Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0K004208.839ON77877835870.0
NCAS0C004208.839ON72568824120.0
TDEL0B005808.839ON71369222480.0
KAFR0B039108.839ON72469422370.0
ZYRO0G14168g8.839ON76469122380.0
CAGL0M02959g8.839ON75864621960.0
TPHA0I002408.839ON73269521150.0
Kpol_1068.98.839ON74569921120.0
TBLA0D032608.839ON76871520780.0
Skud_13.4498.839ON73469320660.0
YMR277W (FCP1)8.839ON73269520620.0
Smik_13.4908.839ON73269520580.0
KNAG0J002808.839ON74270420340.0
Suva_13.4658.839ON73258919580.0
SAKL0D01496g8.839ON68869019280.0
Kwal_27.102638.839ON74358018150.0
Ecym_46108.839ON75169818110.0
ABL127W8.839ON72854017790.0
KLLA0D01595g8.839ON71958017370.0
KLTH0C03894g8.839ON74557817380.0
Kpol_478.165.202ON350921072e-04
NCAS0A068005.202ON473511000.002
NDAI0D018605.202ON51451990.003
TPHA0E030705.202ON49451970.005
Kpol_1010.615.94ON93294960.007
YLR019W (PSR2)5.202ON39743930.016
Smik_12.825.202ON39243920.021
SAKL0G12870g5.202ON39943910.022
Skud_12.875.202ON39243890.040
ZYRO0B10428g5.202ON48240890.042
Suva_10.995.202ON38541860.093
TPHA0N006705.202ON45241860.12
CAGL0D05610g5.202ON44745850.14
NDAI0I021705.202ON39145850.14
YLL010C (PSR1)5.202ON42740850.15
Skud_12.575.202ON41551850.15
Suva_10.655.202ON41540840.16
Smik_12.535.202ON41440840.17
AAL158W5.202ON47840830.25
NCAS0D027405.202ON39845810.38
TBLA0C060905.202ON48451810.40
KAFR0E021405.94ON95182820.40
KLLA0E16655g5.629ON656140810.43
Kpol_2002.1005.202ON47742810.47
TDEL0E042705.202ON45340800.60
CAGL0D03234g5.202ON41040790.62
Ecym_71045.202ON49240800.64
NDAI0C032305.94ON1034109800.66
KNAG0M017405.202ON48140790.73
Smik_16.1728.527ON477110790.82
NDAI0G055201.276ON83265790.88
KNAG0E005705.94ON98191790.93
KAFR0J009905.202ON48340781.0
TBLA0H019905.202ON68840781.1
Suva_16.2498.527ON480110771.3
KLTH0B03388g5.202ON40940761.5
KLLA0F15620g5.202ON41440761.5
Ecym_44607.111ON73193771.6
Kwal_33.151405.202ON41042761.7
KNAG0B018301.276ON75249762.1
TPHA0A051105.94ON106560752.6
SAKL0G15620g5.94ON87995752.7
SAKL0H20592g4.156ON50868743.2
YPL063W (TIM50)8.527ON476100733.4
TPHA0H010705.94ON101588743.4
Kwal_14.10425.94ON91292743.7
ZYRO0G15180g1.276ON68864734.0
Kpol_1050.635.94ON105881734.4
Kwal_23.57315.311ON62178734.7
AFR095C1.276ON67026717.6
Kpol_1059.298.637ON85881718.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0K00420
         (778 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON...  1386   0.0  
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...   933   0.0  
TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {O...   870   0.0  
KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.8...   866   0.0  
ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} simi...   866   0.0  
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...   850   0.0  
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...   819   0.0  
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...   818   0.0  
TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.8...   805   0.0  
Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277...   800   0.0  
YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}  FCP1Carbo...   798   0.0  
Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277...   797   0.0  
KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON...   788   0.0  
Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277...   758   0.0  
SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {...   747   0.0  
Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {...   703   0.0  
Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar...   702   0.0  
ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic ho...   689   0.0  
KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {...   673   0.0  
KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...   674   0.0  
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    46   2e-04
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    43   0.002
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     43   0.003
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    42   0.005
Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932...    42   0.007
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    40   0.016
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    40   0.021
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    40   0.022
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    39   0.040
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    39   0.042
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    38   0.093
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    38   0.12 
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    37   0.14 
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     37   0.14 
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    37   0.15 
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    37   0.15 
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    37   0.16 
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    37   0.17 
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    37   0.25 
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    36   0.38 
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    36   0.40 
KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.9...    36   0.40 
KLLA0E16655g Chr5 (1479322..1481292) [1971 bp, 656 aa] {ON} simi...    36   0.43 
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    36   0.47 
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    35   0.60 
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    35   0.62 
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    35   0.64 
NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5....    35   0.66 
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    35   0.73 
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    35   0.82 
NDAI0G05520 Chr7 complement(1356809..1359307) [2499 bp, 832 aa] ...    35   0.88 
KNAG0E00570 Chr5 (95945..98890) [2946 bp, 981 aa] {ON} Anc_5.94 ...    35   0.93 
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    35   1.0  
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...    35   1.1  
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    34   1.3  
KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} simila...    34   1.5  
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    34   1.5  
Ecym_4460 Chr4 (939029..941224) [2196 bp, 731 aa] {ON} similar t...    34   1.6  
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    34   1.7  
KNAG0B01830 Chr2 complement(341951..344209) [2259 bp, 752 aa] {O...    34   2.1  
TPHA0A05110 Chr1 (1149460..1152657) [3198 bp, 1065 aa] {ON} Anc_...    33   2.6  
SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some...    33   2.7  
SAKL0H20592g Chr8 complement(1805321..1806847) [1527 bp, 508 aa]...    33   3.2  
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    33   3.4  
TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5....    33   3.4  
Kwal_14.1042 s14 complement(168504..171242) [2739 bp, 912 aa] {O...    33   3.7  
ZYRO0G15180g Chr7 (1223984..1226050) [2067 bp, 688 aa] {ON} simi...    33   4.0  
Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON} (138...    33   4.4  
Kwal_23.5731 s23 complement(1296239..1298104) [1866 bp, 621 aa] ...    33   4.7  
AFR095C Chr6 complement(604687..606699) [2013 bp, 670 aa] {ON} S...    32   7.6  
Kpol_1059.29 s1059 complement(61291..63867) [2577 bp, 858 aa] {O...    32   8.6  

>NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON}
           Anc_8.839 YMR277W
          Length = 778

 Score = 1386 bits (3587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 687/778 (88%), Positives = 687/778 (88%)

Query: 1   MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEXXXXX 60
           MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELE     
Sbjct: 1   MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEDDNDN 60

Query: 61  XXXXXXXXXXXXXTINGNNVTNLTNRPSIEPISRNTITHAHXXXXXXTVRESIEFFDCPY 120
                        TINGNNVTNLTNRPSIEPISRNTITHAH      TVRESIEFFDCPY
Sbjct: 61  DNDNDPDGDVDKNTINGNNVTNLTNRPSIEPISRNTITHAHKKKKKKTVRESIEFFDCPY 120

Query: 121 DGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLSGPNLT 180
           DGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLSGPNLT
Sbjct: 121 DGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLSGPNLT 180

Query: 181 ISHTDTNLKISTREAVDIGQSVXXXXXXXXXXXXXXXXXQTVIHCGVDPTIGEWKRDPTN 240
           ISHTDTNLKISTREAVDIGQSV                 QTVIHCGVDPTIGEWKRDPTN
Sbjct: 181 ISHTDTNLKISTREAVDIGQSVKKRLRDDKKLILVVDLDQTVIHCGVDPTIGEWKRDPTN 240

Query: 241 PNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLFEMHIY 300
           PNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLFEMHIY
Sbjct: 241 PNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLFEMHIY 300

Query: 301 TMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDRGDV 360
           TMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDRGDV
Sbjct: 301 TMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDRGDV 360

Query: 361 WNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDLLTDI 420
           WNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDLLTDI
Sbjct: 361 WNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDLLTDI 420

Query: 421 MDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQKNR 480
           MDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQKNR
Sbjct: 421 MDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQKNR 480

Query: 481 PLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYIMPQ 540
           PLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYIMPQ
Sbjct: 481 PLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYIMPQ 540

Query: 541 MKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGTYKA 600
           MKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGTYKA
Sbjct: 541 MKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGTYKA 600

Query: 601 RLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERRIQLS 660
           RLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERRIQLS
Sbjct: 601 RLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERRIQLS 660

Query: 661 ELKDEGLYNKLPDGNIDINEVNLFAGGTSWLXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 720
           ELKDEGLYNKLPDGNIDINEVNLFAGGTSWL                             
Sbjct: 661 ELKDEGLYNKLPDGNIDINEVNLFAGGTSWLDEDEEIFEGDDDDDDDDDDDDDDDEDEDE 720

Query: 721 XNEGTKTSTSEKPMDDSTAEKDAKKNTKEAPXXXXXXXXXXXXXXXXXXXXLLNMLDD 778
            NEGTKTSTSEKPMDDSTAEKDAKKNTKEAP                    LLNMLDD
Sbjct: 721 DNEGTKTSTSEKPMDDSTAEKDAKKNTKEAPSEGASDDGDDDESGSEFEEELLNMLDD 778

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score =  933 bits (2412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/688 (67%), Positives = 535/688 (77%), Gaps = 56/688 (8%)

Query: 5   TVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEXXXXXXXXX 64
           T I AP+GLPYPITID+L+  +G E+ K DRLLAYKFW+VV++A+SPD+           
Sbjct: 3   TQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFVVDVASSPDD----------- 51

Query: 65  XXXXXXXXXTINGNNVTNLTNRPSIEPISRNTITHAHXXXXXXTVRESIEFFDCPYDGIL 124
                            ++++ P+                   ++RESIEFF+ PY G L
Sbjct: 52  ----------------NDVSSPPT---------------AGKKSIRESIEFFESPYKGQL 80

Query: 125 TSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDID-DLSGPNLTISH 183
            SW V+ GD+I  PNQ L EI RPCNHDV+YGGLCTLCG+EVDE+D D   SG NLTISH
Sbjct: 81  ISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCGEEVDEDDNDASGSGANLTISH 140

Query: 184 TDTNLKISTREAVDIGQSVXXXXXXXXXXXXXXXXXQTVIHCGVDPTIGEWKRDPTNPNF 243
           TDTNLKISTREA+DIG +V                 QTVIHCGVDPTIGEWK DP NPNF
Sbjct: 141 TDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQTVIHCGVDPTIGEWKNDPKNPNF 200

Query: 244 ETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLFEMHIYTMA 303
           ETLKDVK+F+LEEEPILP +YMGPKPP RKCWYYVKVRPGLK+F +K+APLFEMHIYTMA
Sbjct: 201 ETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMA 260

Query: 304 TRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDRGDVWNW 363
           TRAYASEIAKIIDP GDLFG+RILSRDENGS+TTKSLERLFPTDQSMVI+IDDRGDVWNW
Sbjct: 261 TRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSLERLFPTDQSMVIVIDDRGDVWNW 320

Query: 364 SPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDLLTDIMDT 423
           SPNLIKV+PYNFFVGVGDINSNFLPKQQATMLQLGRR     S+  +K+ +DLL DIMD+
Sbjct: 321 SPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRR-----SREKSKDTEDLLIDIMDS 375

Query: 424 EKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQKNRPLA 483
           EK L+ KI++EVKRQEE+L+HQ AT EEPPT+AGENKEEISKKIEYSASLEVQQ+NRPLA
Sbjct: 376 EKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEISKKIEYSASLEVQQQNRPLA 435

Query: 484 TLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYIMPQMKQ 543
            LQKHFHDQRLLIDDD+ELYHLKDTL +IH KYY +L+K  E    ++ DIK IMP MKQ
Sbjct: 436 ALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKDGE----LKADIKLIMPAMKQ 491

Query: 544 TVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGTYKARLA 603
            VL +C FVFSGLIPLGT+IQ++DIVIWTN FGA ST+DIDE TTHVITKTPGTYKARLA
Sbjct: 492 NVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTTHVITKTPGTYKARLA 551

