Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0K00430singletonON43843822280.0
NDAI0B03820singletonON54332015130.0
NDAI0F00850singletonON66330014420.0
NDAI0B04070singletonON1791656894e-89
TBLA0G01145singletonON7752634222e-44
TBLA0D02870singletonON5892223186e-31
Suva_1.357.61ON760108732.2
Smik_1.357.61ON760171688.4
YAL031C (GIP4)7.61ON760104689.2
NDAI0J010508.313ON172273689.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0K00430
         (438 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0K00430 Chr11 (97520..98836) [1317 bp, 438 aa] {ON}               862   0.0  
NDAI0B03820 Chr2 complement(961507..963138) [1632 bp, 543 aa] {O...   587   0.0  
NDAI0F00850 Chr6 (204487..206478) [1992 bp, 663 aa] {ON}              560   0.0  
NDAI0B04070 Chr2 (1031710..1032249) [540 bp, 179 aa] {ON}             270   4e-89
TBLA0G01145 Chr7 (302341..304668) [2328 bp, 775 aa] {ON}  possib...   167   2e-44
TBLA0D02870 Chr4 complement(706102..707871) [1770 bp, 589 aa] {O...   127   6e-31
Suva_1.35 Chr1 complement(61225..63507) [2283 bp, 760 aa] {ON} Y...    33   2.2  
Smik_1.35 Chr1 complement(67645..69927) [2283 bp, 760 aa] {ON} Y...    31   8.4  
YAL031C Chr1 complement(84749..87031) [2283 bp, 760 aa] {ON}  GI...    31   9.2  
NDAI0J01050 Chr10 (240897..246065) [5169 bp, 1722 aa] {ON} Anc_8...    31   9.4  

>NDAI0K00430 Chr11 (97520..98836) [1317 bp, 438 aa] {ON} 
          Length = 438

 Score =  862 bits (2228), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/438 (95%), Positives = 420/438 (95%)

Query: 1   MRGNEGNKYAALELNDILEKIKQINELLGSDSRQLNVVLYVEKFRRLRINRVMEALVTTS 60
           MRGNEGNKYAALELNDILEKIKQINELLGSDSRQLNVVLYVEKFRRLRINRVMEALVTTS
Sbjct: 1   MRGNEGNKYAALELNDILEKIKQINELLGSDSRQLNVVLYVEKFRRLRINRVMEALVTTS 60

Query: 61  RPLSQILIRSTNPLRFSSMLLVLKXXXXXXXXXXXXXXXXXXGLSEEVEDVLKDNNREHL 120
           RPLSQILIRSTNPLRFSSMLLVLK                  GLSEEVEDVLKDNNREHL
Sbjct: 61  RPLSQILIRSTNPLRFSSMLLVLKEDDEDVDEERQDGEVVDEGLSEEVEDVLKDNNREHL 120

Query: 121 MTGSGSFNVMKQCFSRQGLFPAAKMTTVSVTPDINGVAMDKYIRDSLKYISNNIEPDSLF 180
           MTGSGSFNVMKQCFSRQGLFPAAKMTTVSVTPDINGVAMDKYIRDSLKYISNNIEPDSLF
Sbjct: 121 MTGSGSFNVMKQCFSRQGLFPAAKMTTVSVTPDINGVAMDKYIRDSLKYISNNIEPDSLF 180

Query: 181 IATKLLNPNLRNKFAGIFLIDGIFLRGYLKTLINIVGMRTDYRSIPLAHLFTTSHETTKA 240
           IATKLLNPNLRNKFAGIFLIDGIFLRGYLKTLINIVGMRTDYRSIPLAHLFTTSHETTKA
Sbjct: 181 IATKLLNPNLRNKFAGIFLIDGIFLRGYLKTLINIVGMRTDYRSIPLAHLFTTSHETTKA 240

Query: 241 CRIAIQLLKRNVDLDWSAANFMCDQGKGLESAIREEHGKEALTCVTHLSKNLIRNAKGRV 300
           CRIAIQLLKRNVDLDWSAANFMCDQGKGLESAIREEHGKEALTCVTHLSKNLIRNAKGRV
Sbjct: 241 CRIAIQLLKRNVDLDWSAANFMCDQGKGLESAIREEHGKEALTCVTHLSKNLIRNAKGRV 300

