVRSGKKXXXXXXXXXXXXXXXXXX----VPSNISAGQTGGFNPLADLTSAR 118
           I DGH++HLV+SG                        VPS+ISAGQ+GGFNPLADLT AR
Sbjct: 62  IADGHAIHLVKSGGAKAAPAASAAGGESTGAAAGAGAVPSSISAGQSGGFNPLADLTGAR 121

Query: 119 YAGYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMIQSN 178
           YAGY  NLPS D FGPDGG+N S    +E + ML+NPI QSQMNEML+NPQMIDF+IQ +
Sbjct: 122 YAGYT-NLPSTDMFGPDGGLN-SAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLIQQH 179

Query: 179 PQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAASSFP 238
           P LQAMGP AR+M QSP FRQMLTNPD+IRQ  +L     MG G  G+   TD     FP
Sbjct: 180 PHLQAMGPAAREMLQSPFFRQMLTNPDIIRQMSRLQ----MGMGGAGAEQGTD-----FP 230

Query: 239 APG 241
           APG
Sbjct: 231 APG 233

 Score =  105 bits (262), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 61/76 (80%), Gaps = 3/76 (3%)

Query: 329 LPPFDPSMFASLFGGAGAPSTTPQQQDTRPPEERYETQLRQLNDMGFFDFDRNIAALRRT 388
           +PP DP+M +SLFG     + +P   D RPPEERYE QLRQLNDMGFFDFDRN+AALRR 
Sbjct: 273 MPPLDPAMLSSLFGAG---AASPAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRA 329

Query: 389 GGSVEAAVNALLNGDV 404
           GGSV+ A++ALLNGDV
Sbjct: 330 GGSVQGALDALLNGDV 345

>Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276W
           (REAL)
          Length = 366

 Score =  278 bits (712), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 148/247 (59%), Positives = 177/247 (71%), Gaps = 11/247 (4%)

Query: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62
           ++++++KSGQ+ W+VS+   +++   K+ I++ + IP  NQRLIYSGKILKDDQ V+ Y+
Sbjct: 2   SLNVYVKSGQDKWEVSVAPESTVLQFKEAISEANGIPVANQRLIYSGKILKDDQTVESYH 61

Query: 63  IQDGHSVHLVRSGKKXXXXXXXXXXXXXXXXXXVPS-----NISAGQTGGFNPLADLTSA 117
           IQDGHSVHLV+S  +                    S     N+S+GQ+ GFNPLADLTSA
Sbjct: 62  IQDGHSVHLVKSQPRPQAGAATGAGGDAGASATNASVSATPNMSSGQSAGFNPLADLTSA 121

Query: 118 RYAGYNLNLPSADAFGPDGG-MNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMIQ 176
           RYAGY LN+PSAD FGPDGG +N    N DE L M+DNPI QSQMNEMLSNPQM+DFMIQ
Sbjct: 122 RYAGY-LNMPSADMFGPDGGALNNDSNNQDELLRMMDNPIFQSQMNEMLSNPQMLDFMIQ 180

Query: 177 SNPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAASS 236
           SNPQLQAMGPQARQM QSPMFRQMLTNPDMIRQSMQ A MM           +   AAS+
Sbjct: 181 SNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMM----DPNAGNGSAGGAASA 236

Query: 237 FPAPGGD 243
           FPAPGGD
Sbjct: 237 FPAPGGD 243

 Score =  110 bits (274), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 64/76 (84%)

Query: 329 LPPFDPSMFASLFGGAGAPSTTPQQQDTRPPEERYETQLRQLNDMGFFDFDRNIAALRRT 388
           +P FDP++ AS+F    A +  PQ +DTRPPEERYE QLRQLNDMGFFDFDRN+AALRR+
Sbjct: 291 MPAFDPALLASMFQPQQAAAQAPQPEDTRPPEERYEQQLRQLNDMGFFDFDRNVAALRRS 350