Query: 604 KSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERRIQLSELK 663
           KS++P IKI+HPDWVFECL  WKHV+EKPYEL+VEQ VS+ EL +F +KL +R QL    
Sbjct: 552 KSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELEEFKKKLAKR-QLLATA 610

Query: 664 DEGLYNKLPDGNIDINEVNLFAGGTSWL 691
           +E L    P    +  E+ LF+GG SWL
Sbjct: 611 NENLS---PANGTNSAELELFSGGMSWL 635

>TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {ON}
           Anc_8.839 YMR277W
          Length = 713

 Score =  870 bits (2248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/692 (61%), Positives = 522/692 (75%), Gaps = 68/692 (9%)

Query: 1   MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEXXXXX 60
           M TP  + +P  LPYPITID+L+ PIG+ + K  RL A+KFWY+VEIA+SPDE E     
Sbjct: 1   MTTP--VFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENE----- 53

Query: 61  XXXXXXXXXXXXXTINGNNVTNLTNRPSIEPISRNTITHAHXXXXXXTVRESIEFFDCPY 120
                           G+                             TVRESIEFF+ P+
Sbjct: 54  ---------------GGHR--------------------------KKTVRESIEFFEAPF 72

Query: 121 DGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLSGPNLT 180
           +G L SW V+ GD++V PNQ +CEI RPCNHD++YGGLCTLCGKEVDE++    +G NL 
Sbjct: 73  EGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGKEVDESE--QFNG-NLA 129

Query: 181 ISHTDTNLKISTREAVDIGQSVXXXXXXXXXXXXXXXXXQTVIHCGVDPTIGEWKRDPTN 240
           ISHTD NLK+S +EA DI  ++                 QTVIHCGVDPTIGEWKRD +N
Sbjct: 130 ISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIHCGVDPTIGEWKRDSSN 189

Query: 241 PNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLFEMHIY 300
           PN+E LKDV+ FAL+EEPILPL+YMGPKPP RKCWYYVKVRPGLK+FF KVAPLFEMHIY
Sbjct: 190 PNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIY 249

Query: 301 TMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDRGDV 360
           TMATRAYA EIAKIIDP G LFG+RILSRDENGS+T KSLERLFPTDQSMV++IDDRGDV
Sbjct: 250 TMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERLFPTDQSMVVVIDDRGDV 309

Query: 361 WNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDLLTDI 420
           WNW PNLIKV+PYNFFVGVGDINSNFLP+QQ TMLQLGR + +      T+E+D+L+TDI
Sbjct: 310 WNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARK-----KTQESDELITDI 364

Query: 421 MDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQKNR 480
           MDTEK LQ KI+EEVKRQEEKLNHQ+A+ EE P  A E+K++++KK+EYSASLEVQQ+NR
Sbjct: 365 MDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVP--APESKDQLAKKLEYSASLEVQQQNR 422

Query: 481 PLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYIMPQ 540
           PLATLQKH H+QRLL+DDD+EL +L++ L+K+H +YY+ L + +E K     DIK ++P 
Sbjct: 423 PLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDSEKK----ADIKTLLPL 478

Query: 541 MKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGTYKA 600
           MK  V +DCHFVFSGLIPLGTNI ++DIV+WTNMFGA+S+ +ID++TTHVIT+TPGTYKA
Sbjct: 479 MKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRTPGTYKA 538

Query: 601 RLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERRIQ-L 659
           R+AK+++ +IK+VHPDWVFECL+ WKHV+EKPYEL+VEQ  +D+EL D+ +KL RR   L
Sbjct: 539 RIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQKLARRSSAL 598

Query: 660 SELKDEGLYNKLPDGNIDINEVNLFAGGTSWL 691
           +E + E       +G I     NLFAGGTSWL
Sbjct: 599 AEQEMELAMESAKNGTI-----NLFAGGTSWL 625

>KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.839
           YMR277W
          Length = 724

 Score =  866 bits (2237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/694 (62%), Positives = 522/694 (75%), Gaps = 56/694 (8%)

Query: 1   MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEXXXXX 60
           M TP +  AP GLPYPITIDEL+ PIGT + K  RL AYKFWY+VEIA+SPD+       
Sbjct: 1   MTTPVL--APEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDD------- 51

Query: 61  XXXXXXXXXXXXXTINGNNVTNLTNRPSIEPISRNTITHAHXXXXXXTVRESIEFFDCPY 120
                                   N P+      NT T A        +RESIEFFD P+
Sbjct: 52  ------------------------NDPA------NTDTQA--SHPKKKIRESIEFFDAPF 79

Query: 121 DGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLSGPNLT 180
           +G L SW ++ GD++   +Q +CEI+RPCNHD++YGGLCT CGKEVDE++     G N T
Sbjct: 80  EGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQCGKEVDESEQSQF-GSNFT 138

Query: 181 ISHTDTNLKISTREAVDIGQSVXXXXXXXXXXXXXXXXXQTVIHCGVDPTIGEWKRDPTN 240
           +SHTDTNLKIS +EA+DIG+                   QTVIHCGVDPTIGEWK DP N
Sbjct: 139 VSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDLDQTVIHCGVDPTIGEWKSDPNN 198

Query: 241 PNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLFEMHIY 300
           PN++TLKDV+ FALEEEP+LP MYMGPKP  RKCWYYVKVRPGLK+FF+KVAPLFEMHIY
Sbjct: 199 PNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYYVKVRPGLKEFFKKVAPLFEMHIY 258

Query: 301 TMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDRGDV 360
           TMATRAYA EI KIIDPTG+LFGNRILSRDENGSLT+KSLERLFPTDQSMVIIIDDRGDV
Sbjct: 259 TMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSKSLERLFPTDQSMVIIIDDRGDV 318

Query: 361 WNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDLLTDI 420
           WNWSPNLIKV+PY+FFVGVGDINSNFLPKQQ TMLQLGRR     S+   KE D+LLTDI
Sbjct: 319 WNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGRR-----SREKAKEADELLTDI 373

Query: 421 MDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQKNR 480
           MDTEK LQ KI+EEVKRQE+ L+HQ+   EE  + + E KEE +KK+E+SAS+EVQQ+NR
Sbjct: 374 MDTEKKLQEKIDEEVKRQEKNLSHQVVPTEE--SVSNETKEEWTKKLEHSASVEVQQQNR 431

Query: 481 PLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYIMPQ 540
           PLA LQ+H H+QRLLIDDD+ELY LKDTL+K+H++YY +L+  N++ D    DIK IMP+
Sbjct: 432 PLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILE--NKSLDESGADIKLIMPK 489

Query: 541 MKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGTYKA 600
           +KQ+V + CHFVFSGLIPL T+I+++DIV+WT+MFGA S+++I+E TTHVITKTPGT+KA
Sbjct: 490 LKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEVTTHVITKTPGTFKA 549

Query: 601 RLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERRIQLS 660
           RLAKS++ DIKIVHPDWVFECL+RW HV+EKPY L+VE+ +SD+EL  F   L  R +L+
Sbjct: 550 RLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDRELKKFREDLNNR-KLT 608

Query: 661 ELKDE---GLYNKLPDGNIDINEVNLFAGGTSWL 691
           E  +E   G        N D N V+LFA GTSWL
Sbjct: 609 ERNNEQNSGDITGTIVENFD-NTVDLFATGTSWL 641

>ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277W FCP1
           Carboxy-terminal domain (CTD) phosphatase
          Length = 764

 Score =  866 bits (2238), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/691 (60%), Positives = 521/691 (75%), Gaps = 58/691 (8%)

Query: 1   MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEXXXXX 60
           MATP +  AP  LPYPITID+L+ PIG+ + K  RL AYKFWY+VEIA+SPDE       
Sbjct: 1   MATPVI--APESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDE------- 51

Query: 61  XXXXXXXXXXXXXTINGNNVTNLTNRPSIEPISRNTITHAHXXXXXXTVRESIEFFDCPY 120
                          +GN     + +                     TVRESIEFF+ P+
Sbjct: 52  --------------NDGNGGAQHSKK---------------------TVRESIEFFESPF 76

Query: 121 DGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLSGPNLT 180
           +G L SW V++GD++    Q +CEI RPCNHDV+YGGLCT+CGKEVDEND  +    NL 
Sbjct: 77  EGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGKEVDENDQME---ANLA 133

Query: 181 ISHTDTNLKISTREAVDIGQSVXXXXXXXXXXXXXXXXXQTVIHCGVDPTIGEWKRDPTN 240
           ISHTDTNLK+S +EA D+   +                 QTVIHCGVDPTIGEWK+DP+N
Sbjct: 134 ISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQTVIHCGVDPTIGEWKKDPSN 193

Query: 241 PNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLFEMHIY 300
           PN+ETLKDV+ F+LEEEPI+P MYMGP+ P RKCWY+VKVRPGL++FF ++APL+EMHIY
Sbjct: 194 PNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVRPGLREFFAQLAPLYEMHIY 253

Query: 301 TMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDRGDV 360
           TMATR YA EIAKIIDP G LFG+RILSRDENGSLT KSLERLFPTDQSMVI+IDDRGDV
Sbjct: 254 TMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSLERLFPTDQSMVIVIDDRGDV 313

Query: 361 WNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDLLTDI 420
           WNW PNLIKV+PYNFFVGVGDINSNFLP+QQ+ +LQLGRR+ +       +E+D+LLTDI
Sbjct: 314 WNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRRTHK-----KPQESDELLTDI 368

Query: 421 MDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQKNR 480
           MDTEK LQ KI+EEVKRQEEKL+HQL T +EP    GE+KE+++KK+EYSASLEVQQ+NR
Sbjct: 369 MDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEP--VQGESKEQLTKKLEYSASLEVQQQNR 426

Query: 481 PLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYIMPQ 540
           PLATLQKH H+QRLL+DDD+ELY+LKDTL+KIH KYY++L + NEN      DI+ ++P 
Sbjct: 427 PLATLQKHMHNQRLLVDDDDELYYLKDTLAKIHRKYYKLLDEGNENS----ADIQSLVPT 482

Query: 541 MKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGTYKA 600
           MK  V +DC+FVFSGLIPLGTNI+++DIV+WT MFGA ++++IDENTTHVITKTPGTYKA
Sbjct: 483 MKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVITKTPGTYKA 542

Query: 601 RLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERRIQLS 660
           R+AK ++ ++K+VHPDWVFECL+ W HV+EKPYEL+++   +++E+ DF RK+E+R  + 
Sbjct: 543 RIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFKRKIEQRHLIE 602

Query: 661 ELKDEGLYNKLPDGNIDINEVNLFAGGTSWL 691
           E + E   ++        + +NLFAGGTSWL
Sbjct: 603 EQRREQFESEALMKTAQDSTLNLFAGGTSWL 633

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score =  850 bits (2196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/646 (63%), Positives = 502/646 (77%), Gaps = 54/646 (8%)

Query: 1   MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEXXXXX 60
           M+TP +   P+GLPYPIT+DELM PIG+ + K  RL AYKFWY+VEIA SPD+       
Sbjct: 1   MSTPVL--TPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDD------- 51

Query: 61  XXXXXXXXXXXXXTINGNNVTNLTNRPSIEPISRNTITHAHXXXXXXTVRESIEFFDCPY 120
                            N++      P IE   R              VRESIEF++ P+
Sbjct: 52  -----------------NDID--YEGPEIEKSKRK-------------VRESIEFYEAPF 79

Query: 121 DGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLSGPNLT 180
           +G L SW V++ D+I GPN  +CEI+RPCNHD++YGGLCT+CGKEVDE D  D    NLT
Sbjct: 80  EGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTMCGKEVDEYDQVD---ANLT 136

Query: 181 ISHTDTNLKISTREAVDIGQSVXXXXXXXXXXXXXXXXXQTVIHCGVDPTIGEWKRDPTN 240
           ISHTDTNL++S +EA+D+ + +                 QTVIHCGVDPTIGEWK DP+N
Sbjct: 137 ISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDLDQTVIHCGVDPTIGEWKADPSN 196