Query: 301 IEAFQAATHTVDPQVYEESINELIKKIRESKRDSGNSTFKKLTENPRSFSRLKRDWPHWE 360
           IEAFQAATHTVDPQVYEESINELIKKIRESKRDSGNSTFKKLTENPRSFSRLKRDWPHWE
Sbjct: 301 IEAFQAATHTVDPQVYEESINELIKKIRESKRDSGNSTFKKLTENPRSFSRLKRDWPHWE 360

Query: 361 IFTTNPVEQFHSFINVLKRGSLVNMIVNLTSFQISCHNRLFLNQHFLKPHQYTFHLLIGS 420
           IFTTNPVEQFHSFINVLKRGSLVNMIVNLTSFQISCHNRLFLNQHFLKPHQYTFHLLIGS
Sbjct: 361 IFTTNPVEQFHSFINVLKRGSLVNMIVNLTSFQISCHNRLFLNQHFLKPHQYTFHLLIGS 420

Query: 421 HFELEFPQHPELAANVGE 438
           HFELEFPQHPELAANVGE
Sbjct: 421 HFELEFPQHPELAANVGE 438

>NDAI0B03820 Chr2 complement(961507..963138) [1632 bp, 543 aa] {ON} 
          Length = 543

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/320 (88%), Positives = 294/320 (91%), Gaps = 1/320 (0%)

Query: 103 GLSEEVEDVLKDNNREHLMTGSGSFNVMKQCFSRQGLFPAAKMTTVSVTPDINGVAMDKY 162
           GLSEE+EDVLKDNNREHLMTG+GSFNVMKQCFSRQGLFPA KMTTVSVTPD+N VAMDKY
Sbjct: 224 GLSEELEDVLKDNNREHLMTGNGSFNVMKQCFSRQGLFPAVKMTTVSVTPDVNSVAMDKY 283

Query: 163 IRDSLKYISNNIEPDSLFIATKLLNPNLRNKFAGIFLIDGIFLRGYLKTLINIVGMRTDY 222
           IRDSLKYI NNIEPDSLFIATKLLNPNLRN+FAGIFLIDG FLRG+ +TLINIVGM TDY
Sbjct: 284 IRDSLKYIFNNIEPDSLFIATKLLNPNLRNEFAGIFLIDGTFLRGHFRTLINIVGMTTDY 343

Query: 223 RSIPLAHLFTTSHETTKACRIAIQLLKRNVDLDWSAANFMCDQGKGLESAIREEHGKEAL 282
           RSIPLAHLFTTSHETTKACRI IQ LKRNVDLDWSAANFMCDQGKGLESAIREE+GKE L
Sbjct: 344 RSIPLAHLFTTSHETTKACRITIQSLKRNVDLDWSAANFMCDQGKGLESAIREEYGKEEL 403

Query: 283 TCVTHLSKNLIRNAKGRVIEAFQAATHTVDPQVYEESINELIKKIRESKRDSGNSTFKKL 342
           TCVTHLSKNLIRNAKGRVIEAFQAATHT+DPQVYEESINELIKK  ESKR+SGNSTFKKL
Sbjct: 404 TCVTHLSKNLIRNAKGRVIEAFQAATHTLDPQVYEESINELIKKFPESKRNSGNSTFKKL 463

Query: 343 TENPRSFSRLKRDWPHWEIFTTNPVEQFHSFINVLKRGSLVNMIVNLTSFQISCHNRLFL 402
           TENPRSFSRLKRD PHWEIFTTNPVEQFHS I VLKRG+LVNMIVNLTSFQISC N+LFL
Sbjct: 464 TENPRSFSRLKRDCPHWEIFTTNPVEQFHSIIKVLKRGNLVNMIVNLTSFQISCQNKLFL 523

Query: 403 NQHFLKPHQYTFHLLIGSHF 422
           N HF  P  Y   LLI  H 
Sbjct: 524 NPHFQAPPIY-LPLLIRPHL 542

 Score =  119 bits (299), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 59/69 (85%), Positives = 61/69 (88%)

Query: 4  NEGNKYAALELNDILEKIKQINELLGSDSRQLNVVLYVEKFRRLRINRVMEALVTTSRPL 63
          N+G KY  LE+ND L KIKQINEL GSDSRQLNVV YVEKFRRLRINRVMEALVTTSRPL
Sbjct: 6  NKGKKYTVLEINDTLAKIKQINELFGSDSRQLNVVFYVEKFRRLRINRVMEALVTTSRPL 65