Query: 389 GGSVEAAVNALLNGDV 404
           GGSV+ A+++LLNGDV
Sbjct: 351 GGSVQGALDSLLNGDV 366

>TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.837
           YMR276W
          Length = 284

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 62/249 (24%), Positives = 106/249 (42%), Gaps = 22/249 (8%)

Query: 4   ISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNI 63
           IS++IK  +  + +  +    I+ +  +I    +IP  NQRLIYSG+IL  ++ +  YN 
Sbjct: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61

Query: 64  QDGHSVHLV--RSGKKXXXXXXXXXXXXXXXXXXVPSN---ISAGQTGGFNPLADLTSAR 118
           +DGH + ++  +  K                    P++   I++    G   +  +T+  
Sbjct: 62  KDGHCIIVIIHKEEKNNLHPPPNNTTNLNPNNSVYPASNTPINSPTPFGEGNIITITTT- 120

Query: 119 YAGYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQ-MIDFMIQS 177
                    S D +G             E L +LD+P    Q NEML N Q ++ F+IQ+
Sbjct: 121 ---------SPDPYGVRSNEVHDPEVERELLQVLDHP-RSFQENEMLLNNQNLLRFLIQT 170

Query: 178 NPQLQAMGPQ-ARQMFQSPMFRQMLTNPDMIRQSMQL----ANMMGMGPGARGSTNATDN 232
           NP L+ M    ARQ+ + P  ++   + + + Q + L          G    GS+N T  
Sbjct: 171 NPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISLRRTAIEHANNGITHPGSSNETIT 230

Query: 233 AASSFPAPG 241
             +     G
Sbjct: 231 VVTRIDESG 239

>SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          +S+++   +  +K+ + +   IP + QRLI+ GK ++DDQ VD  N+  G  +HLV
Sbjct: 15 ISLESHEKVYRIKELLEEKEGIPPSQQRLIFQGKQIEDDQTVDSANLSSGMQLHLV 70

>TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16
          YLL039C
          Length = 77

 Score = 43.5 bits (101), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C
          (REAL)
          Length = 124

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 11 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 66

>NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON}
          Anc_4.16
          Length = 77

 Score = 43.1 bits (100), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C
          (REAL)
          Length = 125

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 12 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa]
          {ON} YKR094C (REAL)
          Length = 125

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 12 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [234
          bp, 77 aa] {ON}
          complement(173662..173746,173844..173992) [234 nt, 78
          aa]
          Length = 77

 Score = 43.1 bits (100), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 32/56 (57%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          V I  +  +  +K+ + +   IP + QRLI+ GK + D+Q VD   + DG  +HLV
Sbjct: 15 VEIQGSDKVYHIKELLEEKEGIPPSQQRLIFQGKQIDDEQTVDSAKLTDGMQLHLV 70

>KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128
          aa] {ON} highly similar to uniprot|P61864 Saccharomyces
          cerevisiae YKR094c RPL40B and highly similar to
          uniprot|P61864 Saccharomyces cerevisiae YIL148w RPL40A
          Length = 128

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212)
          [387 bp, 128 aa] {ON} highly similar to uniprot|P61864
          Saccharomyces cerevisiae YLR167W RPS31 and highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YIL148W and highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094C and highly similar to
          uniprot|P04838 Saccharomyces cerevisiae YLL039C Fusion
          proteins that are cleaved to yield a ribosomal protein
          of the small (40S) subunit and ubiquitin
          Length = 128

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YKR094C RPL40B Fusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa]
          {ON} complement(145335..145721) [387 nt, 129 aa]
          Length = 128

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083)
          [387 bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387
          bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634)
          [387 bp, 128 aa] {ON} Anc_5.701
          Length = 128

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387
          bp, 128 aa] {ON} highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094c UBI2 ubiquitin and
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YIL148w UBI1 ubiquitin
          Length = 128

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128
          aa] {ON} ANNOTATED BY YGOB -
          Length = 128