Query: 241 PNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLFEMHIY 300
           PN+ETLKDVK F+LEEEPILPL+YMGPKPP R CWYYVK+RPGLK+FF+K+APL+EMHIY
Sbjct: 197 PNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYVKIRPGLKEFFEKIAPLYEMHIY 256

Query: 301 TMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDRGDV 360
           TMATRAYA EIAKIIDP   LFG+RILSRDENGSLT KSL RLFPTDQSMV++IDDRGDV
Sbjct: 257 TMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQKSLTRLFPTDQSMVVVIDDRGDV 316

Query: 361 WNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDLLTDI 420
           WNW PNLIKV+PYNFFVGVGDINSNFLPKQQ TMLQLGRR+ +       KE+++LLTDI
Sbjct: 317 WNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLGRRTRQ-----KIKESEELLTDI 371

Query: 421 MDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQKNR 480
           MDTEK LQ KI+EEVKRQEEKLNHQ+AT EE  +T  E+KE+I+KK+E+SASLEVQQ+NR
Sbjct: 372 MDTEKKLQEKIDEEVKRQEEKLNHQMATAEE--STDQESKEKIAKKLEFSASLEVQQQNR 429

Query: 481 PLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYIMPQ 540
           PLA LQKH HDQRLLIDDD+EL++LKDTL+ IH ++Y +L+ A+   D  E DI  ++P+
Sbjct: 430 PLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLEDAS---DQNEADITMLLPK 486

Query: 541 MKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGTYKA 600
           +K+ V ++CHFVFSGLIPLGT+I+++DIVIWT++FGA ST+DIDE+TTHV+TKTPGTYKA
Sbjct: 487 LKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHVVTKTPGTYKA 546

Query: 601 RLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKEL 646
           RLAK+++PDIK+VHPDW+FECL  WK ++EKPY L+VEQ VS+ EL
Sbjct: 547 RLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSEDEL 592

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score =  819 bits (2115), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/695 (58%), Positives = 507/695 (72%), Gaps = 54/695 (7%)

Query: 1   MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEXXXXX 60
           MATP  ++ P G+PYPITI +L+ P+G+ +NK DRL AYKFWY+VEIA SPDEL+     
Sbjct: 1   MATP--VKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELD----- 53

Query: 61  XXXXXXXXXXXXXTINGNNVTNLTNRPSIEPISRNTITHAHXXXXXXTVRESIEFFDCPY 120
                         +NGN      ++                     T+RESI+FFD P+
Sbjct: 54  --------------VNGNVQDGEQSK--------------------KTIRESIDFFDAPF 79

Query: 121 DGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLSGPNLT 180
           +G +  W V+ GD+IV P + +CE++RPC+HD++Y G+CT+CGKEVDE D       NLT
Sbjct: 80  EGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTMCGKEVDERD---QVSANLT 136

Query: 181 ISHTDTNLKISTREAVDIGQSVXXXXXXXXXXXXXXXXXQTVIHCGVDPTIGEWKRDPTN 240
           ISHTDTNLK+S +EA +IGQ+                  QTVIHCGVDPTI EWK DP+N
Sbjct: 137 ISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSN 196

Query: 241 PNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLFEMHIY 300
           PN+ETL++VK F LEEE ILP MYMGPKPP  KC YYVKVRPGLK+FF+KVAP++EMHIY
Sbjct: 197 PNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIY 256

Query: 301 TMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDRGDV 360
           TMATRAYA EIAKIIDP G LFGNRILSRDENGSLT KSLERLFPTDQSMV+IIDDRGDV
Sbjct: 257 TMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDV 316

Query: 361 WNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDLLTDI 420
           WNWSPNLIKV PYNFFVG+GDINSNFLP+QQATMLQ+GRR+   E +  ++E    LTDI
Sbjct: 317 WNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNHNAEKEKESEEL---LTDI 373

Query: 421 MDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQKNR 480
           +DTEK LQ KI++EVKRQE  L H+ A + E       N  +I+KKIE+SASLEVQQ+NR
Sbjct: 374 IDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNG-DITKKIEFSASLEVQQQNR 432

Query: 481 PLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYIMPQ 540
           PLA LQKH H+Q+LL DDD+EL +LK+ L+ + S++Y+ L+  N N D  +  I+ +MP+
Sbjct: 433 PLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGNSD--DTSIQELMPK 490

Query: 541 MKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGTYKA 600
           +K++V +DC+FVFSGLIPLGT+IQK+DIV+WT MFGA ST++I ENTTHVITKTPGT KA
Sbjct: 491 LKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHVITKTPGTLKA 550

Query: 601 RLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERRIQLS 660
           R+AKS++P IK+VHPDWVFECL  WKHV+EK +EL V+Q+ S++EL +F + LE+R +  
Sbjct: 551 RIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASERELEEFKKNLEKRNKNK 610

Query: 661 ELKDEGLYNKLPDGNIDI----NEVNLFAGGTSWL 691
                     L +G   +    N V+LFAGG+SWL
Sbjct: 611 LTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWL 645

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score =  818 bits (2112), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/699 (59%), Positives = 499/699 (71%), Gaps = 70/699 (10%)

Query: 1   MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEXXXXX 60
           M+TP  + APLGLPYPITI +L+  IG+ + K  RL AYKFWY+VEIA SPDE       
Sbjct: 1   MSTP--VSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDE------- 51

Query: 61  XXXXXXXXXXXXXTINGNNVTNLTNRPSIEPISRNTITHAHXXXXXXTVRESIEFFDCPY 120
                          N + V +  ++ SI                    RESIEFFD P+
Sbjct: 52  ---------------NDDGVNDEHSKKSI--------------------RESIEFFDSPF 76

Query: 121 DGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLSGPNLT 180
           +G L SW V+ GD+IV PNQ +CEI RPCNHD++Y G+CT+CGKEVDE+D       NLT
Sbjct: 77  EGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCGKEVDESD---QVSANLT 133

Query: 181 ISHTDTNLKISTREAVDIGQSVXXXXXXXXXXXXXXXXXQTVIHCGVDPTIGEWKRDPTN 240
           ISHTDTNLK+S REA DIGQ +                 QTVIHCGVDPTI EWK DPTN
Sbjct: 134 ISHTDTNLKVSRREANDIGQGIKKRLIREKKLILVVDLDQTVIHCGVDPTIAEWKNDPTN 193

Query: 241 PNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLFEMHIY 300
           PNFETL+DVK F LEEEPILP MYMGPKPP  KCWYYVK+RPGLK+FF++V+ L+EMHIY
Sbjct: 194 PNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIRPGLKEFFEEVSKLYEMHIY 253

Query: 301 TMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDRGDV 360
           TMATR+YA EIAKIIDP G LF +RILSR+ENGSLT KSLERLFPTDQSMV++IDDRGDV
Sbjct: 254 TMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSLERLFPTDQSMVVVIDDRGDV 313

Query: 361 WNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDLLTDI 420
           WNW PNLIKV PYNFFVG+GDINSNFLP+QQ TMLQLGRR+ +      T++ D+LLTDI
Sbjct: 314 WNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRRNHK-----KTEDTDELLTDI 368

Query: 421 MDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQKNR 480
           MDTEK LQ KI+EEVKRQEE L+HQ A + E   ++   KE+I+KKIE+SASLEVQQ+NR
Sbjct: 369 MDTEKKLQEKIDEEVKRQEENLSHQSAALGE-EISSQVRKEDITKKIEFSASLEVQQQNR 427

Query: 481 PLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYIMPQ 540
           PLA LQKH H+Q+LL DDD+EL++LKD L  +  KYYE L      K   E  I+ +MP+
Sbjct: 428 PLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEEL------KTDKEIQIQTLMPK 481

Query: 541 MKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGTYKA 600
           +K+ VL+ C+FVFSGLIPLGTNIQK+DIV+WTNMFGA+S+ADI E+TTHVITKTP TYKA
Sbjct: 482 LKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHVITKTPHTYKA 541

Query: 601 RLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKL------- 653
           ++AK++  DIK++HPDWVFECL+ WK++ E PYE  +    +DKEL +F   L       
Sbjct: 542 KIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIPTATDKELNEFKEALERRKKKE 601

Query: 654 -ERRIQLSELKDEGLYNKLPDGNIDINEVNLFAGGTSWL 691
            + +I +SE   EG  N           V+LFA G SWL
Sbjct: 602 TKTKITVSEESLEGDSNSPSSQGA---SVDLFASGASWL 637

>TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.839
           YMR277W
          Length = 768

 Score =  805 bits (2078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/715 (58%), Positives = 510/715 (71%), Gaps = 65/715 (9%)

Query: 1   MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEXXXXX 60
           M+TP +  +P  LP+PITID+L+ PIG+ + K  RL AYKFWY+VEIA SPD        
Sbjct: 1   MSTPVL--SPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDN------- 51

Query: 61  XXXXXXXXXXXXXTINGNNVTNLTNRPSIEPISRNTITHAHXXXXXXTVRESIEFFDCPY 120
                         ++GNN  +  N         N  +H        ++RESIEFF+ P+
Sbjct: 52  ----NDPTSENSSDLSGNNSDSNENG--------NNASHQKK-----SIRESIEFFESPF 94

Query: 121 DGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLSGPNLT 180
           +G L  W V+KGD+I+  NQ LC+I+RPCNHD++Y G+CT CGKEVD++DI D S   L+
Sbjct: 95  EGDLIGWNVDKGDEIISENQLLCDIKRPCNHDIVYAGICTQCGKEVDDSDIMDAS---LS 151

Query: 181 ISHTDTNLKISTREAVDIGQSVXXXXXXXXXXXXXXXXXQTVIHCGVDPTIGEWKRDPTN 240
           ISHTDTNLKIS +EA DI QS                  QTVIHCGVDPTIGEWK DP N
Sbjct: 152 ISHTDTNLKISRKEARDIDQSSMSRLKKIKKLILVVDLDQTVIHCGVDPTIGEWKNDPKN 211

Query: 241 PNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLFEMHIY 300
           PN+ETLKDV+ F+L+EEPILP  YMGP+PP RKCWYYVKVRPGLK+FF K+APL+EMHIY
Sbjct: 212 PNYETLKDVRSFSLDEEPILPPSYMGPRPPVRKCWYYVKVRPGLKEFFAKIAPLYEMHIY 271

Query: 301 TMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDRGDV 360
           TMATRAYA EIAKIIDP G LFG+RILSRDENGSLT KSLERLFPTDQSMVIIIDDRGDV
Sbjct: 272 TMATRAYALEIAKIIDPDGSLFGSRILSRDENGSLTQKSLERLFPTDQSMVIIIDDRGDV 331

Query: 361 WNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRS--------------SRGES 406
           WNW  NLIKVIPYNFFVG+GDINSNFLP+QQ+TMLQLG RS               + +S
Sbjct: 332 WNWCNNLIKVIPYNFFVGIGDINSNFLPRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDS 391

Query: 407 KVSTKEND---DLLTDIMDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEI 463
            +S  E D   +LLTDIMDTEK LQ+KI+EEV+RQE+KL        +  +    N  E+
Sbjct: 392 TLSVHEKDKTEELLTDIMDTEKKLQKKIDEEVRRQEKKLIKDEMPKRKSISDESSNN-EL 450

Query: 464 SKKIEYSASLEVQQKNRPLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKA 523
           SKKIE+SASLEVQQ+NRPLATLQ+H  +QRLLIDDD+EL++LKD L+++H  +YE L   
Sbjct: 451 SKKIEFSASLEVQQQNRPLATLQRHRQNQRLLIDDDDELFYLKDILTEVHDTFYEQL--- 507

Query: 524 NENKDSIEPDIKYIMPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADI 583
           +E+K+     I+ +MP++K +V    +FVFSGLIPLGT+I+++DIV+WTNMFGA STADI
Sbjct: 508 DEDKNE-SVSIQTLMPRLKFSVFSGYNFVFSGLIPLGTDIRRADIVLWTNMFGANSTADI 566

Query: 584 DENTTHVITKTPGTYKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVS- 642
           DENTTHVITKT GTYKARLAK+++P+IK+VHPDW+FECL+ WK + EKPYEL++EQ  S 
Sbjct: 567 DENTTHVITKTAGTYKARLAKAFNPEIKVVHPDWIFECLVSWKRMPEKPYELIIEQPASE 626

Query: 643 ------DKELADFNRKLERRIQLSELKDEGLYNKLPDGNIDINEVNLFAGGTSWL 691
                  K+L   N  LE+R   +E + E L  + P        ++LFA GTSWL
Sbjct: 627 EELEEFKKKLELKNELLEKREMETEAQFEALNTRDP-------AIDLFASGTSWL 674

>Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277W
           (REAL)
          Length = 734

 Score =  800 bits (2066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/693 (58%), Positives = 501/693 (72%), Gaps = 56/693 (8%)

Query: 5   TVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEXXXXXXXXX 64
           T IR+P GLPYPI ID+L+  +G+ +++ DRL+ YKFWY+VE A+               
Sbjct: 3   TQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASD-------------- 48

Query: 65  XXXXXXXXXTINGNNVTNLTNRPSIEPISRNTITHAHXXXXXXTVRESIEFFDCPYDGIL 124
                    T + +N  + T        S +  T          +RESIEFF+ PY+G L
Sbjct: 49  --------TTGDDDNEHDATPGGGAGSGSVSPPTKQ--------LRESIEFFESPYEGDL 92

Query: 125 TSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLSGPNLTISHT 184
            SW V+ GD+I   NQ +CEI+RPCNHD++YGGLCT CGKEV  +  D   G  L +   
Sbjct: 93  ISWNVDVGDEIATANQVICEIKRPCNHDIVYGGLCTQCGKEVSADAFD---GVPLDVV-G 148

Query: 185 DTNLKISTREAVDIGQSVXXXXXXXXXXXXXXXXXQTVIHCGVDPTIGEWKRDPTNPNFE 244
           D +L+IS  EA+  G+++                 QT+IHCGVDPTI EWK DP NPNFE
Sbjct: 149 DMDLQISETEAIRSGEALKEHLRRDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFE 208

Query: 245 TLKDVKEFALEEEPILPLMYMGPK------PPARKCWYYVKVRPGLKDFFQKVAPLFEMH 298
           TL+DVK F L+EE +LPLMYM         PP RKCWYYVKVRPGLK+FF KVAPLFEMH
Sbjct: 209 TLRDVKSFTLDEELVLPLMYMNEDGSVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMH 268

Query: 299 IYTMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDRG 358
           IYTMATRAYA +IAKI+DPTG+LFG+RILSRDENGSLTTKSL +LFPTDQSMV++IDDRG
Sbjct: 269 IYTMATRAYAIQIAKIVDPTGELFGDRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRG 328

Query: 359 DVWNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDLLT 418
           DVWNW PNLIKV+PYNFFVGVGDINSNFLPKQ   MLQLGR++ +      ++E+ +LLT
Sbjct: 329 DVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQSTGMLQLGRKTRQ-----KSQESQELLT 383

Query: 419 DIMDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQK 478
           DIMD EK LQ KI++EVKRQEEKLNHQLAT EEP  +A E+KEE++KK+EYSASLEVQQ+
Sbjct: 384 DIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEP--SANESKEELTKKLEYSASLEVQQQ 441

Query: 479 NRPLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYIM 538
           NRPLA LQKH HDQ+LL+DDD+ELY+L  TLS IH+ YY+M+ ++NE     EP++  I+
Sbjct: 442 NRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHNTYYQMISQSNEP----EPNLMEII 497

Query: 539 PQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGTY 598
           P +KQ V Q+CHFVFSGLIPLGT+IQ+SDIVIWT+ FGA ST+DID  TTH+ITK P TY
Sbjct: 498 PSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSDIDYLTTHLITKNPSTY 557

Query: 599 KARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERRIQ 658
           KARLAK ++P+IKI+HPDW+FECL+ WK V+EKPY L+V+  +SD+EL +F ++L++R +
Sbjct: 558 KARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLIVDSPISDEELQNFQKQLQKRQE 617

Query: 659 LSELKDEGLYNKLPDGNIDINEVNLFAGGTSWL 691
             E   +  +   P  N+     NLFA GTSWL
Sbjct: 618 YLEENQQQQHMLTPQENL-----NLFAAGTSWL 645

>YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}
           FCP1Carboxy-terminal domain (CTD) phosphatase, essential
           for dephosphorylation of the repeated C-terminal domain
           of the RNA polymerase II large subunit (Rpo21p)
          Length = 732

 Score =  798 bits (2062), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/695 (58%), Positives = 498/695 (71%), Gaps = 61/695 (8%)

Query: 5   TVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIA--TSPDELEXXXXXXX 62
           T IR+P GLPYPI ID+L+  +G+ +++ DRLL YKFWY+VE A  T  D+ E       
Sbjct: 3   TQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDV---- 58

Query: 63  XXXXXXXXXXXTINGNNVTNLTNRPSIEPISRNTITHAHXXXXXXTVRESIEFFDCPYDG 122
                      +  G+  +N  + P+ +                  +RESIEFF+ PY+G
Sbjct: 59  -----------SPGGSAGSNGVSPPTKQ------------------LRESIEFFESPYEG 89

Query: 123 ILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLSGPNLTIS 182
            L SW V+ GD++   NQ +CEI+RPCNHD++YGGLCT CGKEV  +  D   G  L + 
Sbjct: 90  DLISWNVDVGDEVATANQVICEIKRPCNHDIVYGGLCTQCGKEVSADAFD---GVPLDVV 146

Query: 183 HTDTNLKISTREAVDIGQSVXXXXXXXXXXXXXXXXXQTVIHCGVDPTIGEWKRDPTNPN 242
             D +L+IS  EA+  G+++                 QT+IHCGVDPTI EWK DP NPN
Sbjct: 147 -GDVDLQISETEAIRTGKALKEHLRRDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPN 205

Query: 243 FETLKDVKEFALEEEPILPLMYMGPK------PPARKCWYYVKVRPGLKDFFQKVAPLFE 296
           FETL+DVK F L+EE +LPLMYM         PP RKCWYYVKVRPGLK+FF KVAPLFE
Sbjct: 206 FETLRDVKSFTLDEELVLPLMYMNDDGSMLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFE 265

Query: 297 MHIYTMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDD 356
           MHIYTMATRAYA +IAKI+DPTG+LFG+RILSRDENGSLTTKSL +LFPTDQSMV++IDD
Sbjct: 266 MHIYTMATRAYALQIAKIVDPTGELFGDRILSRDENGSLTTKSLAKLFPTDQSMVVVIDD 325

Query: 357 RGDVWNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDL 416
           RGDVWNW PNLIKV+PYNFFVGVGDINSNFLPKQ   MLQLGR++ +      ++E+ +L
Sbjct: 326 RGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQSTGMLQLGRKTRQ-----KSQESQEL 380

Query: 417 LTDIMDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQ 476
           LTDIMD EK LQ KI++EVKRQEEKLNHQLAT EEPP  A E+KEE++KK+EYSASLEVQ
Sbjct: 381 LTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPP--ANESKEELTKKLEYSASLEVQ 438

Query: 477 QKNRPLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKY 536
           Q+NRPLA LQKH HDQ+LL+DDD+ELY+L  TLS IH  YY+ML + NE     EP++  
Sbjct: 439 QQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHKTYYDMLSQQNEP----EPNLME 494

Query: 537 IMPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPG 596
           I+P +KQ V Q+C+FVFSGLIPLGT+IQ+SDIVIWT+ FGA ST DID  TTH+ITK P 
Sbjct: 495 IIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTPDIDYLTTHLITKNPS 554

Query: 597 TYKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERR 656
           TYKARLAK ++P IKIVHPDW+FECL+ WK V+EKPY L+V+  +SD+EL +F  +L++R
Sbjct: 555 TYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPISDEELQNFQTQLQKR 614

Query: 657 IQLSELKDEGLYNKLPDGNIDINEVNLFAGGTSWL 691
            +  E   E  +      N+     NLFA GTSWL
Sbjct: 615 QEYLEETQEQQHMLTSQENL-----NLFAAGTSWL 644

>Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/695 (58%), Positives = 497/695 (71%), Gaps = 61/695 (8%)

Query: 5   TVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIA--TSPDELEXXXXXXX 62
           T IR+P GLPYPI ID+L+  +G+ +++ DRLL YKFWY+VE A  T  D+ E       
Sbjct: 3   TQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDA---- 58

Query: 63  XXXXXXXXXXXTINGNNVTNLTNRPSIEPISRNTITHAHXXXXXXTVRESIEFFDCPYDG 122
                      +  G   +N  + P+ +                  +RESIEFF+ PY+G
Sbjct: 59  -----------SPGGGAGSNGVSPPTKQ------------------LRESIEFFESPYEG 89

Query: 123 ILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLSGPNLTIS 182
            L SW V+ GD++   NQ +CEI+RPCNHD++YGGLCT CGKEV  +  D   G  L + 
Sbjct: 90  DLISWNVDVGDEVATANQVICEIKRPCNHDIVYGGLCTQCGKEVSADAFD---GVPLDVV 146

Query: 183 HTDTNLKISTREAVDIGQSVXXXXXXXXXXXXXXXXXQTVIHCGVDPTIGEWKRDPTNPN 242
             D +L+IS  EA+  G+++                 QT+IHCGVDPTI EWK DP NPN
Sbjct: 147 -GDMDLQISETEAIRTGKALKEHLRRDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPN 205

Query: 243 FETLKDVKEFALEEEPILPLMYMGPK------PPARKCWYYVKVRPGLKDFFQKVAPLFE 296
           FETL+DVK F L+EE +LPLMYM         PP RKCWYYVKVRPGLK+FF KVAPLFE
Sbjct: 206 FETLRDVKSFTLDEELVLPLMYMNEDGSVLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFE 265

Query: 297 MHIYTMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDD 356
           MHIYTMATRAYA +IAKI+DPTG LFG+RILSRDENGSLTTKSL +LFPTDQSMV++IDD
Sbjct: 266 MHIYTMATRAYALQIAKIVDPTGKLFGDRILSRDENGSLTTKSLAKLFPTDQSMVVVIDD 325

Query: 357 RGDVWNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDL 416
           RGDVWNW PNLIKV+PYNFFVGVGDINSNFLPKQ   MLQLGR++ +      ++E+ +L
Sbjct: 326 RGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQSTGMLQLGRKTRQ-----KSQESQEL 380

Query: 417 LTDIMDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQ 476
           LTDIMD EK LQ KI++EVKRQEEKLNHQLAT EEPP  A E+KEE++KK+EYSASLEVQ
Sbjct: 381 LTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPP--ANESKEELTKKLEYSASLEVQ 438

Query: 477 QKNRPLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKY 536
           Q+NRPLA LQKH HDQ+LL+DDD+ELY+L  TLS IH  YY+ML + NE     EP++  
Sbjct: 439 QQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHMTYYQMLSQENEP----EPNLME 494

Query: 537 IMPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPG 596
           I+P +KQ V Q+C FVFSGLIPLGT+IQ+SDIVIWT+ FGA ST+DID  TTH+ITK P 
Sbjct: 495 IIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSDIDFLTTHLITKNPS 554

Query: 597 TYKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERR 656
           TYKARLAK ++P+IKIVHPDW+FECL+ WK V+EKPY L+V+  +SD+EL +F  +L++R
Sbjct: 555 TYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPISDEELQNFQSQLQKR 614

Query: 657 IQLSELKDEGLYNKLPDGNIDINEVNLFAGGTSWL 691
            +  E   E  +      N+     NLFA GTSWL
Sbjct: 615 QEYLEENQEQQHMLTSQENL-----NLFATGTSWL 644

>KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON}
           Anc_8.839 YMR277W
          Length = 742

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/704 (56%), Positives = 495/704 (70%), Gaps = 60/704 (8%)