Query: 64 SQILIRSTN 72
          SQI IRSTN
Sbjct: 66 SQIFIRSTN 74

>NDAI0F00850 Chr6 (204487..206478) [1992 bp, 663 aa] {ON} 
          Length = 663

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/300 (89%), Positives = 281/300 (93%)

Query: 103 GLSEEVEDVLKDNNREHLMTGSGSFNVMKQCFSRQGLFPAAKMTTVSVTPDINGVAMDKY 162
           GLSEE+EDVLKDNNREHLMTGSGSFNVMKQCFSRQGLFPAAKMTTV VTPD+NGVAMDKY
Sbjct: 204 GLSEELEDVLKDNNREHLMTGSGSFNVMKQCFSRQGLFPAAKMTTVHVTPDVNGVAMDKY 263

Query: 163 IRDSLKYISNNIEPDSLFIATKLLNPNLRNKFAGIFLIDGIFLRGYLKTLINIVGMRTDY 222
           IRDSLKYISNNIEPDSLFIATKLLNPNL NKFAGIFLID  FLRG+ K LINIVG+ TDY
Sbjct: 264 IRDSLKYISNNIEPDSLFIATKLLNPNLGNKFAGIFLIDDTFLRGHFKNLINIVGLTTDY 323

Query: 223 RSIPLAHLFTTSHETTKACRIAIQLLKRNVDLDWSAANFMCDQGKGLESAIREEHGKEAL 282
           RSIPLAHLFT SHE +KACRIAIQLLKRNVDLD SAANF+CDQGKG E+AIREEHGKEAL
Sbjct: 324 RSIPLAHLFTASHEASKACRIAIQLLKRNVDLDCSAANFICDQGKGPEAAIREEHGKEAL 383

Query: 283 TCVTHLSKNLIRNAKGRVIEAFQAATHTVDPQVYEESINELIKKIRESKRDSGNSTFKKL 342
           T VT LSKNLIRNAKGRVIEAFQAATHT+DPQVYEESINELI+K  ESKR+SGNSTFKKL
Sbjct: 384 TLVTRLSKNLIRNAKGRVIEAFQAATHTLDPQVYEESINELIEKFPESKRNSGNSTFKKL 443

Query: 343 TENPRSFSRLKRDWPHWEIFTTNPVEQFHSFINVLKRGSLVNMIVNLTSFQISCHNRLFL 402
           TENPRSFSRLKRD+PHWEIFTTNPVEQ HS I VLKRGSLVNMIVNLTSFQISC N+LFL
Sbjct: 444 TENPRSFSRLKRDYPHWEIFTTNPVEQSHSIIKVLKRGSLVNMIVNLTSFQISCQNKLFL 503

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%)

Query: 47 LRINRVMEALVTTSRPLSQILIRSTN 72
          LRINRVMEALVTTSRPLSQI +RSTN
Sbjct: 31 LRINRVMEALVTTSRPLSQIFVRSTN 56

>NDAI0B04070 Chr2 (1031710..1032249) [540 bp, 179 aa] {ON} 
          Length = 179

 Score =  270 bits (689), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 140/165 (84%), Gaps = 1/165 (0%)

Query: 258 AANFMCDQGKGLESAIREEHGKEALTCVTHLSKNLIRNAKGRVIEAFQAATHTVDPQVYE 317
             NFMCDQGK  ESAIRE HGKEA+TCVTHLSKNLIRNAKGRVIEAFQAATHT+DPQVY 
Sbjct: 15  TGNFMCDQGKAFESAIREGHGKEAITCVTHLSKNLIRNAKGRVIEAFQAATHTLDPQVYG 74

Query: 318 ESINELIKKIRESKRDSGNSTFKKLTENPRSFSRLKRDWPHWEIFTTNPVEQFHSFINVL 377
           ESINELIKK  E+KR+SGNSTFKKLT++PRSFSRLKRD PHWEIFTTNPVEQ HS I VL
Sbjct: 75  ESINELIKKFPENKRNSGNSTFKKLTQSPRSFSRLKRDCPHWEIFTTNPVEQSHSIIKVL 134

Query: 378 KRGSLVNMIVNLTSFQISCHNRLFLNQHFLKPHQYTFHLLIGSHF 422
           KR SLVNMIVNLTS QISCHNRLFLN HF  P  Y   LLI  H 
Sbjct: 135 KRESLVNMIVNLTSCQISCHNRLFLNPHFQAPPIY-LPLLIRPHL 178