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128
          aa] {ON} highly similar to uniprot|P14796 Saccharomyces
          cerevisiae YKR094C RPL40B
          Length = 128

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}
          RPL40AFusion protein, identical to Rpl40Bp, that is
          cleaved to yield ubiquitin and a ribosomal protein of
          the large (60S) ribosomal subunit with similarity to
          rat L40; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes
          Length = 128

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,
          128 aa] {ON}  RPL40BFusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}
          similar to Ashbya gossypii AFR285C 1-intron
          Length = 128

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp,
          128 aa] {ON} Syntenic homolog of Saccharomyces
          cerevisiae YKR094C (RPL40B) and YIL148W (RPL40A);
          1-intron
          Length = 128

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387
          bp, 128 aa] {ON} 
          Length = 128

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 33/56 (58%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + +  +  +  +KD + +   IP + QRLI+ GK + D+Q V+  N+ DG  +HLV
Sbjct: 15 IEVQGSDKVFHIKDLLEEKEGIPPSQQRLIFQGKQIDDEQTVESANLIDGMQLHLV 70

>Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON}
          YLL039C (REAL)
          Length = 62

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++ + +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 1  LEVEYSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 56

>KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 32/56 (57%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          V +D    +  +K+ + +   IP T QRLI+ GK + DD++V   N+  G  +HLV
Sbjct: 15 VVVDPDDKVYRIKEYLEEKEGIPPTQQRLIFQGKQIDDDKSVSSANLSSGMQLHLV 70

>NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234
          bp, 77 aa] {ON}
          Length = 77

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          V I  T  +  +K+ + +   IP + QRLI+ GK + D+Q V   N+ DG  +HLV
Sbjct: 15 VDIQGTDPVYRIKEMLEEKEGIPPSQQRLIFQGKQIDDEQTVSSANLIDGMQLHLV 70

>NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 32/56 (57%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          V I     +  +K+ + +   IP + QRLI+ GK + D+Q+V   N+ DG  +HLV
Sbjct: 15 VEISGNEPVYRIKELLEEKEGIPPSQQRLIFQGKQIDDEQSVSSANLVDGMQLHLV 70

>CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037c RAD23 nucleotide excision repair protein
          Length = 392

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 4  ISIHIKS-GQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62
          +S+  K+  +  + + ++++ SI  +K+ +++      +  +LI+SGK+LKD  +V+  N
Sbjct: 2  VSVTFKNFKKEKYPLDLESSQSIVAVKEALSEKLSCDPSQIKLIFSGKVLKDGDSVESCN 61

Query: 63 IQDGHSVHLVRSGKK 77
           +DG+ V  + S KK
Sbjct: 62 FKDGNEVIFMVSAKK 76

>Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {ON}
           YLL039C (UBI4) - 1:1 [contig 144] FULL
          Length = 231

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 39/64 (60%), Gaps = 3/64 (4%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV---R 73
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV   R
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 226

Query: 74  SGKK 77
            GKK
Sbjct: 227 GGKK 230

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa]
          {ON} Anc_1.480 YEL037C
          Length = 379

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 37/61 (60%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLVRSGK 76
          V ++++++I   K+++A +        +LI+SGK+LKDDQ V    ++D   V ++ S K
Sbjct: 15 VELESSSTILDAKNKLASIKSCDIDQIKLIFSGKVLKDDQTVSSCGLKDNDQVIMMISKK 74

Query: 77 K 77
          K
Sbjct: 75 K 75

>Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W
          (REAL)
          Length = 144

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 31 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 86

>KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to
          Ashbya gossypii ACL062C
          Length = 153

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON}
          YALI0E18986g (REAL)
          Length = 151

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 38.9 bits (89), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 34/56 (60%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          V + ++ ++  +K+ + +   IP + Q+LI+ GK + D+  +   ++QDG  +HLV
Sbjct: 15 VDVQSSETVYHIKELLEEKEGIPPSQQKLIFQGKQIDDNATIGSADLQDGSLLHLV 70

>KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304)
          [450 bp, 149 aa] {ON} 
          Length = 149

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 150

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234
          bp, 77 aa] {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 38.9 bits (89), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 31/56 (55%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          V + + A I  +K  + +   IP + QRLI+ GK + D Q ++   + DG  +HLV
Sbjct: 15 VELKSDAPIYRIKQLLEEKEGIPPSQQRLIFQGKQIDDRQTLEAAKLVDGMVLHLV 70

>KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON}
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes; interacts genetically
          with translation factor eIF2B
          Length = 150

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar
          to uniprot|P05759 Saccharomyces cerevisiae YLR167W
          RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes interacts genetically
          with translation factor eIF2B
          Length = 152

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON}
          similar to Ashbya gossypii AGL128W
          Length = 152

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON}
          YLR167W (RPS31) - Ribosomal protein S31 (S37) (YS24)
          [contig 251] FULL
          Length = 150

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa]
          {ON} similar to Ashbya gossypii AFR358W
          Length = 443

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 4  ISIHIKS-GQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62
          I+I+ K   +    + +  TA+IA  K  +AK  +   +  ++I+SGK+L+D   +D   
Sbjct: 3  ITINFKDFKKEKLPLQLSPTATIAEAKQLLAKEKQCDESQLKMIFSGKVLQDGHTLDACK 62

Query: 63 IQDGHSVHLVRSGKK 77
          ++DG  V  + S KK
Sbjct: 63 LKDGDQVIFMISKKK 77

>KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 409

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 119 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 174

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 195 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 250

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 271 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 326

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 347 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 402

>NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa]
          {ON} similar to uniprot|Q03919 Saccharomyces cerevisiae
          YDR139C RUB1 Ubiquitin-like protein with similarity to
          mammalian NEDD8
          Length = 77

 Score = 38.5 bits (88), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV---R 73
          V ++    I  +K+ + +   IP + QRLI+ GK + D Q V    + DG  +HLV   R
Sbjct: 15 VELNGEDPIYRIKELLEEKEGIPPSQQRLIFQGKQIDDQQTVSSAKLVDGMQLHLVLTLR 74

Query: 74 SGK 76
           GK
Sbjct: 75 GGK 77

>SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 and similar to uniprot|P04838
          Saccharomyces cerevisiae YIL148W and similar to
          uniprot|P04838 Saccharomyces cerevisiae YKR094C and
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039C Fusion proteins that are cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 154

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa]
          {ON} YEL037C (RAD23) - ubiquitin-like protein [contig
          41] FULL
          Length = 381

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 34/53 (64%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSV 69
          + ++ ++++   K ++A+  E   +  +LIYSGKIL+DD+ +  Y ++DG  V
Sbjct: 16 LELELSSTVNEAKQKLAENKECDDSQIKLIYSGKILQDDRTIGDYKLKDGDQV 68

>KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 391

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 33/53 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSV 69
          + +D+ ++I+  K  +A+  +   +  +LIYSGKIL+DD+ +  Y + DG  V
Sbjct: 16 LELDSGSTISEAKQRLAENKDCDESQIKLIYSGKILQDDRTIADYKLNDGDQV 68

>NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701
          Length = 187

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 43/76 (56%), Gaps = 8/76 (10%)

Query: 4   ISIHIK-------SGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQ 56
           + IHIK       +G+    + ++++ +I  +K +I     IP   QRLI++GK L+D +
Sbjct: 55  LHIHIKYSFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGR 113

Query: 57  NVDFYNIQDGHSVHLV 72
            +  YNIQ   ++HLV
Sbjct: 114 TLSDYNIQKESTLHLV 129

>YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusion
          protein that is cleaved to yield a ribosomal protein of
          the small (40S) subunit and ubiquitin; ubiquitin may
          facilitate assembly of the ribosomal protein into
          ribosomes; interacts genetically with translation
          factor eIF2B
          Length = 152