Query: 1   MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEXXXXX 60
           +  PT + +  GLPYP+T+DEL+  +G  +++ DRL AYKFWYVVE+A            
Sbjct: 3   LVAPTPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGV---------- 52

Query: 61  XXXXXXXXXXXXXTINGNNVTNLTNRPSIEPISRNTITHAHXXXXXXTVRESIEFFDCPY 120
                                      + E  S  T T A       +VRES+EFF+ P+
Sbjct: 53  -------------------------DAAAEGDSDGTGTTAKK-----SVRESVEFFESPF 82

Query: 121 DGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLS----- 175
           +G + SW V+ GD+I GP  PLC ++RPCNHDV+Y GLCTLCG+EVDE +I   +     
Sbjct: 83  EGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCGREVDEYEIQAAAAASGG 142

Query: 176 -GPNLTISHTDTNLKISTREAVDIGQSVXXXXXXXXXXXXXXXXXQTVIHCGVDPTIGEW 234
            GPNLT+SH DTNL+IS  EA  +   +                 QTV+HCGVDPTIGEW
Sbjct: 143 VGPNLTVSHRDTNLQISRVEAQQLDLQLQQRLRAAQKLVLVVDLDQTVVHCGVDPTIGEW 202

Query: 235 KRDPTNPNFETLKDVKEFALEEEPILPLMYMGPKPPA-RKCWYYVKVRPGLKDFFQKVAP 293
           KRDP NPN+E L+DV+ FALEEEPILP +Y+G K PA RKCWYYVKVRPGLK FF+++AP
Sbjct: 203 KRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWYYVKVRPGLKQFFKRLAP 262

Query: 294 LFEMHIYTMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVII 353
           LFEMHIYTMATRAYA EIAKIIDP   LFG+RILSRDENGSLT KSLERLFPTDQSMV +
Sbjct: 263 LFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTHKSLERLFPTDQSMVTV 322

Query: 354 IDDRGDVWNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKEN 413
           IDDRGDVWNW  NLIKV+PYNFFVGVGDINSNFLPKQQ TMLQ+GRRS   E    +K+ 
Sbjct: 323 IDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQMGRRSKLNERGHESKQQ 382

Query: 414 DD------LLTDIMDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKI 467
            D      LLTDIM+TEK LQ KI++EVKRQE KLN   A  +E   T G++KEE +KK+
Sbjct: 383 QDDVKDDLLLTDIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGDE-QQTPGQSKEEWTKKL 441

Query: 468 EYSASLEVQQKNRPLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENK 527
           E+SAS+EVQQKNRPLATLQKH H+Q+LL+D+D+EL++LKD L+ +H +YY  L++  ++ 
Sbjct: 442 EFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLADLHKRYYSTLKENPQDT 501

Query: 528 DSIEPDIKYIMPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENT 587
                +I+ IM Q+K  V QDCHFVFSGLIPL TN+Q +DIVIWTN FGA +T D+DE T
Sbjct: 502 -----NIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIWTNKFGATTTNDLDETT 556

Query: 588 THVITKTPGTYKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELA 647
           TH+ITKTPGT KARLAK+++PDIKIVHPDW+FECL++W+ V+ KPY L+VE  VS+ ++ 
Sbjct: 557 THLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPYLLIVEDPVSEAQVR 616

Query: 648 DFNRKLERRIQLSELKDEGLYNKLPDGNIDINEVNLFAGGTSWL 691
           +F  KL R+ + +E +       LP       +++LFAGG SWL
Sbjct: 617 EFKEKLTRQKERAE-RQTSRTALLPANKPAEPDIDLFAGGISWL 659

>Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/589 (62%), Positives = 454/589 (77%), Gaps = 26/589 (4%)

Query: 109 VRESIEFFDCPYDGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDE 168
           +RESIEFF+ PY+G L SW V+ GD+I   NQ +CEI+RPCNHD++YGGLCT CGKEV  
Sbjct: 75  LRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIVYGGLCTQCGKEVSA 134

Query: 169 NDIDDLSGPNLTISHTDTNLKISTREAVDIGQSVXXXXXXXXXXXXXXXXXQTVIHCGVD 228
           +  D   G  L +   D +L+IS  EA+  G+++                 QT+IHCGVD
Sbjct: 135 DAFD---GVPLDVV-GDMDLQISETEAIRTGRALKEHLRRDKKLILVVDLDQTIIHCGVD 190

Query: 229 PTIGEWKRDPTNPNFETLKDVKEFALEEEPILPLMYMG-----PKPP-ARKCWYYVKVRP 282
           PTI EWK DP NPNFETL+DVK F L+EE +LPLMYM      PKPP  RKCWYYVKVRP
Sbjct: 191 PTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPPPVRKCWYYVKVRP 250

Query: 283 GLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLER 342
           GLK+FF KVAPLFEMHIYTMATRAYA +IAKI+DPTG+LFG+RILSRDENGSLTTKSL +
Sbjct: 251 GLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDENGSLTTKSLAK 310

Query: 343 LFPTDQSMVIIIDDRGDVWNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSS 402
           LFPTDQSMV++IDDRGDVWNW PNLIKV+PYNFFVGVGDINSNFLPKQ   MLQLGR++ 
Sbjct: 311 LFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQSTGMLQLGRKTR 370

Query: 403 RGESKVSTKENDDLLTDIMDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEE 462
           +      ++E+ +L+TDIMD EK LQ KI+ EVKRQEE+LNHQLAT EEP  +A E+KEE
Sbjct: 371 Q-----KSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATAEEP--SANESKEE 423

Query: 463 ISKKIEYSASLEVQQKNRPLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQK 522
           ++KK+EYSASLEVQQ+NRPLA LQKH HDQ+LL+DDD+EL++L  TL  IH  YY+ML +
Sbjct: 424 LTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELHYLMSTLLNIHKTYYQMLSQ 483

Query: 523 ANENKDSIEPDIKYIMPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTAD 582
             E    IEP++  I+P +KQ V Q+C+FVFSGLIPLGT+IQ+SDIVIWT+ FGA ST+D
Sbjct: 484 PGE----IEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSD 539

Query: 583 IDENTTHVITKTPGTYKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVS 642
           I+  TTH+ITK PGTYKARLAK ++P+IK+VHPDW+FECL+ WK V+EKPY L+V+  +S
Sbjct: 540 INYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDSPIS 599

Query: 643 DKELADFNRKLERRIQLSELKDEGLYNKLPDGNIDINEVNLFAGGTSWL 691
           D EL  F ++L+++ +  +   E  +  +P  NI     NLFA GTSWL
Sbjct: 600 DDELQSFQKQLQKKQEYLDEHHEQQHMLMPQENI-----NLFAAGTSWL 643

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/42 (59%), Positives = 33/42 (78%)

Query: 5  TVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVE 46
          T IR+P GLPYPI ID+L+  +G+ + + DRLL YKFWY+VE
Sbjct: 3  TQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVE 44

>SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 688

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/690 (54%), Positives = 475/690 (68%), Gaps = 71/690 (10%)

Query: 5   TVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEXXXXXXXXX 64
           T ++ P  LPYPITI +L    G  + K  RL AYK+W   ++ TSP             
Sbjct: 3   TALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSP------------- 49

Query: 65  XXXXXXXXXTINGNNVTNLTNRPSIEPISRNTITHAHXXXXXXTVRESIEFFDCPYDGIL 124
                               N  S +P  +                + I  FD P +G L
Sbjct: 50  --------------------NDTSTKPKKQRV--------------DLIGTFDSPVEGAL 75

Query: 125 TSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDE---NDIDDLSGPNLTI 181
            S+ +  GD+ V  N  + EI++ C HDV YGGLC +CGK V+E   N   D S   LT+
Sbjct: 76  VSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGKSVEEYSSNSASDPSQNKLTM 135

Query: 182 SHTDTNLKISTREAVDIGQSVXXXXXXXXXXXXXXXXXQTVIHCGVDPTIGEWKRDPTNP 241
           SHT+TN+KIS R+A  I ++                  QTVIHCGVDPTIGEW RDP NP
Sbjct: 136 SHTNTNIKISERQAAAIEETAQKQLRKLKKLVLVVDLDQTVIHCGVDPTIGEWSRDPKNP 195

Query: 242 NFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLFEMHIYT 301
           N+E LKD+K FAL EEPILP  YMGPKPPARKCWYYVK+RPGLK+FF+K+AP FE+HIYT
Sbjct: 196 NYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYVKLRPGLKEFFEKIAPHFELHIYT 255

Query: 302 MATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDRGDVW 361
           MATRAYA EIAKIIDP G LFG+RILSRDENGS+T KSLERLFP DQSMV+IIDDRGDVW
Sbjct: 256 MATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLERLFPMDQSMVVIIDDRGDVW 315

Query: 362 NWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDLLTDIM 421
           NW  NLIKV+PY+FFVGVGDINSNFLP+QQ +ML LGRR  +        E ++LLTDI+
Sbjct: 316 NWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRRHRK------KAEEEELLTDIL 369

Query: 422 DTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQKNRP 481
           DTEK LQ KI+EEVKRQEEKL+ ++   ++P  T   +KE+++KK+E+SASLEVQQ+NRP
Sbjct: 370 DTEKKLQEKIDEEVKRQEEKLS-KMTEEKQPEDT--NSKEDLAKKLEHSASLEVQQQNRP 426

Query: 482 LATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYIMPQM 541
           LA LQKH H+Q+LLIDDD+EL HL   L ++H KYYE L     +K S  P+IK +MPQ+
Sbjct: 427 LAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDL-----SKHSSPPNIKNLMPQL 481

Query: 542 KQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGTYKAR 601
           K+ V   C FVFSGLIPLGT+++K+DI +WT+MFGA++TADIDE TTH+ITKTPGT+KAR
Sbjct: 482 KKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIITKTPGTFKAR 541

Query: 602 LAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERRIQLSE 661
           LAK+++P+IK+VHPDW+FECL+ WK V+EK YELL+EQ VS++EL DF +KLE   + ++
Sbjct: 542 LAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVSEEELDDFKKKLENEKKDAQ 601

Query: 662 LKDEGLYNKLPDGNIDINEVNLFAGGTSWL 691
           +++E          +  +E+NL AG  SWL
Sbjct: 602 IQEEV-------DRVSSDEINLLAGNDSWL 624

>Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {ON}
           YMR277W (FCP1) - TFIIF interacting component of CTD
           phosphatase [contig 37] FULL
          Length = 743

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/580 (58%), Positives = 426/580 (73%), Gaps = 24/580 (4%)

Query: 116 FDCPYDGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDID--- 172
           FD P +G L S  V  GD+ V  +  + E+++PC+H+V YG LC +CGK VDE+D +   
Sbjct: 66  FDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCGKAVDEDDSNMSG 125

Query: 173 -DLSGPNLTISHTDTNLKISTREAVDIGQSVXXXXXXXXXXXXXXXXXQTVIHCGVDPTI 231
             +S   LT++H +TN+K+S R+A  I ++                  QTVIHCGVDPTI
Sbjct: 126 SGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLDQTVIHCGVDPTI 185

Query: 232 GEWKRDPTNPNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKV 291
            EW  DP+NPN++ LK+VK F+L+E+PILP  YMGP+PP R+C YYVK+RPGL++FF KV
Sbjct: 186 KEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRRCQYYVKLRPGLQEFFDKV 245

Query: 292 APLFEMHIYTMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMV 351
           AP FE+HIYTMATRAYA EIAKIIDPT  LFG+RILSRDENGSLT KSLERLFP DQSMV
Sbjct: 246 APHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKSLERLFPMDQSMV 305

Query: 352 IIIDDRGDVWNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTK 411
           +IIDDRGDVW+W  NLIKV+PYNFFVGVGDINSNFLP+QQ +ML +GRR  +        
Sbjct: 306 VIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGRRHRK------KA 359

Query: 412 ENDDLLTDIMDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSA 471
           E ++LLTDIMDTEK LQ KI++EVK+QEEK N      EE       +KE+++KK+E++A
Sbjct: 360 EEEELLTDIMDTEKKLQEKIDQEVKKQEEKFN---KISEENQPDRSMSKEDLTKKLEHNA 416