>TBLA0G01145 Chr7 (302341..304668) [2328 bp, 775 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 775

 Score =  167 bits (422), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 92/263 (34%), Positives = 148/263 (56%), Gaps = 2/263 (0%)

Query: 173 NIEPDSLFIATKLLNPNLRNKFAGIFLIDGIFLRGYLKTLINIVGMRTDYRSIPLAHLFT 232
           NI P  LF++T +    L++K   I L+D  FLRG  K + NI+GM TD R +P+AHLF+
Sbjct: 315 NIVPTFLFVSTNVDWTILKDKIIPIVLVDSTFLRGEFKYMYNIIGMTTDNRVLPIAHLFS 374

Query: 233 T-SHETTKACRIAIQLLKRNVDLDWSAANFMCDQGKGLESAIREEHGKEALTCVTHLSKN 291
           T   E++   ++ I L  + V+LDW+   +M DQG+ +E  IR   G   LTC T+L +N
Sbjct: 375 TECGESSIGVKMLINLTHKYVNLDWTQMEYMSDQGRAMEKGIRASTGHFPLTCGTNLLRN 434

Query: 292 LIRNAKGRVIEAFQAATHTVDPQVYEESINELIKKIRESKRDSGNSTFKKLTENPRSFSR 351
           + +  KG+V+  F+  T+T+D   Y +   +L+       R   N+T+ K+      F+R
Sbjct: 435 IKKYTKGKVVNKFRKLTYTLDEVEYNQISEKLLSCFYTKNRKFSNNTYNKIKTYACLFAR 494

Query: 352 LKRDWPHWEIFTTNPVEQFHSFINVLKRGSLVNMIVNLTSFQISCHNRLFLNQHFLKPHQ 411
            KR  PH+EIFT+N V+ +HS    +K G+ +N+ +N+     +C+NRL L ++ L  ++
Sbjct: 495 RKRKKPHFEIFTSNSVKVWHSRSKTIKNGNFMNLFINVAFCDANCYNRL-LKENSLSHNE 553

Query: 412 YTFHLLIGSHFELEFPQHPELAA 434
            T + +      +    H E AA
Sbjct: 554 LTKYGITYISMNIALALHFEYAA 576

>TBLA0D02870 Chr4 complement(706102..707871) [1770 bp, 589 aa] {ON} 
          Length = 589

 Score =  127 bits (318), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 79/222 (35%), Positives = 118/222 (53%), Gaps = 1/222 (0%)

Query: 179 LFIATKLLNPNLRNKFAGIFLIDGIFLRGYLKTLINIVGMRTDYRSIPLAHLFTTSHETT 238
           +F    + +  +  K   +  +DG  L G  +TL+ +V   T+ RS P+AH+     E  
Sbjct: 212 VFFTVDMPSSIVSEKLIDVIFLDGTHLAGKFQTLLTLVATTTENRSYPIAHMLVQGGEKY 271

Query: 239 KACRIAIQLLKRNVDLDWSAANFMCDQGKGLESAIREEHGKEALTCVTHLSKNLIRNAKG 298
           +  R  + L K+ V L W     MCDQ + LESAI     +  LTC  HL KN+++  KG
Sbjct: 272 REARQFLWLTKKYVPLSWDRIQVMCDQSRALESAITSVMDRPYLTCGVHLVKNVVKWTKG 331

Query: 299 RVIEAFQAATHTVDPQVYEESINELIKKIRESKRDSGNSTFKKLTENPRSFSRLKRDWPH 358
           +V+  F+   HT+D     +++  L++    S + + NST+ K+T     F+   R   H
Sbjct: 332 KVVAKFRNLLHTLDEATCNDNLKCLVQAFYSSAKANQNSTYNKITSMKEKFATFTRK-NH 390

Query: 359 WEIFTTNPVEQFHSFINVLKRGSLVNMIVNLTSFQISCHNRL 400
           +E F+TNPVEQFHS I +LKR    N+I NL + Q SC N L
Sbjct: 391 FEQFSTNPVEQFHSLIKMLKRTGTNNLINNLLANQGSCINTL 432

>Suva_1.35 Chr1 complement(61225..63507) [2283 bp, 760 aa] {ON}
           YAL031C (REAL)
          Length = 760

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 53/108 (49%), Gaps = 20/108 (18%)