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON}
          Anc_8.386 YLR167W
          Length = 152

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16
          YLL039C
          Length = 229

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.701
          YIL148W
          Length = 229

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YLR167W (RPS31)
          Length = 152

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.386
          YLR167W
          Length = 150

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly
          similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167w UBI3 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 152

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON}
          YLL039C (REAL)
          Length = 254

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa]
          {ON} highly similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139c RUB1
          Length = 77

 Score = 38.1 bits (87), Expect = 0.003,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 30/56 (53%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          V +     +  +K+ + +   IPA+ QRLI+ GK + +D  +    + DG  +HLV
Sbjct: 15 VEVSGEDKVYHIKELLEEKEGIPASQQRLIFHGKQINNDDTISTAKLSDGMQLHLV 70

>AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YEL037C (RAD23)
          Length = 413

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 4  ISIHIKS-GQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62
          I+IH K   +    + +  +A+IA  K  +A+  +   +  ++I+SGK+L+D   ++   
Sbjct: 3  ITIHFKDFKKERLPLQLSPSATIAEAKQMLARAKQCDESQLKMIFSGKVLQDGNTLEGCK 62

Query: 63 IQDGHSVHLVRSGKK 77
          ++DG  V  + S KK
Sbjct: 63 LKDGDQVIFMISKKK 77

>SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039c UBI4 ubiquitin
          Length = 305

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

>KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.480
          YEL037C
          Length = 369

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 13 NNWQVSIDTTASIATL--KDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVH 70
             ++S+D  AS   L  K ++A+  E   +  +LIYSGK+L+D  +++   ++DG  V 
Sbjct: 10 KKQKISLDLPASSTVLHAKKQLAEQKECDDSQIKLIYSGKVLQDSNSIEGCGLKDGDQVI 69

Query: 71 LVRSGKK 77
           + S KK
Sbjct: 70 FMISKKK 76

>Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,
          381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}
          UBI4Ubiquitin, becomes conjugated to proteins, marking
          them for selective degradation via the ubiquitin-26S
          proteasome system; essential for the cellular stress
          response; encoded as a polyubiquitin precursor
          comprised of 5 head-to-tail repeats
          Length = 381

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLL039C
          (UBI4)
          Length = 382

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.142
           YGL181W
          Length = 397

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 28/40 (70%)

Query: 360 EERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNAL 399
           E  Y  Q+RQL +MGF D ++N+ AL+++ G++  A++ L
Sbjct: 187 ESDYRRQVRQLKEMGFSDSEKNLKALKKSNGNMNRAIDVL 226

>Suva_10.30 Chr10
          complement(67747..67841,68061..68288,68558..69013,
          69256..69622) [1146 bp, 381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 34/56 (60%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++ K L+D + +  YNIQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAEKQLEDGRTLSDYNIQKESTLHLV 374

>Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}
          complement(10263..10721) [459 nt, 153 aa]
          Length = 152

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON}
          complement(58683..59141) [459 nt, 153 aa]
          Length = 152

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON}
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 381

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>Smik_12.18 Chr12
          complement(49088..49552,49091..49552,49091..49546)
          [1383 bp, 460 aa] {ON} YLL039C (REAL)
          Length = 460

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 169 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 224

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 245 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 300

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 323 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 378

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 399 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 454

>NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON} 
          Length = 388

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 460

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 395 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450

>Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON}
          complement(16980..18581) [1602 nt, 534 aa]
          Length = 533

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 395 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 471 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526

>NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {ON}
           Anc_8.142 YGL181W
          Length = 447

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 362 RYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGD 403
           +Y  QLR L DMGF D D N+ AL    G++   +N L + +
Sbjct: 155 KYSRQLRSLKDMGFNDVDNNVEALNICNGNINKTINILTSNE 196

>CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} similar
          to uniprot|P04838 Saccharomyces cerevisiae YLL039c UBI4
          ubiquitin
          Length = 533

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 167 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 243 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 319 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 395 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17  VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
           + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 471 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526

>TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.386
          YLR167W
          Length = 152

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          + ++++ +I  +K +I     IP   QRLI++GK L+D + +  YNIQ   ++HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 383

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 34/55 (61%)

Query: 23 ASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLVRSGKK 77
          A+I+  K+ IA+  +  A+  +LIY+GKIL+D + V   N+++G  V  + S  K
Sbjct: 21 ATISHAKELIAEQKQCDASQIKLIYAGKILQDPKTVSGCNLKEGDQVIFMISKTK 75

>NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}
          Anc_1.480 YEL037C
          Length = 427

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 32/54 (59%)

Query: 24 SIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLVRSGKK 77
          +I  +K ++A+      +  ++IYSGK+L+D Q V+   +++G  +  + S KK
Sbjct: 23 TILDVKSQLAQAKACEESQIKIIYSGKVLQDGQTVEECQLKEGDQIIFMISKKK 76

>Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON}
          YEL037C (REAL)
          Length = 409

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%)

Query: 24 SIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLVRSGKK 77
          +I   K ++A+ S    +  +LIYSGK+L+D + V    ++DG  V  + S KK
Sbjct: 23 TIFEAKTKLAQSSSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMISQKK 76

>SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 400

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 4  ISIHIKS-GQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62
          I+I+ K   +    + +D T+++   K ++A          +LI+SGK+L+D + ++   
Sbjct: 2  ITINFKDFKKEKLPLELDPTSTVLQAKQQLASTKSCDEDQIKLIFSGKVLQDGKTLEECK 61

Query: 63 IQDGHSVHLVRSGKK 77
          ++DG  V  + S K+
Sbjct: 62 LKDGDQVIFMISKKR 76

>Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 37.4 bits (85), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 35/61 (57%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLVRSGK 76
          + ++ + +I   K ++A+ +    +  +LIYSGK+L+D + V    ++DG  V  + S K
Sbjct: 16 LDLEPSNTIFEAKTKLAQSTSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMISQK 75

Query: 77 K 77
          K
Sbjct: 76 K 76

>Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 37.0 bits (84), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 31/54 (57%)

Query: 24 SIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLVRSGKK 77
          +I  +K ++A+      +  +LIYSGK+L+D + V    ++DG  V  + S KK
Sbjct: 23 TIFEVKSKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQKK 76

>TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa]
          {ON} Anc_1.480 YEL037C
          Length = 368

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 4  ISIHIKS-GQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62
          +SI  K   +    + +D ++S+   K ++A+  E      +LIYSGK+L+D +++    
Sbjct: 2  VSITFKDFKKEKIPLDLDLSSSVLDAKVQLAQKKECEEGQIKLIYSGKVLQDSKSLQESG 61

Query: 63 IQDGHSV 69
          ++DG  V
Sbjct: 62 LKDGDQV 68

>YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}
          RAD23Protein with ubiquitin-like N terminus, subunit of
          Nuclear Excision Repair Factor 2 (NEF2) with Rad4p that
          binds damaged DNA; enhances protein deglycosylation
          activity of Png1p; also involved, with Rad4p, in
          ubiquitylated protein turnover
          Length = 398

 Score = 36.6 bits (83), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%)

Query: 24 SIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLVRSGKK 77
          +I   K ++A+      +  +LIYSGK+L+D + V    ++DG  V  + S KK
Sbjct: 23 TILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQKK 76

>Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON}
          (10094..11308) [1215 nt, 405 aa]
          Length = 404

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 4  ISIHIKSGQNNWQVSIDTTASIATL--KDEIAKVSEIPATNQRLIYSGKILKDDQNVDFY 61
          +SI  K  +   ++ +D   S+  L  K +IA   +   +  +LIYSGK+L++D  +   
Sbjct: 2  VSITFKDFKKE-KIPLDLEGSVTVLDAKKQIAVKKDCEDSQIKLIYSGKVLQNDSTIGDC 60