Query: 472 SLEVQQKNRPLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIE 531
           SLEVQQ+NRPLA LQKH ++Q+LLIDDD+EL HL + L  +H  YYE L K       + 
Sbjct: 417 SLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEELAKT-----EVF 471

Query: 532 PDIKYIMPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVI 591
           PDIK +MPQMK  V   CHFVFSGLIPLGTNI+ +DIV+WTNMFGA++++DIDENTTHVI
Sbjct: 472 PDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHVI 531

Query: 592 TKTPGTYKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNR 651
           TKTPGT+KARLAKSY+PDIKIVHPDW+FECL++W   +EKPYEL++EQ VS  EL +F R
Sbjct: 532 TKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELEEFQR 591

Query: 652 KLERRIQLSELKDEGLYNKLPDGNIDINEVNLFAGGTSWL 691
            L++R    +   E L  +  +      E+NL AG   WL
Sbjct: 592 NLKKRQMAEKAARESLQQETGE------ELNLLAGNDMWL 625

 Score = 48.1 bits (113), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 1  MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDE 53
          M TP  IR P  LP+PITI +L    G  + K  RL  YK+W + ++ T+P+E
Sbjct: 1  MTTP--IRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNE 51

>Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar to
           Ashbya gossypii ABL127W
          Length = 751

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/698 (51%), Positives = 461/698 (66%), Gaps = 68/698 (9%)

Query: 1   MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEXXXXX 60
           M+TP  IR P  LPYPIT+ +L    G  + +  RL AYK+W   +I TSP +       
Sbjct: 1   MSTP--IRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGD------- 51

Query: 61  XXXXXXXXXXXXXTINGNNVTNLTNRPSIEPISRNTITHAHXXXXXXTVRESIEFFDCPY 120
                             +    + R  I+ +                       FD P 
Sbjct: 52  -----------------ESAGGKSKRQRIDLVGT---------------------FDSPV 73

Query: 121 DGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEV-DENDIDDL--SGP 177
            G + S  +  GD+ V     + EI++PC HDV YGGLC  CG+ V DE     L  +  
Sbjct: 74  SGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQCGQTVEDEQTSGSLLDNQA 133

Query: 178 NLTISHTDTNLKISTREAVDIGQSVXXXXXXXXXXXXXXXXXQTVIHCGVDPTIGEWKRD 237
            LT+SHT+ N++IS ++A  + +S                  QTVIHCGVDPTIGEW +D
Sbjct: 134 KLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDLDQTVIHCGVDPTIGEWSKD 193

Query: 238 PTNPNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLFEM 297
           P NPN+E+LKDV+ F+L EEP+LP  YMGPKPP RKCWYYVK+RPGL+DFF  +AP FE+
Sbjct: 194 PDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYVKLRPGLQDFFSNIAPHFEL 253

Query: 298 HIYTMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDR 357
           HIYTMATR YA EIAKIIDP G LFG+RILSRDENGSLT KSLERLFP DQSMV+IIDDR
Sbjct: 254 HIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQKSLERLFPMDQSMVVIIDDR 313

Query: 358 GDVWNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDLL 417
           GDVWNW  NLIKV+PY+FFVG+GDINSNFLP+QQ +ML LGRR+ +       K++++LL
Sbjct: 314 GDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLGRRNRK-----KLKQDEELL 368

Query: 418 TDIMDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQ 477
           TDI+DTEK L+ KI+EEVKRQEE++  +L+  + P  T   +KE+I+KK+E++ASLEVQQ
Sbjct: 369 TDILDTEKKLKVKISEEVKRQEEEM-QKLSEEKIPDHTT--SKEDIAKKLEHNASLEVQQ 425

Query: 478 KNRPLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYI 537
           +NRPLA LQKH H++RLLIDDD+EL HL D L ++HS YY+ L+K       + PDIK++
Sbjct: 426 QNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKNKHGATELSPDIKHL 485

Query: 538 MPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGT 597
           +P +K+ V + C+FVFSGLIPL TNI ++DIV+WTN FGA++T +ID NTTH+ITKTPGT
Sbjct: 486 IPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINIDYNTTHLITKTPGT 545

Query: 598 YKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERRI 657
            KARLA S++ DIKIVHPDW+FEC++ WK V+EKPYEL+VE+ VS + L +F ++LE   
Sbjct: 546 MKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVSKEYLENFKKELEETE 605

Query: 658 QLSELKDEGL----YNKLPDGNIDINEVNLFAGGTSWL 691
           +     D  +    Y    D  I      L  G  SWL
Sbjct: 606 KSKNSVDANISSQKYETFNDAMI------LLGGSDSWL 637

>ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR277W (FCP1)
          Length = 728

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/540 (61%), Positives = 415/540 (76%), Gaps = 15/540 (2%)

Query: 116 FDCPYDGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDE--NDIDD 173
           FD P  G + S  V  GD+ V   +P+ EI++ C HDV YGGLC  CG+ V++     D 
Sbjct: 68  FDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQAVEDEAGAADG 127

Query: 174 LSGPNLTISHTDTNLKISTREAVDIGQSVXXXXXXXXXXXXXXXXXQTVIHCGVDPTIGE 233
           +    LT+SHT+T++++S R+A  +GQS                  QTVIHCGVDPTIGE
Sbjct: 128 VEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTVIHCGVDPTIGE 187

Query: 234 WKRDPTNPNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAP 293
           W +DP NPN+E LKDV+ F+L+EEP+LP  YMGPKPP RKCWYYVK+RPGLK+FF K+AP
Sbjct: 188 WSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVKLRPGLKEFFAKIAP 247

Query: 294 LFEMHIYTMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVII 353
            FE+HIYTMATRAYA EIAKIIDP G LFG+RILSRDENGSLT KSLERLFP DQSMV++
Sbjct: 248 HFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSLERLFPMDQSMVVV 307

Query: 354 IDDRGDVWNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKEN 413
           IDDRGDVWNW  NLIKV+PY+FFVG+GDINSNFLP QQ +ML LGRR+ +       K+ 
Sbjct: 308 IDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRRNRK-----KPKQE 362

Query: 414 DDLLTDIMDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASL 473
           ++LLTDI+DTEK L+ KINEEVKRQE+++ H+L T E+ P T      +I+KK+E++ASL
Sbjct: 363 EELLTDILDTEKKLKEKINEEVKRQEDQM-HRL-TDEKLPDT-----RDIAKKLEHNASL 415

Query: 474 EVQQKNRPLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPD 533
           EVQQ+NRPLA LQKH  ++RLL DDD+EL HL + L K+HS YY+ LQ+ N  +D I PD
Sbjct: 416 EVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGEDPI-PD 474

Query: 534 IKYIMPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITK 593
           IK +MP++K+TV + C FVFSGLIPL TNI+++DIV+WTNMFGA +TA++D NTTH+IT+
Sbjct: 475 IKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTHLITR 534

Query: 594 TPGTYKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKL 653
           TPGT KARLAKS++P IKIVHPDW+FECL+ W+ VEE PYEL+VE+ V ++ L +F R L
Sbjct: 535 TPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLENFKRDL 594

>KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase ,
          Length = 719

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/580 (56%), Positives = 416/580 (71%), Gaps = 23/580 (3%)

Query: 116 FDCPYDGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLS 175
           FD P  G +  W     D+    N  +  I++ CNHD+ YGGLC  CG  VDE D    +
Sbjct: 66  FDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGNTVDEED----N 121

Query: 176 GPNLTISHTDTNLKISTREAVDIGQSVXXXXXXXXXXXXXXXXXQTVIHCGVDPTIGEWK 235
             NLTISH +TN+K+S ++A  + +S                  QTVIHCGVDPTIGEW 
Sbjct: 122 SKNLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIHCGVDPTIGEWM 181

Query: 236 RDPTNPNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLF 295
           RDP NPN++ L+DVK F LE+EPI+P  Y GPKPPARK WYYVK+RPGLK+FF+ V+P F
Sbjct: 182 RDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGLKEFFEAVSPHF 241

Query: 296 EMHIYTMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIID 355
           EMHIYTMATR+YA EIAKIIDPTG+LFG+RILSRDENGSLTTKSLERLFP DQSMV++ID
Sbjct: 242 EMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLFPMDQSMVVVID 301

Query: 356 DRGDVWNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDD 415
           DRGDVWNW  NLIKV+PY+FFVG+GDINSNFLP+QQ ++L LGR   R +      E + 
Sbjct: 302 DRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHHRRKQ------EEEK 355

Query: 416 LLTDIMDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEV 475
           L++DI+D EK L+ KI+EEVKRQEE ++H +            NKE+ISKK+E+SASLEV
Sbjct: 356 LISDIIDNEKKLKEKIDEEVKRQEEIISH-IGDDNTRKEGGPPNKEDISKKLEHSASLEV 414

Query: 476 QQKNRPLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIK 535
           QQ+NRPLA LQKH H+Q LLIDDD+EL HL   L ++H +Y+    +A +N     PDIK
Sbjct: 415 QQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAPKNP----PDIK 470

Query: 536 YIMPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTP 595
           Y++PQMK  V Q CHFVFSGLIPL T+++K+DIV+WT+MFGA +++DI+  TTH+IT T 
Sbjct: 471 YLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKTTHIITTTS 530

Query: 596 GTYKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLER 655
            T+KARLAKS++PDIKIVHPDW+FECL++W+ V+E PYELL++  V + ++ +F  KL++
Sbjct: 531 RTFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPVDEDKVKEFKEKLDK 590

Query: 656 RIQLSELKDEGLYNKLPDGNID----INEVNLFAGGTSWL 691
           +I           N   DGN D     +E +L AG  SWL
Sbjct: 591 KIS----NPSSSVNPFEDGNEDEEVLGDEFHLLAGNDSWL 626

 Score = 38.5 bits (88), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%)

Query: 1  MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFW 42
          M+  T ++    LPYPIT+ +L    G  + K  RL AY++W
Sbjct: 1  MSLETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYW 42

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/578 (56%), Positives = 422/578 (73%), Gaps = 24/578 (4%)

Query: 113 IEFFDCPYDGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDID 172
           I  FD P +G L S  +  GD+ V     + E+ + C+H+V YGGLC +CGK V+E+D +
Sbjct: 63  IGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCGKTVEEDDQN 122

Query: 173 ----DLSGPNLTISHTDTNLKISTREAVDIGQSVXXXXXXXXXXXXXXXXXQTVIHCGVD 228
                +S   LT++H +TN+K+S R+A  I ++                  QTVIHCGVD
Sbjct: 123 VSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLDQTVIHCGVD 182

Query: 229 PTIGEWKRDPTNPNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFF 288
           PTI EW  DP+NPN++ LK+VK F+L+E+PILP  YMGP+PP RKC YYVK+RPGL++FF
Sbjct: 183 PTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRKCQYYVKLRPGLQEFF 242

Query: 289 QKVAPLFEMHIYTMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQ 348
            K+AP FE+HIYTMATRAYA EIAKIIDP G+LFG+RILSRDENGSLT KSLERLFP DQ
Sbjct: 243 DKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKSLERLFPMDQ 302

Query: 349 SMVIIIDDRGDVWNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKV 408
           SMV+IIDDRGDVW+W  NLIKV+PYNFFVGVGDINSNFLP+QQ +ML LGRR+ +     
Sbjct: 303 SMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGRRNRK----- 357

Query: 409 STKENDDLLTDIMDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIE 468
              E ++LLTDIMDTEK LQ KI++EVK+QEEK N      EE       +KE+++KK+E
Sbjct: 358 -KAEEEELLTDIMDTEKKLQEKIDQEVKKQEEKFN---KINEENQPERPISKEDLTKKLE 413

Query: 469 YSASLEVQQKNRPLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKD 528
           ++ASLEVQQ+NRPLA LQKH ++Q+LL DDD+EL HL + L  +H  YY+ L +  +   
Sbjct: 414 HNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAEQGQ--- 470