Query: 339 FKKLTEN-PRSFSRLKRDWPHWEIFTTNPVEQFHSFINVLKRGSLVNMIVNLTSFQISCH 397
            +K +E  P S   L+ D PHWE +T + +  FH     L+  S++ +I++L S QI   
Sbjct: 251 LQKFSETRPVSLLNLQNDLPHWE-WTLHRMYSFH-----LRVLSVLCVIISL-SRQIFLP 303

Query: 398 NRLFLNQHFL-------KPHQYTFHLLIGSHFELEFPQHPELAANVGE 438
           N+    QHFL         + Y + L+I     L  PQ  EL+  +GE
Sbjct: 304 NK----QHFLDVKTRLSSQNAYQYDLVINDLMALLSPQSDELST-LGE 346

>Smik_1.35 Chr1 complement(67645..69927) [2283 bp, 760 aa] {ON}
           YAL031C (REAL)
          Length = 760

 Score = 30.8 bits (68), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 74/171 (43%), Gaps = 56/171 (32%)

Query: 282 LTCVTHLSKNLIR--NAKGRVI----EAFQAATHTVDPQVYEESIN--------ELIKKI 327
           L C++ +++N I+  NAK R I    +A+++ + + D  + E+ +N        +L   I
Sbjct: 152 LHCLSCIAQNAIKIYNAKLRQILLERDAYKSRSLSFDTSIIEDLLNPVEMSLILDLAVLI 211

Query: 328 RESKRDSGNSTFKKLT-------------------------------ENPRSFSRLKRDW 356
            +  +D   ++F KL                                  P S   L++D 
Sbjct: 212 NDPIKDKSTNSFYKLQWQVMEKLNSCVLSKIFPILRAYYNQLQKFSERRPISLQNLQKDL 271

Query: 357 PHWEIFTTNPVEQFHSFINVLKRGSLVNMIVNLTSFQISCHNRLFLNQHFL 407
           PHWE +T + +  FH     L+  S++ +I++L S QI   N+    QHFL
Sbjct: 272 PHWE-WTLHRIYTFH-----LRVFSVLCVIISL-SRQIFLPNK----QHFL 311

>YAL031C Chr1 complement(84749..87031) [2283 bp, 760 aa] {ON}
           GIP4Cytoplasmic Glc7-interacting protein whose
           overexpression relocalizes Glc7p from the nucleus and
           prevents chromosome segregation; potential Cdc28p
           substrate
          Length = 760

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 51/104 (49%), Gaps = 19/104 (18%)

Query: 339 FKKLTEN-PRSFSRLKRDWPHWEIFTTNPVEQFHSFINVLKRGSLVNMIVNLTSFQISCH 397
            +K +E  P S S L++D PHWE +T + +  FH     L+  S++ +I++  S QI   
Sbjct: 252 LQKFSETRPTSLSNLQKDLPHWE-WTLHRIYTFH-----LRVFSVLCVIISF-SRQIFLP 304

Query: 398 NRLFLNQHFL-------KPHQYTFHLLIGSHFELEFPQHPELAA 434
           N+    QHFL         + Y + L+I     L  P+  ++ A
Sbjct: 305 NK----QHFLDIKTRLSSENVYHYDLIICELMALLSPECDDVTA 344

>NDAI0J01050 Chr10 (240897..246065) [5169 bp, 1722 aa] {ON} Anc_8.313
            YDR141C
          Length = 1722

 Score = 30.8 bits (68), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 6/73 (8%)

Query: 372  SFINVLKRG------SLVNMIVNLTSFQISCHNRLFLNQHFLKPHQYTFHLLIGSHFELE 425
            S+IN+L         S+ +M++ LTS  + C  RLF +      +  +  LL+G   EL 
Sbjct: 1012 SYINLLSESIVYFDHSIFSMVLPLTSSIVQCVQRLFNSAKVSGDYYESISLLLGGLKELS 1071

Query: 426  FPQHPELAANVGE 438
               H  LAA+  E
Sbjct: 1072 EVSHGYLAADERE 1084

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,932,580
Number of extensions: 1744726
Number of successful extensions: 5777
Number of sequences better than 10.0: 17
Number of HSP's gapped: 5945
Number of HSP's successfully gapped: 19
Length of query: 438
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 325
Effective length of database: 40,524,141
Effective search space: 13170345825
Effective search space used: 13170345825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)