Query: 62 NIQDGHSVHLVRSGKK 77
           ++DG  V  + S KK
Sbjct: 61 GLKDGDQVIFMISKKK 76

>Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]
           {ON} YGL181W (REAL)
          Length = 399

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%)

Query: 362 RYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNAL 399
           RY  QL +L DMGF D ++N+ AL    G++  A++ L
Sbjct: 196 RYSRQLLELRDMGFSDANKNLDALSSAHGNINRAIDYL 233

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 54/110 (49%), Gaps = 23/110 (20%)

Query: 134 PDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMI--QSNPQLQAMGPQARQM 191
           PD G  Q  ++P+    + +NP    +  E++ +PQ++  ++  QSNPQ+  MGP     
Sbjct: 125 PDLGFGQMFSDPNMIEKLKNNP----KTAELMKDPQLVSKVLQFQSNPQM--MGP----- 173

Query: 192 FQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAASSFPAPG 241
                  ++L +P M+     +A M+G+     G +N  + AA S  AP 
Sbjct: 174 -------EILQDPRMM---TIMAAMLGVDLSIGGDSNGQEPAAPSKEAPA 213

>YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protein
           involved in Arf3p regulation and in transcription
           regulation; localizes to the nucleus and to endocytic
           patches; contains an N-terminal Zn-finger and ArfGAP
           homology domain, a C-terminal glutamine-rich region, and
           a UBA (ubiquitin associated) domain; gts1 mutations
           affect budding, cell size, heat tolerance, sporulation,
           life span, ultradian rhythms, endocytosis; expression
           oscillates in a pattern similar to metabolic
           oscillations
          Length = 396

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%)

Query: 362 RYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNAL 399
           RY  QL +L DMGF D ++N+ AL    G++  A++ L
Sbjct: 194 RYSRQLAELKDMGFGDTNKNLDALSSAHGNINRAIDYL 231

>TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa]
          {ON} Anc_1.480 YEL037C
          Length = 404

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDG-HSVHLVRSG 75
          + +D  ++I + K +IA          +LIYSGKILK+D  +    ++D  H + ++   
Sbjct: 16 LELDADSTIESAKGQIASEKNCDIDQIKLIYSGKILKNDATILNSGLKDNDHIIFMISKK 75

Query: 76 KK 77
          KK
Sbjct: 76 KK 77

>TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.142
           YGL181W
          Length = 563

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%)

Query: 362 RYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNAL 399
           +Y  QL++LNDMGF + D N  AL  + G +  A++ L
Sbjct: 219 KYSRQLKELNDMGFTNTDNNAEALSISRGDINRALDLL 256

>TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.142
           YGL181W
          Length = 442

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%)

Query: 362 RYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNAL 399
           RY  +LR L +MG+ D D N  AL    G +  A++ L
Sbjct: 193 RYSRELRTLKEMGYDDIDHNAEALSHAHGDLNRAIDIL 230

>ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 384

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSV 69
          + +D ++S+   K  +A       +  +LIYSGK+L+D +N+    ++DG  V
Sbjct: 16 LELDPSSSVKDAKVRLATEKSCEESQIKLIYSGKVLQDAKNLQESGLKDGDQV 68

>YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp,
          77 aa] {ON}  RUB1Ubiquitin-like protein with similarity
          to mammalian NEDD8; conjugation (neddylation)
          substrates include the cullins Cdc53p, Rtt101p, and
          Cul3p; activated by Ula1p and Uba3p (E1 enzyme pair);
          conjugation mediated by Ubc12p (E2 enzyme)
          Length = 77

 Score = 32.0 bits (71), Expect = 0.39,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 16 QVSIDTTAS--IATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSVHLV 72
          ++S++   S  +  +K+ + +   IP + QRLI+ GK + D   V   ++ +G  +HLV
Sbjct: 12 EISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDAHLVEGMQLHLV 70

>NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON}
          Anc_1.480 YEL037C
          Length = 392

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 33/53 (62%)

Query: 17 VSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNIQDGHSV 69
          +++++T ++   K ++A+      +  +LIYSGK+L+D + ++   ++DG  V
Sbjct: 16 LALESTNTVLDAKTQLAQNKSCEESQIKLIYSGKVLQDAKTLEDCGLKDGDQV 68

>NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {ON} 
          Length = 403

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 2/44 (4%)

Query: 362 RYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALL--NGD 403
           +Y  +LR+L +MGF D D N  AL    G +  A++ L   NGD
Sbjct: 166 KYSRELRRLQNMGFRDIDINTEALVLARGDLNGAIDILTQDNGD 209

>Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]
           {ON} YGL181W (REAL)
          Length = 401

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%)

Query: 362 RYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNAL 399
           RY  QL +L DMGF D ++N+ AL    G++  A++ L
Sbjct: 194 RYSRQLAELRDMGFNDKNKNLDALSSAHGNLSRAIDYL 231

>SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181W GTS1 Contains a zinc-finger in the N-
           terminus and a long Gln-rich region in the C-terminus
           regulates ultradian rhythm cell size cell cycle lifespan
           sporulation heat tolerance and multidrug transport
          Length = 414

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 362 RYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404
           R+  QLR L ++G+ D D N+ AL    G +  A++ +L  DV
Sbjct: 184 RHSHQLRNLKELGYLDTDSNVEALVLARGDINLALD-ILEADV 225

>CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181w GTS1
          Length = 505

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 24/38 (63%)

Query: 362 RYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNAL 399
           +Y  +LRQL ++GF +  +NI A+  + G V  A++ L
Sbjct: 211 KYGRELRQLRELGFTNEQKNIDAITYSHGDVNGALDYL 248

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
          bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 10/48 (20%), Positives = 29/48 (60%)

Query: 2  STISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSG 49
           T+  ++K   N + +SI ++ ++  LK+++ +++ +P + Q+ +  G
Sbjct: 4  ETLEFNVKHSGNVYPISITSSTTVQELKEQVQELTNVPVSRQKFMVKG 51

>Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {ON}
           complement(162130..163665) [1536 nt, 512 aa]
          Length = 511

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 20/38 (52%)

Query: 362 RYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNAL 399
           RY  +L +L +MGF D D N  A+    G +  A+  L
Sbjct: 233 RYSRELNRLREMGFNDIDNNAEAMSLANGDISRAITIL 270

>TBLA0A08670 Chr1 complement(2127049..2128395) [1347 bp, 448 aa]
           {ON} Anc_8.185 YER143W
          Length = 448

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 7/65 (10%)

Query: 338 ASLFGGAGAPSTTPQQQDTRPPEERY-ETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAV 396
           A+    A   STTP Q     P+E+Y E  ++QL D+GF   +  + AL  T G+ E A 
Sbjct: 389 ATAITPAQTTSTTPVQ-----PKEKYPEATIKQLMDLGFSKMEV-VHALDMTNGNAEMAA 442

Query: 397 NALLN 401
           + L +
Sbjct: 443 SLLFS 447

>Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W
           (REAL)
          Length = 396

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%)

Query: 362 RYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNAL 399
           RY  QL +L DMG+ D  +N+ AL    G++  +++ L
Sbjct: 194 RYSRQLIELRDMGYNDTAKNLDALSFAHGNINRSIDYL 231

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,713,638
Number of extensions: 1355109
Number of successful extensions: 4680
Number of sequences better than 10.0: 173
Number of HSP's gapped: 4710
Number of HSP's successfully gapped: 258
Length of query: 404
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 292
Effective length of database: 40,638,807
Effective search space: 11866531644
Effective search space used: 11866531644
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)