Query: 529 SIEPDIKYIMPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTT 588
              PDIK +MPQMK  V + CHFVFSGLIPLGTN++++DIV+WT+MFGA ++ D+DE TT
Sbjct: 471 --PPDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATT 528

Query: 589 HVITKTPGTYKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELAD 648
           HVITKTPGT+KARLAK+Y+P+IK++HPDW+FECL++W  V EKPYEL  EQ VS +EL +
Sbjct: 529 HVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELEE 588

Query: 649 FNRKLERRIQLSELKDEGLYNKLPDGNIDINEVNLFAG 686
           F ++L+++ Q  +   E +  +         E+NL  G
Sbjct: 589 FKKRLDKKKQSEKALSESIQQEA------TQELNLLTG 620

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 1  MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDE 53
          M TP  IR P  LP+P+TI +L    G  + K  RL  YK+W + +I T+P+E
Sbjct: 1  MTTP--IRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNE 51

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 47/92 (51%), Gaps = 3/92 (3%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLT 336
           YV  RPG+  F Q  + LFE+ I+T +   Y + +  I+D T DL  +R+  RD   +  
Sbjct: 217 YVIKRPGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDILDSTNDLVHHRLF-RDACYNYN 275

Query: 337 TKSLERLFPTDQSM--VIIIDDRGDVWNWSPN 366
              ++ L    + +  +II+D+    + + PN
Sbjct: 276 GNYIKNLAQLGRPLSDIIILDNSPTSYLFHPN 307

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDPTGDLFGNRIL 327
           YV  RPG+++F ++V  LFE+ ++T +   Y   +  I+DP   L  +R+ 
Sbjct: 340 YVIKRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDILDPGRQLIHHRLF 390

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDPTGDLFGNRIL 327
           YV  RPG+ +F +KV  LFE+ I+T +   Y   +   +DP G    +R+ 
Sbjct: 381 YVIKRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKGKSIHHRLF 431

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 30/51 (58%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDPTGDLFGNRIL 327
           YV  RPG+ +F ++V+ L+E+ ++T +   Y   +  I+DP   +  +R+ 
Sbjct: 361 YVIKRPGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILDPANTIIHHRLF 411

>Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932
           aa] {ON} (148944..151325,151327..151743) [2799 nt, 933
           aa]
          Length = 932

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 46/94 (48%), Gaps = 6/94 (6%)

Query: 545 VLQDCHFVFSGLIPLGT-NIQKSDIVIWTNMFGARSTADIDENTTHVITKTPG--TYKAR 601
           +L+DC    S  +   T NI  S+++   N  G   +  I   TTH+I+  P      A 
Sbjct: 122 ILKDCTIYVSRTVFNRTENILYSELI---NALGGSVSDMISNKTTHLISSDPTDPALIAI 178

Query: 602 LAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYEL 635
           +A      IK V+P W+ +C +  K+V+EK + L
Sbjct: 179 VASDCHSRIKQVYPAWLCQCFLEVKYVDEKNFIL 212

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 27/43 (62%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDPTG 319
           YV  RPG+ +F  +V+ L+E+ ++T +   YA+ +   +DP G
Sbjct: 265 YVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNG 307

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 26/43 (60%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDPTG 319
           YV  RPG+ +F  +V  L+E+ ++T +   YA+ +   +DP G
Sbjct: 260 YVIKRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPNG 302

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 26/43 (60%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDPTG 319
           YV  RPG+ +F ++V  L+E+ ++T +   Y   +  I+DP G
Sbjct: 267 YVIKRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPRG 309

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 27/43 (62%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDPTG 319
           YV  RPG+ +F  +V+ ++E+ ++T +   YA+ +   +DP G
Sbjct: 260 YVIKRPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPNG 302

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 38.9 bits (89), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIID 316
           YV  RPG+ +F +KV  LFE+ I+T +   Y   +  I+D
Sbjct: 350 YVMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILD 389

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 37.7 bits (86), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDP 317
           YV  RPG+ +F  +V+ L+E+ ++T +   YA+ +   +DP
Sbjct: 253 YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDP 293

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 25/41 (60%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDP 317
           YV  RPG+ +F + V  L+E+ ++T +   Y + +  I+DP
Sbjct: 320 YVSKRPGVDEFLKIVGDLYEVIVFTASVSRYGNPLMDILDP 360

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 27/45 (60%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDPTGDL 321
           YV  RPG+ +F Q+V  L+E+ ++T +   Y   +  ++D + ++
Sbjct: 315 YVIKRPGVDEFLQRVGELYEVVVFTASVSRYGDPLLDVLDKSNNI 359

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 27/45 (60%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDPTGDL 321
           YV  RPG+ +F ++VA L+E+ ++T +   Y   +  I+D +  +
Sbjct: 259 YVIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSSNSI 303

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIID 316
           YV  RPG+++F ++V  LFE+ ++T +   Y   +  I+D
Sbjct: 295 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 334

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDPTGDLFGNRIL 327
           YV  RPG+++F ++V  LFE+ ++T +   Y   +  I+D T  +  +R+ 
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD-TNKVIHHRLF 332

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIID 316
           YV  RPG+++F ++V  LFE+ ++T +   Y   +  I+D
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 322

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIID 316
           YV  RPG+++F ++V  LFE+ ++T +   Y   +  I+D
Sbjct: 282 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 321

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIID 316
           YV  RPG+ +F ++V  LFE+ ++T +   Y   +  I+D
Sbjct: 346 YVIKRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILD 385

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 26/45 (57%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDPTGDL 321
           YV  RPG+ +F ++V  L+E+ ++T +   Y   +  I+D +  +
Sbjct: 266 YVIKRPGVDEFLKRVGELYEVVVFTASVSRYGDPLLNILDQSNSV 310

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 29/51 (56%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDPTGDLFGNRIL 327
           YV  RPG+  F ++V   +E+ I+T +   YA+ +  ++D   +L  +R+ 
Sbjct: 351 YVIKRPGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNLINHRLF 401

>KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.94
           YHR154W
          Length = 951

 Score = 36.2 bits (82), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 42/82 (51%), Gaps = 4/82 (4%)

Query: 559 LGTNIQKSDIVIWTNM---FGARSTADIDENTTHVITKTPG-TYKARLAKSYDPDIKIVH 614
           L  + + S+ +++T +    G     +I+  TTH+IT  P  +    L ++    IK ++
Sbjct: 133 LKPSFEASEYLLYTELIHSMGGTCVENINNKTTHIITTNPKESCFEILKRNGTTSIKYIY 192

Query: 615 PDWVFECLMRWKHVEEKPYELL 636
           P W+  C+   + ++E  +E++
Sbjct: 193 PTWLIHCVKESQLIDESEHEIV 214

>KLLA0E16655g Chr5 (1479322..1481292) [1971 bp, 656 aa] {ON} similar
           to uniprot|Q05580 Saccharomyces cerevisiae YDR266C
           Hypothetical ORF
          Length = 656

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 59/140 (42%), Gaps = 4/140 (2%)

Query: 393 TMLQLGRRSSRGESKVSTKENDDLLTDIMDTEKVLQRKINEEVKRQEEKLNHQLATIEEP 452
            M  +   S +  S+++T  N   + D  + E       + + +R E++  H L    EP
Sbjct: 344 AMTLIDNTSKKFRSQITTFSNPTRIIDAQNEESNSANSRDVKRRRMEQRARHYLGN-SEP 402

Query: 453 PTTAGENKEEISKKIEYSASLEVQQKNRPLATLQKHFHDQRLLIDDDEELYHLKDTLSKI 512
              +     ++  K E SA  E+Q K   L   ++H  D +LLI D  ELYH      K 
Sbjct: 403 DFQSFLIINDLFNKNEISAQ-ELQSKYEDL--FKQHADDIQLLIYDLSELYHSTSDKHKR 459

Query: 513 HSKYYEMLQKANENKDSIEP 532
               YE + K  EN    +P
Sbjct: 460 LRAIYEGIMKKKENAGKFKP 479

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 35.8 bits (81), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 25/42 (59%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDPT 318
           YV  RPG+ +F ++V  +FE+ ++T +   Y   +  I+D +
Sbjct: 345 YVIKRPGVDEFLKRVGKIFEVVVFTASVSRYGDPLLDILDSS 386

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 35.4 bits (80), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 24/40 (60%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIID 316
           YV  RPG+ +F ++V  L+E+ ++T +   Y   +  I+D
Sbjct: 321 YVIKRPGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILD 360

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 35.0 bits (79), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 24/40 (60%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIID 316
           YV  RPG+ +F ++V  L+E+ ++T +   Y   +  I+D
Sbjct: 278 YVIKRPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILD 317

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 35.4 bits (80), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 24/40 (60%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIID 316
           YV  RPG+ +F ++V  L+E+ ++T +   Y   +  I+D
Sbjct: 360 YVIKRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILD 399

>NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5.94
           YHR154W
          Length = 1034

 Score = 35.4 bits (80), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 51/109 (46%), Gaps = 8/109 (7%)

Query: 550 HFVFSGLIPLGT-NIQKSDIVIWT---NMFGARSTADIDENTTHVITKT---PGTYKARL 602
           HF  +  I + T +++ S+ + ++   N  G   T  I+  TTH+I      P     + 
Sbjct: 131 HFFRNFQICISTYSMKFSEYIFYSELINSLGGTITHVINNKTTHLIAIAIDDPAIIAIKE 190

Query: 603 AKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNR 651
               +  IK V+P W+ +C    K+++E P+ L+ E   + + L D  R
Sbjct: 191 KGQNNTIIKSVYPTWLVQCFKERKYIDESPH-LITEDQNNSEHLDDIWR 238

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 24/120 (20%), Positives = 51/120 (42%), Gaps = 13/120 (10%)

Query: 530 IEPDIKYIMPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTH 589
           + P+   +    K+ + +    + +     G   Q+S I   T M G  ST ++ +  TH
Sbjct: 341 VPPNTNLLFEPFKKKIFKSSELILTYTNYFGR--QRSYIQRLTEMLGGISTTELSKRNTH 398

Query: 590 VITKTPGTYKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADF 649
           ++++ P   K   AK +    ++++  W+           E+ Y+  ++Q  +  E  DF
Sbjct: 399 LVSRMPVGKKFFQAKKWKDRCQVINHLWL-----------ERTYKTGIKQDPNSSEFQDF 447

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 35.0 bits (79), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 24/40 (60%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIID 316
           YV  RPG+ +F ++V  L+E+ ++T +   Y   +  I+D
Sbjct: 349 YVIKRPGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILD 388

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 35.0 bits (79), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 53/110 (48%), Gaps = 10/110 (9%)

Query: 271 ARKCWYYVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDP-----TGDLFGNR 325
           ++K  +    RPG   F   ++  FE+ +++     Y+ +IA+ +DP     + +LF   
Sbjct: 208 SQKYGWRTAKRPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEH 267

Query: 326 ILSRDENGSLTTKSLERLFPTDQSMVIIIDDRGDVWNWSP-NLIKVIPYN 374
            + +D    +  K L +L   D S VIIID   + +   P N I + P+N
Sbjct: 268 CVYKD---GVHIKDLSKL-NRDLSKVIIIDTEPNSYKLQPENAIPMDPWN 313

>NDAI0G05520 Chr7 complement(1356809..1359307) [2499 bp, 832 aa]
           {ON} Anc_1.276 YJL090C
          Length = 832

 Score = 35.0 bits (79), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 577 ARSTADIDENTTHVITKTPGTYKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELL 636
           AR     + N   V   T   Y AR+  + D +I IVH  WV +C +R   +E  P + L
Sbjct: 156 ARDAVSKNPNREFVFI-TDSIYGARVEAARDENIPIVHHKWVIDCHIRGAKLEFDP-DYL 213

Query: 637 VEQLV 641
           +E +V
Sbjct: 214 LENVV 218

>KNAG0E00570 Chr5 (95945..98890) [2946 bp, 981 aa] {ON} Anc_5.94
           YHR154W
          Length = 981

 Score = 35.0 bits (79), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 3/91 (3%)

Query: 532 PDIKYIMPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVI 591
           P  K I   +KQ+V++    + S     G  +Q+S I   T   G  ST  + +  TH++
Sbjct: 335 PSSKIIWGPLKQSVVRSDELILSFTNYFG--LQRSYIQRITERLGGVSTTSLTKRNTHLV 392

Query: 592 TKTPGTYKARLAKSYDPD-IKIVHPDWVFEC 621
           ++     K  LAK +     ++V+  W+ EC
Sbjct: 393 SRMAIGKKFELAKQWGGQRCRVVNHLWLEEC 423

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 24/40 (60%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIID 316
           YV  RPG+ +F ++V  +FE+ ++T +   Y   +  ++D
Sbjct: 351 YVIKRPGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLD 390

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 23/40 (57%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIID 316
           YV  RPG+  F + V+ +FE+ ++T +   Y   +  ++D
Sbjct: 556 YVIKRPGVDQFLETVSKIFEVVVFTASVSRYGDPLLDVLD 595

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 53/110 (48%), Gaps = 10/110 (9%)

Query: 271 ARKCWYYVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDP-----TGDLFGNR 325
           ++K  +    RPG   F   ++  FE+ +++     Y+ +IA+ +DP     + +LF   
Sbjct: 213 SQKYGWRTAKRPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAEKLDPIHAFVSYNLFKEH 272

Query: 326 ILSRDENGSLTTKSLERLFPTDQSMVIIIDDRGDVWNWSP-NLIKVIPYN 374
            + +D    +  K L +L   D S VIIID   + +   P N I + P+N
Sbjct: 273 CVYKD---GVHIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIPMEPWN 318

>KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 409

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 23/40 (57%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIID 316
           YV  RPG+ DF + V  L+E+ ++T +   Y   +  ++D
Sbjct: 277 YVIKRPGVDDFLRLVGQLYEVVVFTASVSRYGDPLLDVLD 316

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 24/40 (60%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIID 316
           YV  RPG+ +F +++  L+E+ ++T +   Y   +  I+D
Sbjct: 282 YVIKRPGVDEFLRRITELYEVVVFTASVSRYGDPLLDILD 321

>Ecym_4460 Chr4 (939029..941224) [2196 bp, 731 aa] {ON} similar to
           Ashbya gossypii ADR023C
          Length = 731

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 47/93 (50%), Gaps = 11/93 (11%)

Query: 316 DP-TGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDRGDVWNWSP---NLIKVI 371
           DP  G L   R LS+ +   L    LER      S+V + D R +++N+ P   N+IK+ 
Sbjct: 86  DPFVGGLTSLRGLSKSKPNRLA-HGLERCLFEPMSIVPLKDRRSNIYNFKPFLENIIKLK 144

Query: 372 PYNFFVGVGDINSNFLPKQ-QATMLQLGRRSSR 403
            +NF     D  + F+P    + +L+L R+ S+
Sbjct: 145 DFNF-----DAITGFVPPSLDSRLLELARKHSK 172

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 24/42 (57%)

Query: 277 YVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDPT 318
           YV  RPG+ +F + V  L+E+ ++T +   Y   +  ++D T
Sbjct: 278 YVIKRPGVDEFLKLVGQLYEVVVFTASVSRYGDPLLDVLDQT 319

>KNAG0B01830 Chr2 complement(341951..344209) [2259 bp, 752 aa] {ON}
           Anc_1.276 YJL090C
          Length = 752

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 26/49 (53%)

Query: 587 TTHVITKTPGTYKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYEL 635
           +++VI  +   +  R+  +   DI IVHP W+ +C  R   +E  P+ L
Sbjct: 164 SSNVIFISDTLHGVRIESAMAEDIPIVHPKWIMDCHRRHGTLEYDPFYL 212

>TPHA0A05110 Chr1 (1149460..1152657) [3198 bp, 1065 aa] {ON}
           Anc_5.94 YHR154W
          Length = 1065

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 29/60 (48%)

Query: 575 FGARSTADIDENTTHVITKTPGTYKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYE 634
            G +ST  + +  TH+I   P   K   A+S    I +V+  W+ +C++    V E  +E
Sbjct: 374 LGGKSTPTLSKRNTHLIFGVPYGKKYNYARSKLNKINVVNIKWLEQCVLLKSRVPENLFE 433

>SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 879

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 41/95 (43%), Gaps = 2/95 (2%)

Query: 527 KDSIEPDIKYIMPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDEN 586
           ++ I P  K ++  ++  +      + S    LG   Q+  I       G  ST ++ + 
Sbjct: 322 QEFISPSSKLLLSPLRPKIFHKNELLLSYTNYLGQ--QRFYIQKLVEALGGASTTELSKK 379

Query: 587 TTHVITKTPGTYKARLAKSYDPDIKIVHPDWVFEC 621
            THV++  P   K + A  +    K+V+  W+ EC
Sbjct: 380 NTHVLSCMPYGQKYQAAVRWSDTCKVVNHLWLEEC 414

>SAKL0H20592g Chr8 complement(1805321..1806847) [1527 bp, 508 aa]
           {ON} some similarities with uniprot|Q12114 Saccharomyces
           cerevisiae YLR330W CHS5 Protein of unknown function
           involved in chitin biosynthesis by regulating Chs3p
           localization also involved in cell fusion during mating
          Length = 508

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 1/68 (1%)

Query: 562 NIQKSDIVIWTNMFGARSTAD-IDENTTHVITKTPGTYKARLAKSYDPDIKIVHPDWVFE 620
            + K+ I    +  GA++  D +  +TTH I     +    L K+ + +I +V P+WV  
Sbjct: 185 GVTKNQIETSLSNIGAKALQDHVGLDTTHFICNEKDSEDPELEKAQNSNIPVVRPEWVRA 244

Query: 621 CLMRWKHV 628
           C +  + V
Sbjct: 245 CELERRIV 252

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 49/100 (49%), Gaps = 10/100 (10%)

Query: 281 RPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDP-----TGDLFGNRILSRDENGSL 335
           RPG   F   ++  +E+ +++     Y+ +IA+ +DP     + +LF    + +D    +
Sbjct: 218 RPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 274

Query: 336 TTKSLERLFPTDQSMVIIIDDRGDVWNWSP-NLIKVIPYN 374
             K L +L   D S VIIID   + +   P N I + P+N
Sbjct: 275 HIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIPMEPWN 313

>TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5.94
           YHR154W
          Length = 1015

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 38/88 (43%), Gaps = 5/88 (5%)

Query: 563 IQKSDIVIWT---NMFGARSTADIDENTTHVITKTPG--TYKARLAKSYDPDIKIVHPDW 617
             K++++ ++   N  G  +   I   TTH+IT  P      A +A     +I  V+P W
Sbjct: 132 FNKTEVLFYSELINALGGTTVDHISTLTTHLITNDPTDQAVIATIASEQKQNISFVYPTW 191

Query: 618 VFECLMRWKHVEEKPYELLVEQLVSDKE 645
           + +C      V E  + + ++    D +
Sbjct: 192 LCQCFKSMTLVNESDHLINIQSSAEDSK 219

>Kwal_14.1042 s14 complement(168504..171242) [2739 bp, 912 aa] {ON}
           YHR154W (RTT107) - involved in silencing [contig 244]
           FULL
          Length = 912

 Score = 33.1 bits (74), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 5/92 (5%)

Query: 535 KYIMPQMKQTV--LQDCHFVFSGLIPLGTNI---QKSDIVIWTNMFGARSTADIDENTTH 589
           ++I+P  K  +  L+ C F  S L+   TN    Q+  I       G +ST ++ +  TH
Sbjct: 324 RFILPSEKLLLSPLRPCIFQKSELVLSYTNYMGQQRHYIQRLVEALGGKSTTELTKKNTH 383

Query: 590 VITKTPGTYKARLAKSYDPDIKIVHPDWVFEC 621
           +++  P   K   A  +  +  IV+  W+ +C
Sbjct: 384 LLSCLPHGQKYEAASRWGNNCIIVNHLWLEDC 415

>ZYRO0G15180g Chr7 (1223984..1226050) [2067 bp, 688 aa] {ON} similar
           to uniprot|P47027 Saccharomyces cerevisiae YJL090C DPB11
           Essential BRCT repeat protein required on the
           prereplicative complex at replication origins for
           loading DNA polymerases to initiate DNA synthesis also
           required for S/M checkpoint control
          Length = 688

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 13/64 (20%)

Query: 586 NTTHVI----TKTPGTYKARLAKSYDP---------DIKIVHPDWVFECLMRWKHVEEKP 632
           N+TH      TK+ GT    ++ S D           I I+HP WV +C  R   +E  P
Sbjct: 136 NSTHFTKDCQTKSQGTLVVFVSDSLDGIRVKAAMELGIPIIHPKWVLDCHKRNALLEFDP 195

Query: 633 YELL 636
           Y LL
Sbjct: 196 YYLL 199

>Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON}
           (138268..141444) [3177 nt, 1059 aa]
          Length = 1058

 Score = 32.7 bits (73), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 38/81 (46%), Gaps = 3/81 (3%)

Query: 556 LIPLGTNI---QKSDIVIWTNMFGARSTADIDENTTHVITKTPGTYKARLAKSYDPDIKI 612
           LI   TN+   Q++ I   TN  G  +TA +      ++   P   K + A+ +   + I
Sbjct: 349 LILTYTNLFGPQRTYIKTLTNALGGVTTATLSHINNCLVYGIPEGMKYKTAEKWGDKLII 408

Query: 613 VHPDWVFECLMRWKHVEEKPY 633
           V P+W+ EC    K ++ K +
Sbjct: 409 VGPNWLEECYKANKKLDPKLF 429

>Kwal_23.5731 s23 complement(1296239..1298104) [1866 bp, 621 aa]
           {ON} YDR295C (PLO2) - Ploidy-related [contig 11] FULL
          Length = 621

 Score = 32.7 bits (73), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 44/78 (56%), Gaps = 8/78 (10%)

Query: 605 SYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERRIQLSELKD 664
           ++D D+K+     + E +++  +  EK Y +  E+++S +      R+  R+ +L E+K+
Sbjct: 365 NHDLDMKLYQAK-MMEMIVQRLNASEKEYSVRQEEVLSKRL-----RETMRQNELDEMKE 418

Query: 665 EG--LYNKLPDGNIDINE 680
           E   +Y KL DG  D+NE
Sbjct: 419 ESGRMYKKLKDGEGDLNE 436

>AFR095C Chr6 complement(604687..606699) [2013 bp, 670 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL090C
           (DPB11)
          Length = 670

 Score = 32.0 bits (71), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 17/26 (65%)

Query: 610 IKIVHPDWVFECLMRWKHVEEKPYEL 635
           + +VHP WV +C+ R   VE + YEL
Sbjct: 178 VAVVHPKWVTDCVRRGAVVEMEEYEL 203

>Kpol_1059.29 s1059 complement(61291..63867) [2577 bp, 858 aa] {ON}
           complement(61291..63867) [2577 nt, 859 aa]
          Length = 858

 Score = 32.0 bits (71), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 39/81 (48%), Gaps = 3/81 (3%)

Query: 511 KIHSKYYEMLQKANENKDSIEPDIKYIMPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVI 570
           K ++K+      AN++ D    DI   +P+ +   L     VF+G++P    +++ +   
Sbjct: 113 KENAKFDFRAAAANKSSDVDMDDIAGDIPEGRPNCLLGLTIVFTGVLP---TLERGNAET 169

Query: 571 WTNMFGARSTADIDENTTHVI 591
               +GAR T+ I   T+ V+
Sbjct: 170 LAKRYGARVTSSISRKTSVVV 190

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.134    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 80,056,710
Number of extensions: 3542744
Number of successful extensions: 15216
Number of sequences better than 10.0: 277
Number of HSP's gapped: 15827
Number of HSP's successfully gapped: 311
Length of query: 778
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 660
Effective length of database: 39,950,811
Effective search space: 26367535260
Effective search space used: 26367535260
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 70 (31.6 bits)